Psyllid ID: psy18086

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSEIQSHRNPNLQLRRRIFLKKH
ccEEEEcccccccHHHHHHHHHccccEEEEEEHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHcc
ccEEEEEccccccHHHHHHHHHHccEEEEEccHHHHHHHHccccccccccccccHHHHccccccccccEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHccccccEEEEccHHHHHHHHHHHHHHHHccccHHHHcccccccEcccEEEHEccc
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYvfvkppsieeLETRlrgrgteteDSLRRRLDLARRdmsygkdslrsygIISELAFFLEYNSAAGEifehfglksseiqshrnpnlQLRRRIFLKKH
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYvfvkppsieeletrlrgrgtetedslrrrldlarrdmsygkdslrsYGIISELAFFLEYNSAAGEIFEHFGLksseiqshrnpnlqlrrriflkkh
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEdslrrrldlarrdMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSEIQSHRNPNLQLRRRIFLKKH
**VIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKP***********************************KDSLRSYGIISELAFFLEYNSAAGEIFEHFGL************************
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHF*******************RIFL***
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELETRL***********RRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSEIQSHRNPNLQLRRRIFLKKH
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSEIQSHRNPNLQLRRRIFLKKH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSEIQSHRNPNLQLRRRIFLKKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
P15454187 Guanylate kinase OS=Sacch yes N/A 0.457 0.406 0.381 6e-13
Q54XF2202 Guanylate kinase OS=Dicty yes N/A 0.469 0.386 0.33 9e-12
Q64520198 Guanylate kinase OS=Mus m yes N/A 0.487 0.409 0.368 2e-11
Q7U570182 Guanylate kinase OS=Synec yes N/A 0.463 0.423 0.353 2e-10
Q31DP7205 Guanylate kinase OS=Thiom yes N/A 0.5 0.404 0.323 5e-10
Q9P6I5202 Guanylate kinase OS=Schiz yes N/A 0.481 0.396 0.362 6e-10
Q3ALX6185 Guanylate kinase OS=Synec yes N/A 0.457 0.410 0.346 1e-09
Q16774197 Guanylate kinase OS=Homo yes N/A 0.487 0.411 0.349 2e-09
Q5P3M0204 Guanylate kinase OS=Aroma yes N/A 0.469 0.382 0.35 2e-09
Q3AWM1187 Guanylate kinase OS=Synec yes N/A 0.475 0.422 0.336 4e-09
>sp|P15454|KGUA_YEAST Guanylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUK1 PE=1 SV=2 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (61%), Gaps = 21/97 (21%)

Query: 15  AAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVK 74
           A+V+ V  SGKTC+LDI++QGV+ VK              + ++         A ++F+ 
Sbjct: 84  ASVKQVSKSGKTCILDIDMQGVKSVK-------------AIPEL--------NARFLFIA 122

Query: 75  PPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGK 111
           PPS+E+L+ RL GRGTETE+S+ +RL  A+ +++Y +
Sbjct: 123 PPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAE 159
Essential for recycling GMP and indirectly, cGMP.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 8
>sp|Q54XF2|KGUA_DICDI Guanylate kinase OS=Dictyostelium discoideum GN=guk1 PE=3 SV=1 Back     alignment and function description
>sp|Q64520|KGUA_MOUSE Guanylate kinase OS=Mus musculus GN=Guk1 PE=1 SV=2 Back     alignment and function description
>sp|Q7U570|KGUA_SYNPX Guanylate kinase OS=Synechococcus sp. (strain WH8102) GN=gmk PE=3 SV=1 Back     alignment and function description
>sp|Q31DP7|KGUA_THICR Guanylate kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=gmk PE=3 SV=1 Back     alignment and function description
>sp|Q9P6I5|KGUA_SCHPO Guanylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.05 PE=3 SV=1 Back     alignment and function description
>sp|Q3ALX6|KGUA_SYNSC Guanylate kinase OS=Synechococcus sp. (strain CC9605) GN=gmk PE=3 SV=1 Back     alignment and function description
>sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2 Back     alignment and function description
>sp|Q5P3M0|KGUA_AROAE Guanylate kinase OS=Aromatoleum aromaticum (strain EbN1) GN=gmk PE=3 SV=2 Back     alignment and function description
>sp|Q3AWM1|KGUA_SYNS9 Guanylate kinase OS=Synechococcus sp. (strain CC9902) GN=gmk PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
156387610191 predicted protein [Nematostella vectensi 0.548 0.476 0.429 1e-17
383863925216 PREDICTED: LOW QUALITY PROTEIN: guanylat 0.481 0.370 0.470 4e-17
328781717208 PREDICTED: guanylate kinase-like [Apis m 0.596 0.475 0.421 6e-17
380025472194 PREDICTED: guanylate kinase-like [Apis f 0.481 0.412 0.450 3e-16
189014430199 gualynate kinase-1 [Gryllus firmus] 0.475 0.396 0.465 2e-15
189014390199 gualynate kinase-1 [Gryllus pennsylvanic 0.475 0.396 0.465 2e-15
189014404199 gualynate kinase-1 [Gryllus pennsylvanic 0.475 0.396 0.455 3e-15
189014388199 gualynate kinase-1 [Gryllus pennsylvanic 0.475 0.396 0.455 3e-15
350417477214 PREDICTED: guanylate kinase-like [Bombus 0.481 0.373 0.441 3e-15
91082673196 PREDICTED: similar to guanylate kinase [ 0.548 0.464 0.398 5e-15
>gi|156387610|ref|XP_001634296.1| predicted protein [Nematostella vectensis] gi|156221377|gb|EDO42233.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 76/114 (66%), Gaps = 23/114 (20%)

Query: 10  YMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAV 69
           Y  ++ AV+ VI+ GK C+LDI+VQGV+ VK+A              ++K         +
Sbjct: 80  YGTSKKAVQDVIHVGKVCILDIDVQGVKNVKKA--------------EMK--------CL 117

Query: 70  YVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRS-YGIISE 122
           Y+F KPPS+EELE RLRGRGTET+D+LR+RL++A+ +++YG++   + Y II++
Sbjct: 118 YIFAKPPSLEELENRLRGRGTETDDTLRQRLEIAKSELAYGEEPGNADYTIIND 171

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|383863925|ref|XP_003707430.1| PREDICTED: LOW QUALITY PROTEIN: guanylate kinase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328781717|ref|XP_624407.2| PREDICTED: guanylate kinase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380025472|ref|XP_003696498.1| PREDICTED: guanylate kinase-like [Apis florea] Back     alignment and taxonomy information
>gi|189014430|gb|ACD69451.1| gualynate kinase-1 [Gryllus firmus] Back     alignment and taxonomy information
>gi|189014390|gb|ACD69431.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014392|gb|ACD69432.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014394|gb|ACD69433.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014402|gb|ACD69437.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014408|gb|ACD69440.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014410|gb|ACD69441.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014414|gb|ACD69443.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014420|gb|ACD69446.1| gualynate kinase-1 [Gryllus firmus] gi|189014422|gb|ACD69447.1| gualynate kinase-1 [Gryllus firmus] gi|189014426|gb|ACD69449.1| gualynate kinase-1 [Gryllus firmus] gi|189014428|gb|ACD69450.1| gualynate kinase-1 [Gryllus firmus] gi|189014434|gb|ACD69453.1| gualynate kinase-1 [Gryllus firmus] gi|189014438|gb|ACD69455.1| gualynate kinase-1 [Gryllus firmus] gi|189014442|gb|ACD69457.1| gualynate kinase-1 [Gryllus firmus] gi|189014444|gb|ACD69458.1| gualynate kinase-1 [Gryllus firmus] gi|189014446|gb|ACD69459.1| gualynate kinase-1 [Gryllus firmus] gi|189014448|gb|ACD69460.1| gualynate kinase-1 [Gryllus firmus] gi|189014450|gb|ACD69461.1| gualynate kinase-1 [Gryllus firmus] Back     alignment and taxonomy information
>gi|189014404|gb|ACD69438.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014406|gb|ACD69439.1| gualynate kinase-1 [Gryllus pennsylvanicus] Back     alignment and taxonomy information
>gi|189014388|gb|ACD69430.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014396|gb|ACD69434.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014398|gb|ACD69435.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014400|gb|ACD69436.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014412|gb|ACD69442.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014416|gb|ACD69444.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014418|gb|ACD69445.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014424|gb|ACD69448.1| gualynate kinase-1 [Gryllus firmus] gi|189014432|gb|ACD69452.1| gualynate kinase-1 [Gryllus firmus] gi|189014436|gb|ACD69454.1| gualynate kinase-1 [Gryllus firmus] gi|189014440|gb|ACD69456.1| gualynate kinase-1 [Gryllus firmus] Back     alignment and taxonomy information
>gi|350417477|ref|XP_003491441.1| PREDICTED: guanylate kinase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|91082673|ref|XP_971278.1| PREDICTED: similar to guanylate kinase [Tribolium castaneum] gi|270015049|gb|EFA11497.1| hypothetical protein TcasGA2_TC014210 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
ASPGD|ASPL0000052058228 AN10188 [Emericella nidulans ( 0.331 0.241 0.413 6.7e-10
MGI|MGI:95871198 Guk1 "guanylate kinase 1" [Mus 0.337 0.282 0.355 1.9e-07
SGD|S000002862187 GUK1 "Guanylate kinase" [Sacch 0.668 0.593 0.286 3.8e-07
CGD|CAL0001880243 GUK1 [Candida albicans (taxid: 0.524 0.358 0.322 4.4e-07
POMBASE|SPBC1198.05202 SPBC1198.05 "guanylate kinase 0.433 0.356 0.389 1.1e-06
RGD|1309638198 Guk1 "guanylate kinase 1" [Rat 0.337 0.282 0.338 1.5e-06
UNIPROTKB|E9PTV0219 Guk1 "Protein Guk1" [Rattus no 0.337 0.255 0.338 2.4e-06
FB|FBgn0036099233 CG11811 [Drosophila melanogast 0.837 0.596 0.267 2.4e-06
TAIR|locus:2103518390 AGK2 "guanylate kinase" [Arabi 0.469 0.2 0.345 7.5e-05
TAIR|locus:2054356387 GK-1 "guanylate kinase 1" [Ara 0.349 0.149 0.393 0.00062
ASPGD|ASPL0000052058 AN10188 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 108 (43.1 bits), Expect = 6.7e-10, Sum P(2) = 6.7e-10
 Identities = 24/58 (41%), Positives = 32/58 (55%)

Query:    54 GVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEXXXXXXXXXXXXXMSYGK 111
             GV+QVK+       A ++F+ PPS++ELE RLR RGTETE             + Y K
Sbjct:   139 GVKQVKKTD---LNARFLFLAPPSVDELERRLRSRGTETEESLQKRLTQAKNELEYAK 193
GO:0006163 "purine nucleotide metabolic process" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0004385 "guanylate kinase activity" evidence=IEA
MGI|MGI:95871 Guk1 "guanylate kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
SGD|S000002862 GUK1 "Guanylate kinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0001880 GUK1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
POMBASE|SPBC1198.05 SPBC1198.05 "guanylate kinase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1309638 Guk1 "guanylate kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTV0 Guk1 "Protein Guk1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0036099 CG11811 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2103518 AGK2 "guanylate kinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054356 GK-1 "guanylate kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 4e-25
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 8e-24
PLN02772398 PLN02772, PLN02772, guanylate kinase 5e-21
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 7e-21
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 6e-18
smart00072174 smart00072, GuKc, Guanylate kinase homologues 4e-17
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 4e-11
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 1e-08
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 3e-07
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information 
 Score = 94.9 bits (237), Expect = 4e-25
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 22/96 (22%)

Query: 14  RAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFV 73
           ++ VE  + +GK  +L+I+VQG +QVK+                          AV +F+
Sbjct: 80  KSPVEEALAAGKDVLLEIDVQGARQVKKK----------------------FPDAVSIFI 117

Query: 74  KPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSY 109
            PPS+EELE RLR RGT++E+ + RRL  A++++++
Sbjct: 118 LPPSLEELERRLRKRGTDSEEVIERRLAKAKKEIAH 153

Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]. Length = 179
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.97
PRK14737186 gmk guanylate kinase; Provisional 99.95
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.94
PLN02772398 guanylate kinase 99.93
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.92
KOG0707|consensus231 99.88
PRK14738206 gmk guanylate kinase; Provisional 99.85
KOG0609|consensus542 99.85
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.82
PRK00300205 gmk guanylate kinase; Provisional 99.78
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.56
COG3709192 Uncharacterized component of phosphonate metabolis 99.5
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.41
KOG0708|consensus359 99.37
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.3
PRK08356195 hypothetical protein; Provisional 98.85
PRK04040188 adenylate kinase; Provisional 98.81
PRK14731208 coaE dephospho-CoA kinase; Provisional 98.34
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.27
PRK00081194 coaE dephospho-CoA kinase; Reviewed 98.11
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.93
PRK14732196 coaE dephospho-CoA kinase; Provisional 97.76
PTZ00451244 dephospho-CoA kinase; Provisional 97.68
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.59
PRK01184184 hypothetical protein; Provisional 97.57
PLN02422232 dephospho-CoA kinase 97.53
PRK00698205 tmk thymidylate kinase; Validated 97.46
PRK14734200 coaE dephospho-CoA kinase; Provisional 97.23
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 96.99
PRK14733204 coaE dephospho-CoA kinase; Provisional 96.92
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 96.4
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 96.09
KOG3580|consensus 1027 95.92
PRK12339197 2-phosphoglycerate kinase; Provisional 95.81
PRK06762166 hypothetical protein; Provisional 95.74
PRK04182180 cytidylate kinase; Provisional 95.66
PRK14530215 adenylate kinase; Provisional 95.64
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.61
PRK13946184 shikimate kinase; Provisional 95.57
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.39
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.13
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 94.93
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 94.9
PRK14531183 adenylate kinase; Provisional 94.77
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 94.73
KOG3812|consensus475 94.48
PRK05480209 uridine/cytidine kinase; Provisional 94.4
KOG3220|consensus225 94.39
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 93.59
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 93.5
PRK08154309 anaerobic benzoate catabolism transcriptional regu 93.39
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.36
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 92.7
PRK13975196 thymidylate kinase; Provisional 92.6
PRK00131175 aroK shikimate kinase; Reviewed 92.51
PRK05541176 adenylylsulfate kinase; Provisional 91.6
PRK08233182 hypothetical protein; Provisional 90.36
PRK02496184 adk adenylate kinase; Provisional 90.22
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 89.91
PLN02200234 adenylate kinase family protein 89.72
PRK06696223 uridine kinase; Validated 89.72
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 89.72
PRK09270229 nucleoside triphosphate hydrolase domain-containin 88.94
PHA02530300 pseT polynucleotide kinase; Provisional 88.89
PRK14532188 adenylate kinase; Provisional 87.71
PRK03731171 aroL shikimate kinase II; Reviewed 87.33
PRK14526211 adenylate kinase; Provisional 87.31
PRK14527191 adenylate kinase; Provisional 87.28
PRK13808 333 adenylate kinase; Provisional 87.25
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 86.97
PRK12337475 2-phosphoglycerate kinase; Provisional 86.7
TIGR00235207 udk uridine kinase. Model contains a number of lon 86.34
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 86.15
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 85.49
PRK07667193 uridine kinase; Provisional 85.19
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 85.18
PRK00279215 adk adenylate kinase; Reviewed 84.49
PRK13947171 shikimate kinase; Provisional 84.23
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 83.62
PRK14528186 adenylate kinase; Provisional 82.33
PRK13973213 thymidylate kinase; Provisional 81.97
KOG3079|consensus195 81.94
COG0703172 AroK Shikimate kinase [Amino acid transport and me 81.84
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 81.64
COG1936180 Predicted nucleotide kinase (related to CMP and AM 81.54
COG1618179 Predicted nucleotide kinase [Nucleotide transport 80.31
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=4e-31  Score=216.98  Aligned_cols=117  Identities=36%  Similarity=0.526  Sum_probs=111.8

Q ss_pred             EEEccccccCcHHHHHHHHhcCCcEEEEeCHHHHHHHHHhhccCCccchhhchhhhhhccCCCCceEEEEEeCCCHHHHH
Q psy18086          3 VIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEELE   82 (166)
Q Consensus         3 ~~~~gn~YGTs~~~V~~v~~~Gk~~vldid~~Gv~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~IFI~PPS~e~Le   82 (166)
                      ++|+||+||||+..|+..+++|+.|+||||+||++++|+.   ||                   ++++|||.|||+++|+
T Consensus        72 a~~~gnyYGT~~~~ve~~~~~G~~vildId~qGa~qvk~~---~p-------------------~~v~IFi~pPs~eeL~  129 (191)
T COG0194          72 AEYHGNYYGTSREPVEQALAEGKDVILDIDVQGALQVKKK---MP-------------------NAVSIFILPPSLEELE  129 (191)
T ss_pred             EEEcCCcccCcHHHHHHHHhcCCeEEEEEehHHHHHHHHh---CC-------------------CeEEEEEcCCCHHHHH
Confidence            6899999999999999999999999999999999999999   88                   8999999999999999


Q ss_pred             HHhhcCCCCCHHHHHHHHHHHHHHhhcCCCCCCcccEEEEcCCCCCCHhHHHHHHHHHHHhhhhhhh
Q psy18086         83 TRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSEIQS  149 (166)
Q Consensus        83 ~RL~~Rgtetee~I~~Rl~~A~~e~~~~~~~~~~fD~vIvNd~dl~~~e~a~~~l~~ii~~~~~~~~  149 (166)
                      +||++||++|++.|++||..|+.||++..    .|||+|+|| |+   +.|+++|+.|+.++..+..
T Consensus       130 ~RL~~Rgtds~e~I~~Rl~~a~~Ei~~~~----~fdyvivNd-d~---e~a~~~l~~ii~aer~~~~  188 (191)
T COG0194         130 RRLKGRGTDSEEVIARRLENAKKEISHAD----EFDYVIVND-DL---EKALEELKSIILAERLRRD  188 (191)
T ss_pred             HHHHccCCCCHHHHHHHHHHHHHHHHHHH----hCCEEEECc-cH---HHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999988    899999999 99   9999999999998865443

>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>KOG3220|consensus Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1gky_A187 Refined Structure Of The Complex Between Guanylate 3e-10
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 3e-10
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 3e-10
1lvg_A198 Crystal Structure Of Mouse Guanylate Kinase In Comp 4e-08
2an9_A207 Crystal Structure Of Oligomeric E.Coli Guanylate Ki 9e-07
1s96_A219 The 2.0 A X-Ray Structure Of Guanylate Kinase From 5e-06
2j41_A207 Crystal Structure Of Staphylococcus Aureus Guanylat 5e-05
2qor_A204 Crystal Structure Of Plasmodium Vivax Guanylate Kin 2e-04
1z6g_A218 Crystal Structure Of Guanylate Kinase From Plasmodi 2e-04
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 21/79 (26%)
Query: 15  AAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVK 74
           A+V+ V  SGKTC+LDI++QGV+ VK              + ++         A ++F+ 
Sbjct: 84  ASVKQVSKSGKTCILDIDMQGVKSVK-------------AIPEL--------NARFLFIA 122
Query: 75  PPSIEELETRLRGRGTETE 93
           PPS+E+L+ RL GRGTETE
Sbjct: 123 PPSVEDLKKRLEGRGTETE 141
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure
>pdb|2AN9|A Chain A, Crystal Structure Of Oligomeric E.Coli Guanylate Kinase In Complex With Gdp Length = 207 Back     alignment and structure
>pdb|1S96|A Chain A, The 2.0 A X-Ray Structure Of Guanylate Kinase From E.Coli Length = 219 Back     alignment and structure
>pdb|2J41|A Chain A, Crystal Structure Of Staphylococcus Aureus Guanylate Monophosphate Kinase Length = 207 Back     alignment and structure
>pdb|2QOR|A Chain A, Crystal Structure Of Plasmodium Vivax Guanylate Kinase Length = 204 Back     alignment and structure
>pdb|1Z6G|A Chain A, Crystal Structure Of Guanylate Kinase From Plasmodium Falciparum Length = 218 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 3e-30
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 6e-30
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 1e-28
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 6e-28
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 7e-28
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 1e-27
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 1e-27
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 1e-22
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 1e-22
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 7e-21
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 1e-19
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 2e-18
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 3e-17
1kjw_A295 Postsynaptic density protein 95; protein-protein i 8e-17
2xkx_A721 Disks large homolog 4; structural protein, scaffol 7e-13
3kfv_A308 Tight junction protein ZO-3; structural genomics c 9e-12
4dey_A337 Voltage-dependent L-type calcium channel subunit; 1e-11
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-10
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 5e-10
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
 Score =  107 bits (271), Expect = 3e-30
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 22/100 (22%)

Query: 14  RAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFV 73
           + AV AV    + CVLD+++QGV+ +K+                           +Y+FV
Sbjct: 85  KEAVRAVQAMNRICVLDVDLQGVRSIKKT----------------------DLCPIYIFV 122

Query: 74  KPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDS 113
           +PPS++ LE RLR R TETE+SL +RL  AR DM   K+ 
Sbjct: 123 QPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEP 162
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.97
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 99.95
1kjw_A295 Postsynaptic density protein 95; protein-protein i 99.93
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.9
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.9
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.89
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.88
3kfv_A308 Tight junction protein ZO-3; structural genomics c 99.88
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.88
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.87
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.87
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.85
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.79
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.78
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.78
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.78
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.74
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.57
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.53
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.78
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 98.73
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.38
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.73
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.71
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.61
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.6
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.58
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.54
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.49
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.47
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.39
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.35
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.35
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 97.33
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.27
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.26
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.24
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.24
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.18
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.15
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.12
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.11
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.1
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.04
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.87
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.87
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.86
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.81
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.75
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.75
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.6
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.59
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.43
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.4
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.34
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.29
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.27
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.86
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.59
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.32
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.29
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.2
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 95.19
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.14
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 94.81
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.74
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.74
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 94.68
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.45
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 94.35
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.3
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.17
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.98
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.97
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.86
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.84
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.77
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.55
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.39
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.29
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.91
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 92.84
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.59
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.42
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.23
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.51
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 90.12
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 89.85
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.56
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 89.39
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 89.23
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 88.99
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 88.92
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.28
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.2
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 87.97
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 87.63
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 87.63
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 87.38
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.96
1via_A175 Shikimate kinase; structural genomics, transferase 85.52
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 85.39
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 84.47
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 83.85
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 81.97
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 81.62
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 80.01
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
Probab=99.97  E-value=2.7e-31  Score=213.32  Aligned_cols=116  Identities=35%  Similarity=0.529  Sum_probs=107.2

Q ss_pred             eEEEccccccCcHHHHHHHHhcCCcEEEEeCHHHHHHHHHhhccCCccchhhchhhhhhccCCCCceEEEEEeCCCHHHH
Q psy18086          2 NVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEEL   81 (166)
Q Consensus         2 ~~~~~gn~YGTs~~~V~~v~~~Gk~~vldid~~Gv~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~IFI~PPS~e~L   81 (166)
                      -++|+||+|||++++|++++++|++||+|+|++|++++|+.+++                     ++++|||.|||.++|
T Consensus        70 ~~~~~g~~YGt~~~~v~~~l~~g~~vil~id~~g~~~~k~~~~~---------------------~~~~Ifi~pps~e~L  128 (186)
T 1ex7_A           70 WAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPEL---------------------NARFLFIAPPSVEDL  128 (186)
T ss_dssp             EEEETTEEEEEEHHHHHHHHHHTSEEEEECCHHHHHHHHTCGGG---------------------CCEEEEEECSCHHHH
T ss_pred             EEEEcCceeeeecceeeehhhCCCEEEecCCHHHHHHHHHhccc---------------------CceEEEEeCCCHHHH
Confidence            37899999999999999999999999999999999999987443                     799999999999999


Q ss_pred             HHHhhcCCCCCHHHHHHHHHHHHHHhhcCCCCCCcccEEEEcCCCCCCHhHHHHHHHHHHHhh
Q psy18086         82 ETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKS  144 (166)
Q Consensus        82 e~RL~~Rgtetee~I~~Rl~~A~~e~~~~~~~~~~fD~vIvNd~dl~~~e~a~~~l~~ii~~~  144 (166)
                      ++||++||++|+++|++||..|+.||.++. .+ .||++|+|| |+   +.|+++|.+||.++
T Consensus       129 ~~RL~~Rg~e~~e~i~~Rl~~a~~e~~~~~-~~-~fD~vIvNd-dl---e~a~~~l~~iI~ae  185 (186)
T 1ex7_A          129 KKRLEGRGTETEESINKRLSAAQAELAYAE-TG-AHDKVIVND-DL---DKAYKELKDFIFAE  185 (186)
T ss_dssp             HHHHHHHCCSCHHHHHHHHHHHHHHHHHHT-TT-CSSEEEECS-SH---HHHHHHHHHHHTTC
T ss_pred             HHHHHhcCCCCHHHHHHHHHHHHHHHhhcc-cc-CCcEEEECc-CH---HHHHHHHHHHHHhc
Confidence            999999999999999999999999998764 23 799999999 99   99999999999765
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d1gkya_186 c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Sac 3e-04
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 0.001
d1znwa1182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 0.003
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 186 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 37.6 bits (86), Expect = 3e-04
 Identities = 21/51 (41%), Positives = 36/51 (70%)

Query: 70  YVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGII 120
           ++F+ PPS+E+L+ RL GRGTETE+S+ +RL  A+ +++Y +       I+
Sbjct: 117 FLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIV 167
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.96
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.93
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.93
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.92
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.92
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.84
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.56
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 97.36
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.93
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.46
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.31
d1t0hb_219 Guanylate kinase-like domain of the L-type calcium 95.84
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.83
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.52
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.0
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.79
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.62
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.11
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.88
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.68
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.56
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.44
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.18
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.77
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.01
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.28
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.79
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.43
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.14
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.76
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.67
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.33
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.3
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.13
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 84.06
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 82.57
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 81.47
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 80.92
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=8.1e-29  Score=198.11  Aligned_cols=115  Identities=30%  Similarity=0.425  Sum_probs=108.9

Q ss_pred             eEEEccccccCcHHHHHHHHhcCCcEEEEeCHHHHHHHHHhhccCCccchhhchhhhhhccCCCCceEEEEEeCCCHHHH
Q psy18086          2 NVIIYLKSYMVNRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFGVQQVKRAGGAMAGAVYVFVKPPSIEEL   81 (166)
Q Consensus         2 ~~~~~gn~YGTs~~~V~~v~~~Gk~~vldid~~Gv~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~IFI~PPS~e~L   81 (166)
                      .++++||+|||++++|+.++++|++||+|+|++|+.++|+.   ++                   .+++|||.|||.++|
T Consensus        72 ~~~~~g~~YGt~~~~v~~~~~~g~~~ildid~~g~~~lk~~---~~-------------------~~~~ifi~pps~~~l  129 (205)
T d1s96a_          72 HAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQK---MP-------------------HARSIFILPPSKIEL  129 (205)
T ss_dssp             EEEETTEEEEEEHHHHHHHHTTTCEEEEECCHHHHHHHHHH---CT-------------------TCEEEEEECSSHHHH
T ss_pred             EEEECCceeccccchHHHHHhcCCceeecCcHHHHHHHHhh---hc-------------------ccceeeeeccchHHH
Confidence            37899999999999999999999999999999999999999   65                   789999999999999


Q ss_pred             HHHhhcCCCCCHHHHHHHHHHHHHHhhcCCCCCCcccEEEEcCCCCCCHhHHHHHHHHHHHhhhh
Q psy18086         82 ETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGIISELAFFLEYNSAAGEIFEHFGLKSSE  146 (166)
Q Consensus        82 e~RL~~Rgtetee~I~~Rl~~A~~e~~~~~~~~~~fD~vIvNd~dl~~~e~a~~~l~~ii~~~~~  146 (166)
                      ++||++|++++++.|+.|+..|..|+.+++    .||++|+|| |+   +.|+++|.+||.++..
T Consensus       130 ~~RL~~Rg~~~~~~i~~Rl~~a~~E~~~~~----~fD~vIvNd-dl---~~a~~el~~iI~~e~~  186 (205)
T d1s96a_         130 DRRLRGRGQDSEEVIAKRMAQAVAEMSHYA----EYDYLIVND-DF---DTALTDLKTIIRAERL  186 (205)
T ss_dssp             HHHHHTTSCSCHHHHHHHHHHHHHHHTTGG----GSSEEEECS-SH---HHHHHHHHHHHHHHHT
T ss_pred             HHHHHhcCCchHHHHHHHHHHHHHHHHHHh----CCCEEEECc-CH---HHHHHHHHHHHHHHHh
Confidence            999999999999999999999999998887    899999999 99   9999999999987654
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure