Psyllid ID: psy18049

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MQTTTMTITTENRNPFQNCFLVSISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTRTPLDLPPPATPTPGARGDGFISPTGSARSLSFSTPGPGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNLGM
ccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEEcccccccccEEEEEEcccccccccEEccEEEEEcccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccEEEEEcccccccEEEEEEEEccccccEEEEEEEccccccccccccc
cccccccccccccccccccccccccccccccccccccEEEccEEEEEccEEEEEEEEEccccccccEEEEEEccccccEccEEccEEccccccccEEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEccccccEEEEEEcccccccccEEEEEEccccccccccccc
MQTTTMTittenrnpfqnCFLVsisdssqvltedtdsfiigdrvyvggtksgriafigetkfapgdwagvvlddpvgkndgqvgqaryfqcepkhgifsrltrltrtpldlpppatptpgargdgfisptgsarslsfstpgpglstpakggdirlgDRVIVMSaqgsktgvlrfkgttqfaqgewcgveldepigkndgnlgm
mqtttmtittenrnpfqNCFLVSISDSSQVLTEDtdsfiigdrvyvggTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSrltrltrtpldlpppatptpgargdGFISPTGSARSLSFSTPGPGLSTPAKGGDIRLGDRVIVMSaqgsktgvlrfKGTTQfaqgewcgveldepigkndgnlgm
MQtttmtittENRNPFQNCFLVSISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSrltrltrtpldlpppatptpgargdGFISPTGSARSLSFSTPGPGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNLGM
**************PFQNCFLVSISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLT************************************************IRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELD************
***************************************IGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTRTPLDLPPPATPTPGARGDGFISPTGSARSLSFSTPGPGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDG****
********TTENRNPFQNCFLVSISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTRTPLDLPPPATPTPGARGDGFISPTGSARSLSFSTPGPGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNLGM
***********************************DSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTRT********************************************GDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEP**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTTTMTITTENRNPFQNCFLVSISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTRTPLDLPPPATPTPGARGDGFISPTGSARSLSFSTPGPGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNLGM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q9VJE5 1690 Restin homolog OS=Drosoph yes N/A 0.843 0.101 0.583 9e-52
P30622 1438 CAP-Gly domain-containing yes N/A 0.857 0.121 0.439 4e-41
Q922J3 1391 CAP-Gly domain-containing yes N/A 0.833 0.122 0.433 2e-40
Q9UDT6 1046 CAP-Gly domain-containing no N/A 0.754 0.147 0.455 6e-40
O55156 1046 CAP-Gly domain-containing no N/A 0.754 0.147 0.461 1e-39
Q9Z0H8 1047 CAP-Gly domain-containing no N/A 0.754 0.147 0.450 2e-38
O42184 1433 CAP-Gly domain-containing yes N/A 0.769 0.109 0.409 7e-38
Q5U243534 CAP-Gly domain-containing N/A N/A 0.784 0.299 0.421 2e-29
Q96DZ5547 CAP-Gly domain-containing no N/A 0.779 0.290 0.423 1e-28
Q5R686547 CAP-Gly domain-containing no N/A 0.779 0.290 0.417 1e-27
>sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 Back     alignment and function desciption
 Score =  202 bits (515), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 105/180 (58%), Positives = 125/180 (69%), Gaps = 8/180 (4%)

Query: 26  DSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQ 85
           +SS VLT +T+ FIIG RV++GGT+ G+IAFIG+T FA G+WAGVVLD+P GKNDG V  
Sbjct: 111 NSSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSG 170

Query: 86  ARYFQCEPKHGIFSRLTRLTRTPL-DLPPPATPTPGARGD--GFISPTGSARSLSFSTPG 142
            RYFQCEPK GIFSRLTRLT  PL     P +P   +  D    +SPT S RS    +PG
Sbjct: 171 KRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSPG 230

Query: 143 PGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNL 202
            G     K G + +GDRVIV S  GS+ G+LR+ G TQFA G WCGVELDEP GKNDG +
Sbjct: 231 IG----GKNG-MAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTV 285
Together CLIP-190 and jar may coordinate the interaction between the actin and microtubule cytoskeleton. May link endocytic vesicles to microtubules. May play a role in formation of furrows during cellularization.
Drosophila melanogaster (taxid: 7227)
>sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 Back     alignment and function description
>sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 Back     alignment and function description
>sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 Back     alignment and function description
>sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5U243|CLIP3_XENLA CAP-Gly domain-containing linker protein 3 OS=Xenopus laevis GN=clip3 PE=2 SV=1 Back     alignment and function description
>sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 Back     alignment and function description
>sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
328779692 1608 PREDICTED: restin homolog [Apis mellifer 0.867 0.110 0.65 4e-62
322790005 1584 hypothetical protein SINV_05857 [Solenop 0.848 0.109 0.641 4e-62
383860638 1566 PREDICTED: CAP-Gly domain-containing lin 0.838 0.109 0.632 4e-61
340711263 1639 PREDICTED: CAP-Gly domain-containing lin 0.872 0.108 0.648 1e-60
332027329 1584 CAP-Gly domain-containing linker protein 0.852 0.109 0.646 4e-60
340711265 1609 PREDICTED: CAP-Gly domain-containing lin 0.867 0.110 0.640 1e-59
350411733 1609 PREDICTED: restin homolog [Bombus impati 0.867 0.110 0.640 2e-59
345494045 1659 PREDICTED: CAP-Gly domain-containing lin 0.838 0.103 0.596 4e-59
328794497 325 PREDICTED: restin homolog [Apis mellifer 0.872 0.547 0.657 3e-58
307197537 1595 Restin-like protein [Harpegnathos saltat 0.877 0.112 0.644 7e-57
>gi|328779692|ref|XP_396089.4| PREDICTED: restin homolog [Apis mellifera] Back     alignment and taxonomy information
 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 117/180 (65%), Positives = 137/180 (76%), Gaps = 3/180 (1%)

Query: 26  DSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQ 85
           ++S VLTEDTDSFIIGDRV+VGGTK G IA+IGET+FAPGDWAGVVLD+P+GKNDG V  
Sbjct: 38  NNSVVLTEDTDSFIIGDRVWVGGTKPGAIAYIGETQFAPGDWAGVVLDEPIGKNDGSVAG 97

Query: 86  ARYFQCEPKHGIFSRLTRLTRTPLDLPPPATP---TPGARGDGFISPTGSARSLSFSTPG 142
            RYFQCEPK GIFSRLTRLTRTPL     A+P   TP +  D        + S S +   
Sbjct: 98  CRYFQCEPKRGIFSRLTRLTRTPLPDTTDASPTQKTPTSPPDSSKGSLSKSMSPSLNASM 157

Query: 143 PGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNL 202
             LS+     D+R+GDRVIV S+QGSKTGVLR+ GTT+FA GEWCGVELD+PIGKNDG++
Sbjct: 158 TSLSSTVSQRDLRIGDRVIVSSSQGSKTGVLRYYGTTEFAVGEWCGVELDDPIGKNDGSV 217

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322790005|gb|EFZ15081.1| hypothetical protein SINV_05857 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383860638|ref|XP_003705796.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340711263|ref|XP_003394198.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332027329|gb|EGI67413.1| CAP-Gly domain-containing linker protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340711265|ref|XP_003394199.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350411733|ref|XP_003489438.1| PREDICTED: restin homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|345494045|ref|XP_001606131.2| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328794497|ref|XP_001122870.2| PREDICTED: restin homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|307197537|gb|EFN78767.1| Restin-like protein [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
FB|FBgn0020503 1690 CLIP-190 "Cytoplasmic linker p 0.843 0.101 0.522 1.3e-40
UNIPROTKB|E1BQI8 1040 CLIP2 "Uncharacterized protein 0.367 0.072 0.573 7.3e-36
UNIPROTKB|E2QWB0 1438 CLIP1 "Uncharacterized protein 0.607 0.086 0.419 5.8e-35
UNIPROTKB|E2QWD0 1438 CLIP1 "Uncharacterized protein 0.607 0.086 0.419 5.8e-35
UNIPROTKB|P30622 1438 CLIP1 "CAP-Gly domain-containi 0.377 0.053 0.584 9.5e-35
RGD|67404 1320 Clip1 "CAP-GLY domain containi 0.357 0.055 0.602 1.2e-34
UNIPROTKB|F1MAH8 1320 Clip1 "Protein Clip1" [Rattus 0.357 0.055 0.602 1.2e-34
MGI|MGI:1928401 1391 Clip1 "CAP-GLY domain containi 0.357 0.052 0.602 1.8e-34
UNIPROTKB|F1RJL6 827 CLIP2 "Uncharacterized protein 0.357 0.088 0.547 1.9e-34
UNIPROTKB|E1BGH3 1047 CLIP2 "Uncharacterized protein 0.372 0.072 0.558 3.3e-18
FB|FBgn0020503 CLIP-190 "Cytoplasmic linker protein 190" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 446 (162.1 bits), Expect = 1.3e-40, P = 1.3e-40
 Identities = 94/180 (52%), Positives = 112/180 (62%)

Query:    26 DSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQ 85
             +SS VLT +T+ FIIG RV++GGT+ G+IAFIG+T FA G+WAGVVLD+P GKNDG V  
Sbjct:   111 NSSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSG 170

Query:    86 ARYFQCEPKHGIFSXXXXXXXXXXXXXXXXXXXXXXXX---XGFISPTGSARSLSFSTPG 142
              RYFQCEPK GIFS                              +SPT S RS    +PG
Sbjct:   171 KRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSPG 230

Query:   143 PGLSTPAKGGDIRLGDRVIVMSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNL 202
              G     K G + +GDRVIV S  GS+ G+LR+ G TQFA G WCGVELDEP GKNDG +
Sbjct:   231 IG----GKNG-MAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTV 285
GO:0008017 "microtubule binding" evidence=ISS;IDA
GO:0005875 "microtubule associated complex" evidence=ISS;IDA
GO:0003779 "actin binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005938 "cell cortex" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0007349 "cellularization" evidence=IMP
GO:0007017 "microtubule-based process" evidence=ISS
GO:0045169 "fusome" evidence=IDA
GO:0005876 "spindle microtubule" evidence=IDA
GO:0051010 "microtubule plus-end binding" evidence=IDA
GO:0000776 "kinetochore" evidence=IDA
GO:0035371 "microtubule plus end" evidence=IDA
UNIPROTKB|E1BQI8 CLIP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWB0 CLIP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWD0 CLIP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P30622 CLIP1 "CAP-Gly domain-containing linker protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|67404 Clip1 "CAP-GLY domain containing linker protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAH8 Clip1 "Protein Clip1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1928401 Clip1 "CAP-GLY domain containing linker protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJL6 CLIP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGH3 CLIP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VJE5CL190_DROMENo assigned EC number0.58330.84310.1017yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 2e-24
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 4e-22
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 1e-19
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 5e-14
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 7e-13
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 6e-11
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information 
 Score = 90.7 bits (226), Expect = 2e-24
 Identities = 35/67 (52%), Positives = 46/67 (68%), Gaps = 1/67 (1%)

Query: 40  IGDRVYV-GGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIF 98
           +GDRV V GG + G + ++G   FAPG W GV LD+P GKNDG V   RYF+C PK+GIF
Sbjct: 1   VGDRVEVLGGGRRGTVRYVGPVPFAPGLWVGVELDEPRGKNDGSVDGVRYFECPPKYGIF 60

Query: 99  SRLTRLT 105
            R +++ 
Sbjct: 61  VRPSKVE 67

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein CAP-Gly domain was recently solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Length = 67
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG4568|consensus 664 99.95
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.93
KOG3206|consensus234 99.84
KOG0971|consensus 1243 99.79
COG5244 669 NIP100 Dynactin complex subunit involved in mitoti 99.77
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.61
KOG3207|consensus 505 99.57
KOG3206|consensus234 99.56
KOG4568|consensus 664 99.21
KOG3556|consensus 724 99.06
KOG0241|consensus1714 99.03
KOG3556|consensus 724 97.13
KOG0241|consensus1714 96.9
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 92.32
PRK1070862 hypothetical protein; Provisional 92.21
PTZ00243 1560 ABC transporter; Provisional 92.03
PRK1070862 hypothetical protein; Provisional 88.61
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 87.37
PF0992653 DUF2158: Uncharacterized small protein (DUF2158); 83.83
>KOG4568|consensus Back     alignment and domain information 
Probab=99.95  E-value=6.7e-28  Score=232.34  Aligned_cols=174  Identities=47%  Similarity=0.755  Sum_probs=130.2

Q ss_pred             CcccccCCCCCcccccEEEECCCceEEEEEEeecCCCCCcEEEEEEcCCCCCCCceeCCEEeeEcCCCCeeeeecCccee
Q psy18049         27 SSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTR  106 (204)
Q Consensus        27 ~~~~~~~~~~~l~vG~rV~v~g~~~G~vryiG~~~~~~g~w~GVELd~p~Gk~dGs~~G~rYF~C~~~~GiFv~~~kv~~  106 (204)
                      ++.+...+...+.||++|+|.+...|.|||+|+++|+.|+|+||+|++|.|||||+|+|+|||.|.+.+|+|++..+...
T Consensus         7 ~~~~q~~~~~~~~ig~~v~v~~~~~G~v~y~G~t~f~~G~w~GveL~~p~GKNdGsv~G~rYF~ce~~kgif~~~~~~t~   86 (664)
T KOG4568|consen    7 SADVQLDDLGQFIIGRRVWVNNVELGFVRYAGETDFAKGIWAGVELLEPKGKNDGSVHGKRYFQCEPKKGIFFRQGRGTA   86 (664)
T ss_pred             cccchhhhhhhhhhcceEEecCCcceeeeeccCcccccceeeceeeccccCCCCcccchhhhhccccccceeeccccccc
Confidence            55667778889999999999999999999999999999999999999999999999999999999999999998877766


Q ss_pred             cCCCCCC--CCCCCCCCCCCC-c-ccCCC----CCCccc-----------cCCCC--CCCCCCCCCCCCCcCCEEEEecC
Q psy18049        107 TPLDLPP--PATPTPGARGDG-F-ISPTG----SARSLS-----------FSTPG--PGLSTPAKGGDIRLGDRVIVMSA  165 (204)
Q Consensus       107 ~~~~~~~--~~ts~pd~~~~s-~-lS~s~----S~~sl~-----------~s~~~--~S~s~~~~~~~~~vG~RV~v~~~  165 (204)
                      ...+...  .++..|+..-.. + .+.+.    +.+...           .+.+.  ++...+.....+.+|+||.+.  
T Consensus        87 ~~~~~~q~~~~~~~~~~~~~~~~~~~~sp~~~~~ip~~~s~~~~~~kss~~s~s~~~~~~~s~~~~~~l~v~dr~l~~--  164 (664)
T KOG4568|consen   87 SKNEKGQSSPPPSVPNSRLSSAAAASTSPNLQSSIPLLASLSNTIVKSSLESYSTLSSTGKSPTSMLGLRVGDRVLVG--  164 (664)
T ss_pred             ccccccccCCCCCCCchhhccccccccCccccccccccccccccccccccCCCCCcccccccccCccccccccceeec--
Confidence            5433221  111111111000 0 00000    000000           00001  112234567789999999985  


Q ss_pred             CCCeeeeEEEeccCCCCCceEEEEEeCCCCcCCCcccC
Q psy18049        166 QGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGNLG  203 (204)
Q Consensus       166 ~~~~~GtVryiG~~~~~~g~w~GVElD~p~GkndGsv~  203 (204)
                       ++..|++||+|.+.|+.|-|+|||||+|.|+|||+|.
T Consensus       165 -gq~~~~~r~~~~t~fa~g~w~~~elde~~~~~d~sv~  201 (664)
T KOG4568|consen  165 -GQKSGTLRYSGHTKFASGSWLGVELDEPVGKNDGSVG  201 (664)
T ss_pred             -CcccchhhhhccccccCCcccchhccccccccccccc
Confidence             6899999999999999999999999999999999985

>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>KOG4568|consensus Back     alignment and domain information
>KOG3556|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG3556|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
2cp5_A141 Solution Structure Of The 1st Cap-Gly Domain In Hum 1e-21
2cp5_A141 Solution Structure Of The 1st Cap-Gly Domain In Hum 1e-09
2e3i_A86 Crystal Structure Of The Clip-170 Cap-Gly Domain 1 4e-20
2e3i_A86 Crystal Structure Of The Clip-170 Cap-Gly Domain 1 5e-09
3rdv_A72 Structure Of The Slain2c-Clipcg1 Complex Length = 7 8e-20
3rdv_A72 Structure Of The Slain2c-Clipcg1 Complex Length = 7 6e-09
2cp6_A172 Solution Structure Of The 2nd Cap-Gly Domain In Hum 1e-19
2cp6_A172 Solution Structure Of The 2nd Cap-Gly Domain In Hum 7e-13
2cp7_A84 Solution Structure Of The 1st Cap-Gly Domain In Mou 2e-19
2cp7_A84 Solution Structure Of The 1st Cap-Gly Domain In Mou 1e-08
2qk0_A74 Structural Basis Of Microtubule Plus End Tracking B 3e-19
2qk0_A74 Structural Basis Of Microtubule Plus End Tracking B 2e-09
2cp2_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 6e-19
2cp2_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 1e-08
2e4h_A98 Solution Structure Of Cytoskeletal Protein In Compl 9e-19
2e4h_A98 Solution Structure Of Cytoskeletal Protein In Compl 2e-12
2e3h_A90 Crystal Structure Of The Clip-170 Cap-Gly Domain 2 9e-19
2e3h_A90 Crystal Structure Of The Clip-170 Cap-Gly Domain 2 2e-12
2cp3_A84 Solution Structure Of The 2nd Cap-Gly Domain In Hum 3e-17
2cp3_A84 Solution Structure Of The 2nd Cap-Gly Domain In Hum 6e-13
1whj_A102 Solution Structure Of The 1st Cap-Gly Domain In Mou 1e-15
1whj_A102 Solution Structure Of The 1st Cap-Gly Domain In Mou 3e-11
2cp0_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 1e-14
2cp0_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 3e-12
1whh_A102 Solution Structure Of The 2nd Cap-Gly Domain In Mou 6e-14
1whh_A102 Solution Structure Of The 2nd Cap-Gly Domain In Mou 6e-08
2z0w_A96 Crystal Structure Of The 2nd Cap-Gly Domain In Huma 1e-13
2z0w_A96 Crystal Structure Of The 2nd Cap-Gly Domain In Huma 3e-09
2coz_A122 Solution Structure Of The Cap-Gly Domain In Human C 1e-12
2coz_A122 Solution Structure Of The Cap-Gly Domain In Human C 1e-08
1tov_A98 Structural Genomics Of Caenorhabditis Elegans: Cap- 4e-12
1tov_A98 Structural Genomics Of Caenorhabditis Elegans: Cap- 4e-06
1lpl_A95 Structural Genomics Of Caenorhabditis Elegans: Cap- 7e-12
1lpl_A95 Structural Genomics Of Caenorhabditis Elegans: Cap- 4e-06
2coy_A112 Solution Structure Of The Cap-Gly Domain In Human D 1e-10
2coy_A112 Solution Structure Of The Cap-Gly Domain In Human D 7e-06
1whg_A113 Solution Structure Of The Cap-Gly Domain In Mouse T 2e-10
1whg_A113 Solution Structure Of The Cap-Gly Domain In Mouse T 1e-04
1txq_A93 Crystal Structure Of The Eb1 C-Terminal Domain Comp 2e-10
1txq_A93 Crystal Structure Of The Eb1 C-Terminal Domain Comp 4e-05
2hkn_A97 Crystal Structure Of The Cap-Gly Domain Of Human Dy 2e-10
2hkn_A97 Crystal Structure Of The Cap-Gly Domain Of Human Dy 3e-05
2hl3_A97 Crystal Structure Of The A49m Mutant Cap-Gly Domain 3e-10
2hl3_A97 Crystal Structure Of The A49m Mutant Cap-Gly Domain 3e-05
3tq7_P71 Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do 3e-10
3tq7_P71 Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do 3e-04
2cow_A100 Solution Structure Of The Cap-Gly Domain In Human K 1e-09
2cow_A100 Solution Structure Of The Cap-Gly Domain In Human K 3e-06
1whk_A91 Solution Structure Of The 3rd Cap-Gly Domain In Mou 1e-07
4b6m_A84 Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gl 4e-07
>pdb|2CP5|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170RESTIN Length = 141 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (72%)
Query: 23  SISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQ 82
           S + SS+   E  D F +G+RV+V G K G I F+GET+FAPG WAG+VLD+P+GKNDG 
Sbjct: 50  SSTPSSETQEEFVDDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGS 109
Query: 83  VGQARYFQCEPKHGIFS 99
           V   RYFQCEP  GIF+
Sbjct: 110 VAGVRYFQCEPLKGIFT 126
>pdb|2CP5|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170RESTIN Length = 141 Back     alignment and structure
>pdb|2E3I|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 1 Length = 86 Back     alignment and structure
>pdb|2E3I|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 1 Length = 86 Back     alignment and structure
>pdb|3RDV|A Chain A, Structure Of The Slain2c-Clipcg1 Complex Length = 72 Back     alignment and structure
>pdb|3RDV|A Chain A, Structure Of The Slain2c-Clipcg1 Complex Length = 72 Back     alignment and structure
>pdb|2CP6|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 170RESTIN Length = 172 Back     alignment and structure
>pdb|2CP6|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 170RESTIN Length = 172 Back     alignment and structure
>pdb|2CP7|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse Clip- 170RESTIN Length = 84 Back     alignment and structure
>pdb|2CP7|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse Clip- 170RESTIN Length = 84 Back     alignment and structure
>pdb|2QK0|A Chain A, Structural Basis Of Microtubule Plus End Tracking By Xmap215, Clip-170 And Eb1 Length = 74 Back     alignment and structure
>pdb|2QK0|A Chain A, Structural Basis Of Microtubule Plus End Tracking By Xmap215, Clip-170 And Eb1 Length = 74 Back     alignment and structure
>pdb|2CP2|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 115CYLN2 Length = 95 Back     alignment and structure
>pdb|2CP2|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 115CYLN2 Length = 95 Back     alignment and structure
>pdb|2E4H|A Chain A, Solution Structure Of Cytoskeletal Protein In Complex With Tubulin Tail Length = 98 Back     alignment and structure
>pdb|2E4H|A Chain A, Solution Structure Of Cytoskeletal Protein In Complex With Tubulin Tail Length = 98 Back     alignment and structure
>pdb|2E3H|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 2 Length = 90 Back     alignment and structure
>pdb|2E3H|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 2 Length = 90 Back     alignment and structure
>pdb|2CP3|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 115CYLN2 Length = 84 Back     alignment and structure
>pdb|2CP3|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 115CYLN2 Length = 84 Back     alignment and structure
>pdb|1WHJ|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 102 Back     alignment and structure
>pdb|1WHJ|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 102 Back     alignment and structure
>pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 Back     alignment and structure
>pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 Back     alignment and structure
>pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 Back     alignment and structure
>pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 Back     alignment and structure
>pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 Back     alignment and structure
>pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 Back     alignment and structure
>pdb|2COZ|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Centrosome-Associated Protein Cap350 Length = 122 Back     alignment and structure
>pdb|2COZ|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Centrosome-Associated Protein Cap350 Length = 122 Back     alignment and structure
>pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 Back     alignment and structure
>pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 Back     alignment and structure
>pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 Back     alignment and structure
>pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 Back     alignment and structure
>pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 Back     alignment and structure
>pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 Back     alignment and structure
>pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 Back     alignment and structure
>pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 Back     alignment and structure
>pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 Back     alignment and structure
>pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 Back     alignment and structure
>pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 Back     alignment and structure
>pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 Back     alignment and structure
>pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 Back     alignment and structure
>pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 Back     alignment and structure
>pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 Back     alignment and structure
>pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 Back     alignment and structure
>pdb|2COW|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Kinesin- Like Protein Kif13b Length = 100 Back     alignment and structure
>pdb|2COW|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Kinesin- Like Protein Kif13b Length = 100 Back     alignment and structure
>pdb|1WHK|A Chain A, Solution Structure Of The 3rd Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 91 Back     alignment and structure
>pdb|4B6M|A Chain A, Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gly Domain Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 3e-32
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 4e-17
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 9e-32
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 2e-17
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 2e-31
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 5e-17
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 5e-31
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 4e-17
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 2e-30
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 2e-17
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 3e-30
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 2e-17
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 5e-30
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 4e-17
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 5e-30
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 1e-16
2coz_A122 CAP350, centrosome-associated protein 350; microtu 1e-29
2coz_A122 CAP350, centrosome-associated protein 350; microtu 4e-18
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 1e-29
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 3e-17
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 2e-29
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 4e-16
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 7e-29
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 3e-16
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 1e-28
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 3e-17
1txq_A93 Dynactin 1; protein complex, structural protein/pr 1e-28
1txq_A93 Dynactin 1; protein complex, structural protein/pr 2e-17
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 2e-28
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 3e-18
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 7e-28
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 3e-17
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 2e-27
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 3e-17
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 3e-25
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 7e-14
1whg_A113 Tubulin specific chaperone B; microtubule binding, 2e-23
1whg_A113 Tubulin specific chaperone B; microtubule binding, 7e-16
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 3e-19
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 3e-10
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 5e-09
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 4e-07
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
 Score =  110 bits (278), Expect = 3e-32
 Identities = 47/92 (51%), Positives = 65/92 (70%), Gaps = 3/92 (3%)

Query: 25  SDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVG 84
           S +++V  +    F++G+RV+V G K G + ++GET+FAPG WAGVVLDDPVGKNDG VG
Sbjct: 6   SGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVG 65

Query: 85  QARYFQCEPKHGIFSRLTRLTRTPLDLPPPAT 116
             RYF+C    GIF+R ++LTR P     P++
Sbjct: 66  GVRYFECPALQGIFTRPSKLTRQP---SGPSS 94
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.96
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.96
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.96
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.96
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.96
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.96
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.95
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.95
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.95
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.95
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.95
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.95
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.95
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.95
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.95
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.95
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.95
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.95
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.94
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.94
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.93
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.91
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.73
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.73
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.73
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.73
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.72
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.72
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.72
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.72
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.71
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.71
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.71
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.7
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.7
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.7
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.7
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.7
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.7
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.69
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.68
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.68
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.67
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.67
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
Probab=99.96  E-value=3.6e-30  Score=193.19  Aligned_cols=90  Identities=51%  Similarity=0.974  Sum_probs=80.8

Q ss_pred             cccCCCcccccCCCCCcccccEEEECCCceEEEEEEeecCCCCCcEEEEEEcCCCCCCCceeCCEEeeEcCCCCeeeeec
Q psy18049         22 VSISDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRL  101 (204)
Q Consensus        22 ~~~~~~~~~~~~~~~~l~vG~rV~v~g~~~G~vryiG~~~~~~g~w~GVELd~p~Gk~dGs~~G~rYF~C~~~~GiFv~~  101 (204)
                      +.++.++......+..|+|||||.|.+.++|+|||+|++++.+|+|+|||||+|.|||||+++|+|||+|+++||+||++
T Consensus         3 ~~~~~~s~~~~~~~~~~~vG~rV~V~g~~~GtVryvG~v~~~~G~wvGVElDep~GKnDGsv~G~rYF~C~p~~G~Fvr~   82 (95)
T 2cp2_A            3 SGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRP   82 (95)
T ss_dssp             SCCCCCSCCCBSSCCSCCTTCEEEGGGSCEEEEEEEEECSSSCSEEEEEEESSSCSSBBSEETTEECCCCCTTTEEEECG
T ss_pred             ccccccchhhhhhhhcCcCCCEEEECCceEEEEEEecccCCCCCEEEEEEecCCCCccCCEECCEEecccCCCeEEEEcH
Confidence            34555555666677789999999999878999999999999999999999999999999999999999999999999999


Q ss_pred             CcceecCCCC
Q psy18049        102 TRLTRTPLDL  111 (204)
Q Consensus       102 ~kv~~~~~~~  111 (204)
                      ++|.+.|..+
T Consensus        83 ~kv~~~p~~~   92 (95)
T 2cp2_A           83 SKLTRQPSGP   92 (95)
T ss_dssp             GGCCSSCCSS
T ss_pred             HHCccCCCCC
Confidence            9999887543
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 1e-29
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 2e-16
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 1e-27
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 8e-14
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 6e-27
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 2e-13
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 6e-27
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 6e-14
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 6e-26
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 1e-14
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 9e-26
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 2e-14
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 2e-25
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 9e-16
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 2e-25
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 2e-16
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 5e-25
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 1e-13
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 6e-25
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 8e-11
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 2e-23
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 2e-12
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 6e-23
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 2e-12
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 3e-22
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 5e-13
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 3e-16
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 4e-07
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 3e-16
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 6e-14
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Centrosome-associated protein 350
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  103 bits (259), Expect = 1e-29
 Identities = 36/84 (42%), Positives = 49/84 (58%)

Query: 25  SDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVG 84
           S +S    ++   F IGDRV +G  + G + F GET FA G WAGV LD P G N+G   
Sbjct: 12  SLASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYD 71

Query: 85  QARYFQCEPKHGIFSRLTRLTRTP 108
              YF+C+ KHGIF+   +++  P
Sbjct: 72  GIAYFECKEKHGIFAPPQKISHIP 95
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.96
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.96
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.96
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.96
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.95
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.95
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.94
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.93
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.93
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.92
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.91
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.72
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.71
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.7
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.7
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.7
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.69
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.68
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.65
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.63
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.61
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.47
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Restin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1e-29  Score=179.61  Aligned_cols=70  Identities=63%  Similarity=1.235  Sum_probs=67.4

Q ss_pred             cccccEEEECCCceEEEEEEeecCCCCCcEEEEEEcCCCCCCCceeCCEEeeEcCCCCeeeeecCcceec
Q psy18049         38 FIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPKHGIFSRLTRLTRT  107 (204)
Q Consensus        38 l~vG~rV~v~g~~~G~vryiG~~~~~~g~w~GVELd~p~Gk~dGs~~G~rYF~C~~~~GiFv~~~kv~~~  107 (204)
                      |+|||||.|.+...|+|||+|++++.+|+|+|||||+|.|||||+++|+|||+|+|+||+||++++|++.
T Consensus         1 f~vG~rV~v~~~~~G~vryvG~~~~~~g~~vGVEld~p~Gk~dGt~~G~~YF~c~~~~G~Fv~~~~v~k~   70 (71)
T d2e3ia1           1 FRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRK   70 (71)
T ss_dssp             CCTTCEEEETTTEEEEEEEEEECSSSSSEEEEEEESSSCSSBSSEETTEESSCCSTTCEEEECGGGEESS
T ss_pred             CccCCEEEECCCcEEEEEEEeecCCCCCcEEEEEECCCCCCCCCEECCEEEEecCCCcEEEeCHHHEEec
Confidence            6899999999888999999999999999999999999999999999999999999999999999999873
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure