Psyllid ID: psy18204


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----
MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFDGGKESRSKQPISPSAEEVWKIKEAISKASSLEEIERLNKLLQSGQIPGREDAENH
cccccHHHHHHHHHccccccccEEEccccccHHHHccccccccccEEEcccccccccccccccccccccccccccccccccHHHHccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHccccccHHHHHHHHHHccccccccEEEEEEcccccccccccHHHHHHccccccccHHHcHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccEEEEEEEEEccccccccccccccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
cccccHHHHHHccEEEcccccEEEEcccccccccccHHHHcccccEEEcccccccEEccccccccccEEEcccccccEEcccHHHHcccccEEEccccccccHHHHHHHHHcccccEEEccccHHHHcccHHHHHHHHcccccEEccEEccHHHHHHHHcccEEEEEccccccccEEEEEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHEEEHccHHHcHHHHHHHHHHHccccccccccccHHHHHHHHccccHHccccccccccccccccEEEEHHHccccccEEEEEEEEccccccccHHHHHccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
MVKLTADLIVQCMQytnpvkdreldlrgykipvienmgatldqfdtidfsnndirkidgfpllkrlsclffnnnRIVRIAENLQenlpnletliltgnniqelgdldplstlpklktlcllhnpvinrphyrlyvafklpqvklldfSKVKLKALMNVMFGTEiilsgdsidagDQALFIMNHRTrldwnflwgcmfhasrpsaHRLKMVLkspirhapgpgwvMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKaktfvpgaalqdlsniptgnqlnaVYDITVGylgtipqsemdavhgkfpsqahfhikkystdslpvsdtDAMKAWLNQIWAEKEAHLNRfydkgyfdggkesrskqpispsaEEVWKIKEAISKASSLEEIERLNKLLQsgqipgredaenh
MVKLTADLIVQCMqytnpvkdreldLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKaktfvpgaalqdlsniptgNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFdggkesrskqpispsaeeVWKIKEAISKASSLEEIERLNKllqsgqipgredaenh
MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFDGGKESRSKQPISPSAEEVWKIKEAISKASSLEEIERLNKLLQSGQIPGREDAENH
***LTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQ*******************************FVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFD*******************************************************
MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDK**************ISPSAEEVWKIKEAISKASSLEEIERLNKLLQS************
MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFK**********ISKKAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFDG**************EEVWKIKEAISKASSLEEIERLNKLLQSGQ**********
*VKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFDGGKESRSKQPISPSAEEVWKIKEAISKASSLEEIERLNKLLQSGQIP********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKALMNVMFGTEIILSGDSIDAGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQEKQEAAALFKSKKGKELQKEISKKAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTIPQSEMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGYFDGGKESRSKQPISPSAEEVWKIKEAISKASSLEEIERLNKLLQSGQIPGREDAENH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query435 2.2.26 [Sep-21-2011]
P57784255 U2 small nuclear ribonucl yes N/A 0.351 0.6 0.692 2e-57
Q4R8Y8255 U2 small nuclear ribonucl N/A N/A 0.351 0.6 0.692 3e-57
P09661255 U2 small nuclear ribonucl yes N/A 0.351 0.6 0.692 3e-57
Q9V4Q8265 Probable U2 small nuclear yes N/A 0.351 0.577 0.653 2e-55
P43333249 U2 small nuclear ribonucl yes N/A 0.340 0.594 0.562 5e-42
Q9BLB6253 Probable U2 small nuclear yes N/A 0.349 0.600 0.513 2e-41
Q6UWP7414 Lysocardiolipin acyltrans no N/A 0.503 0.528 0.358 1e-40
Q5F3X0378 Lysocardiolipin acyltrans no N/A 0.489 0.563 0.35 2e-40
Q6NYV8388 Lysocardiolipin acyltrans yes N/A 0.487 0.546 0.341 2e-40
Q3UN02376 Lysocardiolipin acyltrans no N/A 0.485 0.561 0.355 9e-40
>sp|P57784|RU2A_MOUSE U2 small nuclear ribonucleoprotein A' OS=Mus musculus GN=Snrpa1 PE=1 SV=2 Back     alignment and function desciption
 Score =  223 bits (568), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%)

Query: 1   MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGF 60
           MVKLTA+LI Q  QYTN V+DRELDLRGYKIPVIEN+GATLDQFD IDFS+N+IRK+DGF
Sbjct: 1   MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF 60

Query: 61  PLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCL 120
           PLL+RL  L  NNNRI RI E L + LP L  LILT N++ ELGDLDPL++L  L  L +
Sbjct: 61  PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI 120

Query: 121 LHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLK 153
           L NPV N+ HYRLYV +K+PQV++LDF KVKLK
Sbjct: 121 LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 153




This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA.
Mus musculus (taxid: 10090)
>sp|Q4R8Y8|RU2A_MACFA U2 small nuclear ribonucleoprotein A' OS=Macaca fascicularis GN=SNRPA1 PE=2 SV=1 Back     alignment and function description
>sp|P09661|RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens GN=SNRPA1 PE=1 SV=2 Back     alignment and function description
>sp|Q9V4Q8|RU2A_DROME Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster GN=U2A PE=2 SV=1 Back     alignment and function description
>sp|P43333|RU2A_ARATH U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana GN=At1g09760 PE=2 SV=2 Back     alignment and function description
>sp|Q9BLB6|RU2A_CAEEL Probable U2 small nuclear ribonucleoprotein A' OS=Caenorhabditis elegans GN=sap-1 PE=1 SV=1 Back     alignment and function description
>sp|Q6UWP7|LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens GN=LCLAT1 PE=1 SV=1 Back     alignment and function description
>sp|Q5F3X0|LCLT1_CHICK Lysocardiolipin acyltransferase 1 OS=Gallus gallus GN=LCLAT1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NYV8|LCLT1_DANRE Lysocardiolipin acyltransferase 1 OS=Danio rerio GN=lclat1 PE=1 SV=1 Back     alignment and function description
>sp|Q3UN02|LCLT1_MOUSE Lysocardiolipin acyltransferase 1 OS=Mus musculus GN=Lclat1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
357617796258 U2 small nuclear ribonucleoprotein A [Da 0.351 0.593 0.764 4e-65
389613272255 U2 small nuclear ribonucleoprotein A, pa 0.351 0.6 0.771 6e-65
240848727263 U2 small nuclear ribonucleoprotein A-lik 0.317 0.524 0.764 1e-61
114052002248 U2 small nuclear ribonucleoprotein A' [B 0.351 0.616 0.738 2e-61
48103229246 PREDICTED: probable U2 small nuclear rib 0.351 0.621 0.732 1e-60
340722194246 PREDICTED: probable U2 small nuclear rib 0.349 0.617 0.732 1e-60
380014342246 PREDICTED: probable U2 small nuclear rib 0.351 0.621 0.732 1e-60
91090564237 PREDICTED: similar to U2 small nuclear r 0.351 0.645 0.712 2e-60
383849645246 PREDICTED: probable U2 small nuclear rib 0.351 0.621 0.725 2e-60
158285236247 AGAP007670-PA [Anopheles gambiae str. PE 0.349 0.615 0.725 3e-60
>gi|357617796|gb|EHJ70998.1| U2 small nuclear ribonucleoprotein A [Danaus plexippus] Back     alignment and taxonomy information
 Score =  255 bits (651), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%)

Query: 1   MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGF 60
           MVKLT +LI   MQY NP +DRELDLRGYKIP IEN+GATLDQFDTIDFS+NDIRK+DGF
Sbjct: 1   MVKLTTELIQSSMQYINPCRDRELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGF 60

Query: 61  PLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCL 120
           PLLKRL CLFFNNNRIVR+ ENL++ LPNLETL+LT NN+ ELGDLDPLSTLPKL+TL L
Sbjct: 61  PLLKRLKCLFFNNNRIVRLTENLEQYLPNLETLVLTNNNLSELGDLDPLSTLPKLRTLSL 120

Query: 121 LHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLK 153
           +HNPV N+ HYR YVA+KLP+++LLDF K+K K
Sbjct: 121 MHNPVANKQHYRAYVAYKLPELRLLDFRKIKQK 153




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|389613272|dbj|BAM19997.1| U2 small nuclear ribonucleoprotein A, partial [Papilio xuthus] Back     alignment and taxonomy information
>gi|240848727|ref|NP_001155389.1| U2 small nuclear ribonucleoprotein A-like [Acyrthosiphon pisum] gi|239789140|dbj|BAH71215.1| ACYPI000509 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|114052002|ref|NP_001040446.1| U2 small nuclear ribonucleoprotein A' [Bombyx mori] gi|95102924|gb|ABF51403.1| U2 small nuclear ribonucleoprotein A' [Bombyx mori] Back     alignment and taxonomy information
>gi|48103229|ref|XP_395530.1| PREDICTED: probable U2 small nuclear ribonucleoprotein A' [Apis mellifera] Back     alignment and taxonomy information
>gi|340722194|ref|XP_003399493.1| PREDICTED: probable U2 small nuclear ribonucleoprotein A'-like [Bombus terrestris] gi|350416563|ref|XP_003490993.1| PREDICTED: probable U2 small nuclear ribonucleoprotein A'-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380014342|ref|XP_003691194.1| PREDICTED: probable U2 small nuclear ribonucleoprotein A'-like [Apis florea] Back     alignment and taxonomy information
>gi|91090564|ref|XP_971653.1| PREDICTED: similar to U2 small nuclear ribonucleoprotein A [Tribolium castaneum] gi|270013888|gb|EFA10336.1| hypothetical protein TcasGA2_TC012554 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383849645|ref|XP_003700455.1| PREDICTED: probable U2 small nuclear ribonucleoprotein A'-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|158285236|ref|XP_001687866.1| AGAP007670-PA [Anopheles gambiae str. PEST] gi|157019895|gb|EDO64515.1| AGAP007670-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
FB|FBgn0033210265 U2A "U2A" [Drosophila melanoga 0.351 0.577 0.653 1.2e-66
ZFIN|ZDB-GENE-041114-82277 snrpa1 "small nuclear ribonucl 0.351 0.552 0.718 2.3e-66
UNIPROTKB|F1NAC8255 SNRPA1 "Uncharacterized protei 0.351 0.6 0.692 3.7e-64
MGI|MGI:1916231255 Snrpa1 "small nuclear ribonucl 0.351 0.6 0.692 1.6e-63
RGD|2320415255 LOC100364748 "U2 small nuclear 0.351 0.6 0.692 1.6e-63
RGD|2320494255 Snrpa1 "small nuclear ribonucl 0.351 0.6 0.692 1.6e-63
UNIPROTKB|A6H788255 SNRPA1 "Uncharacterized protei 0.351 0.6 0.692 5.4e-63
UNIPROTKB|E2QWU2255 SNRPA1 "Uncharacterized protei 0.351 0.6 0.692 5.4e-63
UNIPROTKB|P09661255 SNRPA1 "U2 small nuclear ribon 0.351 0.6 0.692 5.4e-63
UNIPROTKB|F1RWS8255 SNRPA1 "Uncharacterized protei 0.351 0.6 0.692 5.4e-63
FB|FBgn0033210 U2A "U2A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 532 (192.3 bits), Expect = 1.2e-66, Sum P(3) = 1.2e-66
 Identities = 100/153 (65%), Positives = 124/153 (81%)

Query:     1 MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGF 60
             MVKLT +LI Q MQY NP ++RELDLRGYKIP IEN+GATLDQFDTID S+ND+RK+D  
Sbjct:     1 MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNL 60

Query:    61 PLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCL 120
             P L RL CL  NNNRI+RI+E L+E +PNL ++ILTGNN+QEL DL+PL    KL+T+CL
Sbjct:    61 PHLPRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICL 120

Query:   121 LHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLK 153
             L NPV  +P+YR Y+A+K PQ++LLDF K+K K
Sbjct:   121 LINPVSTKPNYREYMAYKFPQLRLLDFRKIKQK 153


GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005686 "U2 snRNP" evidence=ISS
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
ZFIN|ZDB-GENE-041114-82 snrpa1 "small nuclear ribonucleoprotein polypeptide A'" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAC8 SNRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1916231 Snrpa1 "small nuclear ribonucleoprotein polypeptide A'" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2320415 LOC100364748 "U2 small nuclear ribonucleoprotein polypeptide A-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2320494 Snrpa1 "small nuclear ribonucleoprotein polypeptide A'" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6H788 SNRPA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWU2 SNRPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P09661 SNRPA1 "U2 small nuclear ribonucleoprotein A'" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWS8 SNRPA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P09661RU2A_HUMANNo assigned EC number0.69280.35170.6yesN/A
P57784RU2A_MOUSENo assigned EC number0.69280.35170.6yesN/A
P43333RU2A_ARATHNo assigned EC number0.56200.34020.5943yesN/A
Q9V4Q8RU2A_DROMENo assigned EC number0.65350.35170.5773yesN/A
Q9BLB6RU2A_CAEELNo assigned EC number0.51310.34940.6007yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1.510.737
3rd Layer2.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
cd07990193 cd07990, LPLAT_LCLAT1-like, Lysophospholipid Acylt 1e-36
PLN02510374 PLN02510, PLN02510, probable 1-acyl-sn-glycerol-3- 5e-33
PLN02380376 PLN02380, PLN02380, 1-acyl-sn-glycerol-3-phosphate 8e-18
smart00563118 smart00563, PlsC, Phosphate acyltransferases 2e-09
pfam01553131 pfam01553, Acyltransferase, Acyltransferase 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG0204255 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyl 5e-04
cd07989184 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltr 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|153252 cd07990, LPLAT_LCLAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like Back     alignment and domain information
 Score =  132 bits (334), Expect = 1e-36
 Identities = 59/201 (29%), Positives = 94/201 (46%), Gaps = 23/201 (11%)

Query: 154 ALMNVMFGTEIILSGDSIDAGDQ-ALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLK 212
            L   + G ++++ GD      + AL I NHR+ +DW  LW       R    RLK+VLK
Sbjct: 2   FLFEWLSGVKVVVYGDEPKLPKERALIISNHRSEVDWLVLWMLADRFGR--LGRLKIVLK 59

Query: 213 SPIRHAPGPGWVMQIAGFLYIERNWDSDQQAMTEQLDYFHDIQHPVQ------------E 260
             +++ P  GW  Q+  F++++R W+ D++ +  QL    D   P              E
Sbjct: 60  DSLKYPPLGGWGWQLGEFIFLKRKWEKDEKTIKRQLKRLKDSPEPFWLLIFPEGTRFTEE 119

Query: 261 KQEAAALFKSKKGKELQKEISK-KAKTFVPGAALQDLSNIPTGNQLNAVYDITVGYLGTI 319
           K+E +  F  K G    K +   + K FV  A L+ L      + ++AVYD+T+ Y    
Sbjct: 120 KKERSQEFAEKNGLPPLKHVLLPRTKGFV--AILETL-----RDAVDAVYDVTIAYPDGK 172

Query: 320 PQSEMDAVHGKFPSQAHFHIK 340
           P SE   + G  P + H H++
Sbjct: 173 PPSEQRLLLGGKPREVHVHVR 193


Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as Lysocardiolipin acyltransferase 1 (LCLAT1) or 1-acyl-sn-glycerol-3-phosphate acyltransferase and similar proteins. Length = 193

>gnl|CDD|178126 PLN02510, PLN02510, probable 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>gnl|CDD|178006 PLN02380, PLN02380, 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>gnl|CDD|214724 smart00563, PlsC, Phosphate acyltransferases Back     alignment and domain information
>gnl|CDD|216567 pfam01553, Acyltransferase, Acyltransferase Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223282 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|153251 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 435
KOG1505|consensus346 100.0
PLN02380376 1-acyl-sn-glycerol-3-phosphate acyltransferase 100.0
PLN02510374 probable 1-acyl-sn-glycerol-3-phosphate acyltransf 100.0
PRK14014301 putative acyltransferase; Provisional 100.0
KOG1644|consensus233 100.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.92
cd07990193 LPLAT_LCLAT1-like Lysophospholipid Acyltransferase 99.92
KOG4194|consensus 873 99.58
KOG4194|consensus 873 99.55
KOG0617|consensus264 99.55
KOG0444|consensus 1255 99.47
KOG0444|consensus 1255 99.43
KOG0617|consensus264 99.43
KOG2848|consensus276 99.4
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.37
KOG1259|consensus490 99.36
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.32
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.31
KOG0472|consensus565 99.26
KOG0618|consensus 1081 99.26
KOG0472|consensus565 99.25
KOG1259|consensus490 99.24
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.19
KOG4237|consensus498 99.16
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.12
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.1
KOG4237|consensus498 99.1
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.08
KOG0532|consensus 722 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.97
KOG0618|consensus 1081 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
KOG2739|consensus260 98.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.87
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.85
KOG0531|consensus414 98.84
KOG0532|consensus 722 98.83
KOG2123|consensus388 98.79
KOG1859|consensus 1096 98.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.78
KOG0531|consensus414 98.76
KOG3207|consensus505 98.74
PRK15018245 1-acyl-sn-glycerol-3-phosphate acyltransferase; Pr 98.71
KOG1859|consensus 1096 98.7
KOG3207|consensus505 98.67
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.62
PLN03150623 hypothetical protein; Provisional 98.6
PTZ00261355 acyltransferase; Provisional 98.49
COG0204255 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferas 98.48
PLN03150623 hypothetical protein; Provisional 98.48
KOG4579|consensus177 98.44
KOG4579|consensus177 98.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.33
KOG1909|consensus382 98.3
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.28
cd07991211 LPLAT_LPCAT1-like Lysophospholipid Acyltransferase 98.25
KOG1644|consensus233 98.25
PLN02901214 1-acyl-sn-glycerol-3-phosphate acyltransferase 98.07
KOG3665|consensus 699 98.02
KOG4658|consensus889 98.0
KOG2982|consensus418 97.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.94
KOG1909|consensus382 97.93
KOG4658|consensus889 97.87
KOG2982|consensus418 97.84
PF01553132 Acyltransferase: Acyltransferase; InterPro: IPR002 97.82
PRK15386426 type III secretion protein GogB; Provisional 97.72
cd07988163 LPLAT_ABO13168-like Lysophospholipid Acyltransfera 97.67
KOG3665|consensus 699 97.61
TIGR00530130 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltra 97.51
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.39
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.39
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
PLN02833376 glycerol acyltransferase family protein 97.32
KOG2120|consensus419 97.29
cd07993205 LPLAT_DHAPAT-like Lysophospholipid Acyltransferase 97.26
PLN02783315 diacylglycerol O-acyltransferase 97.24
KOG2120|consensus419 97.2
KOG2739|consensus260 97.15
PRK03355 783 glycerol-3-phosphate acyltransferase; Validated 97.06
cd07992203 LPLAT_AAK14816-like Lysophospholipid Acyltransfera 97.02
smart00563118 PlsC Phosphate acyltransferases. Function in phosp 96.98
KOG2123|consensus388 96.9
PRK15386426 type III secretion protein GogB; Provisional 96.85
PRK04974 818 glycerol-3-phosphate acyltransferase; Validated 96.75
PRK08043 718 bifunctional acyl-[acyl carrier protein] synthetas 96.75
PTZ00374 1108 dihydroxyacetone phosphate acyltransferase; Provis 96.69
TIGR03703 799 plsB glycerol-3-phosphate O-acyltransferase. Membe 96.64
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.46
cd07985235 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLA 96.18
KOG3763|consensus585 95.99
cd06551187 LPLAT Lysophospholipid acyltransferases (LPLATs) o 95.96
cd07986210 LPLAT_ACT14924-like Lysophospholipid Acyltransfera 95.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.7
KOG0473|consensus326 95.58
PLN02588525 glycerol-3-phosphate acyltransferase 95.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.87
smart0037026 LRR Leucine-rich repeats, outliers. 94.87
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.49
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.12
KOG0473|consensus326 93.84
KOG3864|consensus221 93.56
PLN02177497 glycerol-3-phosphate acyltransferase 93.52
KOG1947|consensus482 93.01
cd07989184 LPLAT_AGPAT-like Lysophospholipid Acyltransferases 92.38
cd07987212 LPLAT_MGAT-like Lysophospholipid Acyltransferases 91.7
PRK11915 621 glycerol-3-phosphate acyltransferase; Reviewed 91.05
KOG3864|consensus221 90.85
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 90.21
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.13
smart0037026 LRR Leucine-rich repeats, outliers. 90.13
PLN02499498 glycerol-3-phosphate acyltransferase 89.07
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.9
KOG4341|consensus483 88.32
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.14
KOG3729|consensus 715 86.09
KOG3763|consensus585 85.8
KOG1947|consensus482 85.37
cd07983189 LPLAT_DUF374-like Lysophospholipid Acyltransferase 85.29
KOG4308|consensus478 84.2
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.4
>KOG1505|consensus Back     alignment and domain information
Probab=100.00  E-value=6e-45  Score=346.75  Aligned_cols=215  Identities=32%  Similarity=0.647  Sum_probs=188.9

Q ss_pred             hhcccEEEEecCCCc----ccccceeecCCccccccchhchhhhhcCCCCcceeEEeecCccccCCccchhhhhhceecc
Q psy18204        158 VMFGTEIILSGDSID----AGDQALFIMNHRTRLDWNFLWGCMFHASRPSAHRLKMVLKSPIRHAPGPGWVMQIAGFLYI  233 (435)
Q Consensus       158 ~~~~~~l~lsgn~i~----~~~~~~~i~nh~~~lD~l~l~~~~~~~~~~~~~~~~~~lK~~Lk~iP~~G~~~~~~~~ifl  233 (435)
                      ++.+.++...++..+    .+++++.++||++++||+++|..+  .+.+..++.++++|++++|+|++||+|+.++|||+
T Consensus        50 ~~~~~~v~~~~~~~~~~~~~~e~alli~NH~~~~Dwl~~w~~~--~~~G~l~~~~~~lK~~lk~~Pi~Gw~~~~~~fiFl  127 (346)
T KOG1505|consen   50 WYAGSEVNGYGDDVTGDKYGKERALLIANHQSEVDWLYLWTYA--QRKGVLGNVKIVLKKSLKYLPIFGWGMWFHGFIFL  127 (346)
T ss_pred             hcccceeeeeeecccccccCCCceEEEeccccccchhhHHHHH--hcCCchhhhhHHHhhHHHhCcchheeeeecceEEE
Confidence            555556665554444    579999999999999999999554  44455679999999999999999999999999999


Q ss_pred             ccChHHhHHHHHHHHHHhhcCCCchh------------hhHHHhhhhcCccCcc-ccHHHHhhhcccccCCccccccCCC
Q psy18204        234 ERNWDSDQQAMTEQLDYFHDIQHPVQ------------EKQEAAALFKSKKGKE-LQKEISKKAKTFVPGAALQDLSNIP  300 (435)
Q Consensus       234 ~R~~~~d~~~~~~~~~~l~~~~~~~~------------~~~~~~~~f~~~eG~~-~~~~l~pr~~~~~~~~~~~~l~~~~  300 (435)
                      +|+|++|++.+.+.++++.+...|+|            ++++.++.|+.++|.+ +.|+++||++||..  +++.++   
T Consensus       128 ~R~~~~d~~~l~~~~k~l~~~~~~~wLlLFPEGT~~~~~~~~~S~~fa~k~GLp~l~nvLlPRt~Gf~~--~l~~lr---  202 (346)
T KOG1505|consen  128 ERNWEKDEKTLISLLKHLKDSPDPYWLLLFPEGTRFTEKKHERSQEFAAKNGLPHLKNVLLPRTKGFKA--ALEELR---  202 (346)
T ss_pred             ecchhhhHHHHHHHHHHhccCCCceEEEEecCCCcccHHHHHHHHHHHHHcCCCCccceeccCcchHHH--HHHHhc---
Confidence            99999999999999999999977763            4567888999999987 78999999999998  677665   


Q ss_pred             CCCCCCEEEEEEeecCCCCCCC--ccccccCCCCCeEEEEEEEEeCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHcCC
Q psy18204        301 TGNQLNAVYDITVGYLGTIPQS--EMDAVHGKFPSQAHFHIKKYSTDSLPVSDTDAMKAWLNQIWAEKEAHLNRFYDKGY  378 (435)
Q Consensus       301 ~~~~~~~vyD~Ti~Y~~~~~~~--~~~~l~g~~p~~v~i~~~~~~i~~ip~~~~~~~~~wl~~~~~eKd~ll~~~~~~g~  378 (435)
                        +.++||||+||+|++..+++  .+..+.|..|++||+|+||+||++||. |++++++||+++|+|||++|++||++|+
T Consensus       203 --~~l~~IyD~Ti~y~~~~~~~~~~~~~~~~~~~~~v~ihirr~pi~~IP~-de~~~~~WL~~~f~~KDkll~~fy~tg~  279 (346)
T KOG1505|consen  203 --NSLDAIYDVTIGYSKAEPPPYETMLFLLGGEPKEVHIHIRRFPIKEIPE-DEEELANWLYDRFEEKDKLLEEFYETGS  279 (346)
T ss_pred             --CCCceEEEEEEecCCCCCCchhhheeeccCCCceeEEEEEecccccCCC-ChHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence              79999999999999998887  455667888999999999999999998 5699999999999999999999999999


Q ss_pred             CCCC
Q psy18204        379 FDGG  382 (435)
Q Consensus       379 F~~~  382 (435)
                      ||+.
T Consensus       280 f~~~  283 (346)
T KOG1505|consen  280 FPGI  283 (346)
T ss_pred             CCCC
Confidence            9998



>PLN02380 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PLN02510 probable 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PRK14014 putative acyltransferase; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG2848|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PRK15018 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00261 acyltransferase; Provisional Back     alignment and domain information
>COG0204 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd07991 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PLN02901 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF01553 Acyltransferase: Acyltransferase; InterPro: IPR002123 This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function [] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd07988 LPLAT_ABO13168-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168 Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>TIGR00530 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransferases Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PLN02833 glycerol acyltransferase family protein Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>cd07993 LPLAT_DHAPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT-like Back     alignment and domain information
>PLN02783 diacylglycerol O-acyltransferase Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PRK03355 glycerol-3-phosphate acyltransferase; Validated Back     alignment and domain information
>cd07992 LPLAT_AAK14816-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like Back     alignment and domain information
>smart00563 PlsC Phosphate acyltransferases Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK04974 glycerol-3-phosphate acyltransferase; Validated Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PTZ00374 dihydroxyacetone phosphate acyltransferase; Provisional Back     alignment and domain information
>TIGR03703 plsB glycerol-3-phosphate O-acyltransferase Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>cd07985 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>cd06551 LPLAT Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis Back     alignment and domain information
>cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924 Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PLN02588 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>cd07989 LPLAT_AGPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like Back     alignment and domain information
>cd07987 LPLAT_MGAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like Back     alignment and domain information
>PRK11915 glycerol-3-phosphate acyltransferase; Reviewed Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3729|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>cd07983 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374 Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
1a9n_A176 Crystal Structure Of The Spliceosomal U2b''-U2a' Pr 2e-59
2jqd_A169 Structure Of The Leucine-Rich Repeat Domain Of Lanp 2e-06
2ell_A168 Solution Structure Of The Leucine Rich Repeat Of Hu 9e-06
2je0_A149 Crystal Structure Of Pp32 Length = 149 1e-05
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 7e-05
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 7e-05
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 8e-04
>pdb|1A9N|A Chain A, Crystal Structure Of The Spliceosomal U2b''-U2a' Protein Complex Bound To A Fragment Of U2 Small Nuclear Rna Length = 176 Back     alignment and structure

Iteration: 1

Score = 226 bits (576), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 107/153 (69%), Positives = 126/153 (82%) Query: 1 MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGF 60 MVKLTA+LI Q QYTN V+DRELDLRGYKIPVIEN+GATLDQFD IDFS+N+IRK+DGF Sbjct: 1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF 60 Query: 61 PLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCL 120 PLL+RL L NNNRI RI E L + LP+L LILT N++ ELGDLDPL++L L LC+ Sbjct: 61 PLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCI 120 Query: 121 LHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLK 153 L NPV N+ HYRLYV +K+PQV++LDF KVKLK Sbjct: 121 LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 153
>pdb|2JQD|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of Lanp Length = 169 Back     alignment and structure
>pdb|2ELL|A Chain A, Solution Structure Of The Leucine Rich Repeat Of Human Acidic Leucine- Rich Nuclear Phosphoprotein 32 Family Member B Length = 168 Back     alignment and structure
>pdb|2JE0|A Chain A, Crystal Structure Of Pp32 Length = 149 Back     alignment and structure
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
 Score =  196 bits (501), Expect = 1e-61
 Identities = 107/153 (69%), Positives = 126/153 (82%)

Query: 1   MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGF 60
           MVKLTA+LI Q  QYTN V+DRELDLRGYKIPVIEN+GATLDQFD IDFS+N+IRK+DGF
Sbjct: 1   MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF 60

Query: 61  PLLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCL 120
           PLL+RL  L  NNNRI RI E L + LP+L  LILT N++ ELGDLDPL++L  L  LC+
Sbjct: 61  PLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCI 120

Query: 121 LHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLK 153
           L NPV N+ HYRLYV +K+PQV++LDF KVKLK
Sbjct: 121 LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 153


>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.89
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.66
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.66
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.66
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.64
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.62
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.62
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.62
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.62
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.61
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.6
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.59
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.59
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.57
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.57
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.56
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.56
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.56
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.56
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.56
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.55
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.54
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.54
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.54
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.53
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.53
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.52
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.51
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.5
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.49
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.49
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.49
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.49
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.49
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.48
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.48
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.42
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.34
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.31
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.28
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.27
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.22
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.94
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.81
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.37
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.05
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.81
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.51
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.13
1iuq_A367 Glycerol-3-phosphate acyltransferase; open twisted 96.33
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 82.39
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
Probab=99.89  E-value=4e-23  Score=181.45  Aligned_cols=155  Identities=69%  Similarity=1.116  Sum_probs=143.4

Q ss_pred             CccccHHHHhcccccCCCCcceEEEecCCCcccccccccCCCCCCEEEccCCCCCCcCCCCCCCCCCEEEccCCcccccc
Q psy18204          1 MVKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIA   80 (435)
Q Consensus         1 ~~~lt~~~i~~~~~~~~~~~L~~L~L~~n~i~~i~~~~~~l~~L~~L~Ls~N~l~~l~~l~~l~~L~~L~ls~N~i~~i~   80 (435)
                      ||++|.+++...+++.++.+|+.|++++|.++.++......++|+.|++++|.|++++.++.+++|++|++++|+|+.++
T Consensus         1 m~~lt~~~i~~~~~~~~~~~L~~L~l~~n~l~~i~~~~~~~~~L~~L~Ls~N~l~~~~~l~~l~~L~~L~Ls~N~l~~~~   80 (176)
T 1a9n_A            1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG   80 (176)
T ss_dssp             -CCCCHHHHHTSCEEECTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECCCCCCSSCCEEECCSSCCCEEC
T ss_pred             CccccHHHHHHHHhcCCcCCceEEEeeCCCCchhHHhhhcCCCCCEEECCCCCCCcccccccCCCCCEEECCCCcccccC
Confidence            89999999999999999999999999999999998766555699999999999999988999999999999999999998


Q ss_pred             chhhcCCCCCCeeecCCCcCCCCCCCCCCCCCCCCCEEEeecCCccccccchHHHHhcCCccceeeecchhHHHH
Q psy18204         81 ENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKAL  155 (435)
Q Consensus        81 ~~~~~~l~~L~~L~Ls~N~i~~l~~~~~l~~l~~L~~L~L~~N~i~~~~~~~~~~~~~l~~L~~Ldl~~n~l~~l  155 (435)
                      +.+++.+++|++|+|++|+|+.++.+..+..+++|+.|++++|+++.++.++..++..+++|+.||++.|.+...
T Consensus        81 ~~~~~~l~~L~~L~L~~N~i~~~~~~~~l~~l~~L~~L~l~~N~i~~~~~~~~~~~~~l~~L~~Ld~~~n~~~~~  155 (176)
T 1a9n_A           81 EGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKER  155 (176)
T ss_dssp             SCHHHHCTTCCEEECCSCCCCCGGGGGGGGGCTTCCEEECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHH
T ss_pred             cchhhcCCCCCEEECCCCcCCcchhhHhhhcCCCCCEEEecCCCCCCcHhHHHHHHHHCCccceeCCCcCCHHHH
Confidence            888889999999999999999888655788999999999999999999988777889999999999999998764



>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 435
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-31
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 4e-06
d1iuqa_367 c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransf 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (286), Expect = 5e-31
 Identities = 106/152 (69%), Positives = 125/152 (82%)

Query: 2   VKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFP 61
           VKLTA+LI Q  QYTN V+DRELDLRGYKIPVIEN+GATLDQFD IDFS+N+IRK+DGFP
Sbjct: 1   VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFP 60

Query: 62  LLKRLSCLFFNNNRIVRIAENLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLL 121
           LL+RL  L  NNNRI RI E L + LP+L  LILT N++ ELGDLDPL++L  L  LC+L
Sbjct: 61  LLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCIL 120

Query: 122 HNPVINRPHYRLYVAFKLPQVKLLDFSKVKLK 153
            NPV N+ HYRLYV +K+PQV++LDF KVKLK
Sbjct: 121 RNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK 152


>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Length = 367 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.92
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.41
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.4
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.39
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.17
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.07
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.83
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw s 98.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.36
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.19
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.06
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=9.3e-26  Score=193.38  Aligned_cols=153  Identities=69%  Similarity=1.126  Sum_probs=144.4

Q ss_pred             ccccHHHHhcccccCCCCcceEEEecCCCcccccccccCCCCCCEEEccCCCCCCcCCCCCCCCCCEEEccCCccccccc
Q psy18204          2 VKLTADLIVQCMQYTNPVKDRELDLRGYKIPVIENMGATLDQFDTIDFSNNDIRKIDGFPLLKRLSCLFFNNNRIVRIAE   81 (435)
Q Consensus         2 ~~lt~~~i~~~~~~~~~~~L~~L~L~~n~i~~i~~~~~~l~~L~~L~Ls~N~l~~l~~l~~l~~L~~L~ls~N~i~~i~~   81 (435)
                      ||||+++|...++|.++.++++|+|++|+|+.|++.+..+++|+.|+|++|.|+.+++++.+++|++|++++|+|+.+++
T Consensus         1 ~rLt~~~i~~~~~~~n~~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~~~~l~~L~~L~ls~N~i~~l~~   80 (162)
T d1a9na_           1 VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGE   80 (162)
T ss_dssp             CCCCHHHHHTSCEEECTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECCCCCCSSCCEEECCSSCCCEECS
T ss_pred             CCCCHHHHhhhHhccCcCcCcEEECCCCCCCccCccccccccCCEEECCCCCCCccCCcccCcchhhhhcccccccCCCc
Confidence            89999999999999999999999999999999998888899999999999999999999999999999999999999999


Q ss_pred             hhhcCCCCCCeeecCCCcCCCCCCCCCCCCCCCCCEEEeecCCccccccchHHHHhcCCccceeeecchhHHH
Q psy18204         82 NLQENLPNLETLILTGNNIQELGDLDPLSTLPKLKTLCLLHNPVINRPHYRLYVAFKLPQVKLLDFSKVKLKA  154 (435)
Q Consensus        82 ~~~~~l~~L~~L~Ls~N~i~~l~~~~~l~~l~~L~~L~L~~N~i~~~~~~~~~~~~~l~~L~~Ldl~~n~l~~  154 (435)
                      .++..+++|+.|++++|+|++++++..+..+++|++|++++|+++..+.++.+++..+|+|+.||.+.....+
T Consensus        81 ~~~~~l~~L~~L~L~~N~i~~~~~l~~l~~l~~L~~L~l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~~~e  153 (162)
T d1a9na_          81 GLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKE  153 (162)
T ss_dssp             CHHHHCTTCCEEECCSCCCCCGGGGGGGGGCTTCCEEECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHH
T ss_pred             cccccccccccceeccccccccccccccccccccchhhcCCCccccccchHHHHHHHCCCcCeeCCCCCCHHH
Confidence            8888999999999999999998877788999999999999999999999998899999999999987765543



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure