Psyllid ID: psy1907

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320
MTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLFTILPSSSTSSRLFTTLPSSLAAVPHHIQRQSPAQSYHRMTPGCTDRRTQSPCPSCLKVFKTPKVRAFMGHFLTDSDDDRKERDEFSERLKNRDKNNTKNVATSRQDKRAYEEAAKRLKLEAESRDKIIPKLRIESRRKYLEKRKEDKVAELEADILDDEYLFSEQELTERERRDREHKRKLLELAKEHDKARELEKVQRYYMPKGTKGPEKYEEVDEKEKVPHYEQRKWEDEQMSSAIFRVGAKDREHQEQYELLLDNQIDFIQALSLPGNRDKGEEEMTEKQKKKLNIEETKKSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGEH
cccHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHcccccEEEEEcEEcHHHHHHHcccccEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHccccccccccccEEEEEcccccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHcccccHHccccccccccHHHHHHHHHccccccHHHHHHHHHccccccEEEEcccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHHHHccHHHHHHcccccccHHHHHHHccHHHHHHHHcccccccccccccccHHHHHcccHHHHHHcccccHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHHHccccccccccEEEccccccccHHccccccccccccccccccccccEEEEEcccccEEEEEccccccccccccccccccEEEEEcccccHHHHccccccccccccEEEccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccccccEEEccccccHHHHHHHHHHccccccEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcHHcHHccccccEEEcccccEEEEEcccccccccccEEEEEHHHHccccccccEEEEccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcHHHHHccccccEEEcccccEEEEEcccccccccccEEEEEHHHcccccccccccEEcccHHHHHcccccccccccccccccccHHHHHHHHHHccc
cccHHHHHHHHccccHHHcEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEcccccEEccccccccccEEEEcEcHHHHHHHHcccccccccccEEEEEHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccEEEEEccccEEEcccccccEccccEEEEEEcccHHHEEHHHHHHHHccccHEEEEEEcccccccccHccccccHHccccccccccccccccccccccccccccccccccHHEEEccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHcccHHHHcHHHcccccHHHHcccHHcccHHHHHHHHHHHHHHHHHHccccccHccccccccccccccccHHHHHcccccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHccccccccEEEcccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccEEEEEccccHcHHEEEEcccHHHEEEEEEEccccEEEEEcHHHHHHHHcccccccccEEEEEccHHcHHHccccccccccccEEEEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEEccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccEEEEcccHHHHcccccEEEEEEEEEccHHHHHHHEcccHHHHHHHcHHHccccccccccHHHHHHHHcHHHHccccccccHHHHHHHHHHccccccccHHcEEEHHHHHHHHHHHHHHHHHHHHcEEEEcccccHHHHHHHHHHHcccccccEEcccccEEEEccccEEEEccccHHHcccccEEEEEEEEEccHHHHHHHHcccHHHHHHHccHHcccccccccHccccccHHHHHHHHcccc
mtdgtlhreflsepdlasysVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDaqkfseffddapvfripgrrfpvdiyytkapeadyiDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKEliilpvysnlptdmqtkiflptppnarKVVLATNIaetsltidniiyvidpgfckqnnfnsrtgmesltvvpiskasanqragvitgfnplsdfrgcaHVLGEEVLRGCAHVlgeevlrpevsqpfrsfgylgvmqdCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLThlpttyikrksseykvgngedsfcvsplynltiqsssfQSITIQCFaslqlhhpviqlftilpssstssrlfttlpsslaavphhiqrqspaqsyhrmtpgctdrrtqspcpsclkvfktpkvRAFMghfltdsdddrkERDEFSERLknrdknntknvatsrQDKRAYEEAAKRLKLEAESRDKIIPKLRIESRRKYLEKRKEDKVAELEAdilddeylfsEQELTERERRDREHKRKLLELAKEHDKARELEKVQRyympkgtkgpekyeevdekekvphyeqrkwedEQMSSAIFRVGAKDREHQEQYELLLDNQIDFIQalslpgnrdkgeEEMTEKQKKKLNIEetkkslpiypfkqdLIDAVRDHQVLIIegetgsgkttqipqylheagftkdkmkigctqprrVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMtdgtlhreflsepdlasysvmiideahpkvyvidpgfckqnnfnsrtgmesltvvpiskasanqRAGRAGRVAAGKCFRLYTAWAYKheledntvpeiqRINLGNAVLMLKALGindlihfdfldppphETLVLALEQLYALGAlnhhgdltklgrrmaefpldpmmgkMLLASEKYKCVEEIVTIASMLSVngaifyrpkdkiihADTARKNFFMLGGDHLVLLNIYNqwadadfstQWCYENFIQHRSMKRARDVREQLIGLVQRVEMelvsnptetvNIRKAITAGYFYHIAKLsksgsyktakhnqtvmihpnsslfeelPRWVLYHELVFTTKEFMRQVTEIESKWLLevaphyykpreledstnkkmpktlgKSRAELGGDHLVLLNIYNqwadadfstQWCYENFIQHRSMKRARDVREQLIGLVQRVEMelvsnptetvNIRKAITAGYFYHIAKLsksgsyktakhnqtvmihpnsslfeelPRWVLYHELVFTTKEFMRQVTEIESKWLLevaphyykpreledstnkkmpktlGKSRAELGEH
mtdgtlhreflsepdlasYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSAtldaqkfseffddapvfripGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLFTILPSSSTSSRLFTTLPSSLAAVPHhiqrqspaqsyHRMTPGCtdrrtqspcpsclkvfktpkvrafmghfltdsdddrkERDEFserlknrdknntknvatsrqdkraYEEAAKrlkleaesrdkiipklriesrrkylekrkedkvaeleadilddeylfseqeltererrdrehKRKLLelakehdkarelekvqryympkgtkgpekyeevdekekvphyeqrkwedeqmSSAIFRVGAKDREHQEQYELLLDNQIDFIQALSLPGNRDKGEEEMTEKqkkklnieetkkslpiypfKQDLIDAVRDHQVLIIEgetgsgkttqipQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAirfedctseRTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQrvemelvsnptetvniRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHyykpreledstnkkmpKTLGKSRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQrvemelvsnptetvniRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHyykpreledstnkkmpktlgksraelgeh
MTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLtiqsssfqsitiqCFASLQLHHPVIQlftilpssstssrlfttlpsslAAVPHHIQRQSPAQSYHRMTPGCTDRRTQSPCPSCLKVFKTPKVRAFMGHFLTDSDDDRKERDEFSERLKNRDKNNTKNVATSRQDKRayeeaakrlkleaeSRDKIIPKLRIESRRKYLEKRKEDKVAELEADILDDEYLFSEQELTererrdrehkrkllelAKEHDKARELEKVQRYYMPKGTKGPekyeevdekekvPHYEQRKWEDEQMSSAIFRVGAKDREHQEQYELLLDNQIDFIQALSLPGNRDKGEEEMTEKQKKKLNIEETKKSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPrrvaamsvsarvaEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQragragrvaagKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGEH
**************DLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLFTIL*************************************************PSCLKVFKTPKVRAFMGHFL**********************************************************************************IL***YL*****************************************************************************************QYELLLDNQIDFIQAL*****************************LPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPI**********RAGRVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYK**********************LGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYK**************************
MTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKA***********FNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLF*****************SSLAAVPHHIQRQSPAQSYHRMTPGCTD******************VRAFMGHFLTDSDDDR***************************************************************RKEDKVAELEADILDDEYLFSE***************KLLE**************************************************************************************************************KSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFY****************FMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDST**********SRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYY***************************
MTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLFTILPSSSTSSRLFTTLPSSLAAVP**************************PCPSCLKVFKTPKVRAFMGHFLTDSD*********SERLKNRDK***************YEEAAKRLKLEAESRDKIIPKLRIESRRKYLEKRKEDKVAELEADILDDEYLFSEQEL*********HKRKLLELAKEHDKARELEKVQRYYMPKGT******************EQRKWEDEQMSSAIFRVGAKDREHQEQYELLLDNQIDFIQALSLPGN**************KLNIEETKKSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISK***********RVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGEH
**DGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASA**********NPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLFTILPS************SSLA*********************C****TQSPCPSCLKVFKTPKVRAFMGHFLTDSDDDRKERDEFSERLKNRDKNNTKNVATSRQDKRAYEEAAKRLKLEAESRDKIIPKLRIESRRKYLEKRKEDKVAELEADILDDEYLFSEQELTERERRDREHKRKLLELAKEHDKARELEKVQRYYMPKGTKGPEKYEEVDEKEK*****QR*WEDEQMSSAIFRVGAKDREHQEQYELLLDNQIDFIQALSL*****************KLNIEETKKSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISKAS*********RVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDS*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRFRSDLKLLISSATLDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHATQPLGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQPFRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNGEDSFCVSPLYNLTIQSSSFQSITIQCFASLQLHHPVIQLFTILPSSSTSSRLFTTLPSSLAAVPHHIQRQSPAQSYHRMTPGCTDRRTQSPCPSCLKVFKTPKVRAFMGHFLTDSDDDRKERDEFSERLKNRDKNNTKNxxxxxxxxxxxxxxxxxxxxxAESRDKIIPKLRIESRRKYLEKRKEDKVAELEADILDDEYLFSEQELTERERRDREHKRKLLELAKEHDKARELEKVQRYYMPKGTKGPEKYEEVDEKEKVPHYEQRKWEDEQMSSAIFRVGAKDREHQEQYELLLDNQIDFIQALSLPGNxxxxxxxxxxxxxxxxxxxxxKKSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPKVYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELGEH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1320 2.2.26 [Sep-21-2011]
Q7YR391044 Putative pre-mRNA-splicin yes N/A 0.268 0.340 0.741 1e-166
O602311041 Putative pre-mRNA-splicin yes N/A 0.268 0.341 0.741 1e-166
Q767K61045 Putative pre-mRNA-splicin yes N/A 0.268 0.339 0.744 1e-166
O452441008 Probable pre-mRNA-splicin yes N/A 0.267 0.350 0.711 1e-159
Q54MH31106 Putative pre-mRNA-splicin yes N/A 0.265 0.316 0.659 1e-143
Q107521055 Pre-mRNA-splicing factor yes N/A 0.255 0.319 0.619 1e-126
Q54F051160 ATP-dependent RNA helicas no N/A 0.25 0.284 0.549 1e-111
Q389531168 Probable pre-mRNA-splicin no N/A 0.25 0.282 0.543 1e-110
Q145621220 ATP-dependent RNA helicas no N/A 0.25 0.270 0.555 1e-110
A2A4P01244 ATP-dependent RNA helicas no N/A 0.25 0.265 0.555 1e-110
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function desciption
 Score =  587 bits (1512), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 264/356 (74%), Positives = 311/356 (87%), Gaps = 1/356 (0%)

Query: 796  VYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHE 855
            +YV+DPGFCKQ ++N RTGMESLTV P SKASANQRAGRAGRVAAGKCFRLYTAWAY+HE
Sbjct: 690  IYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHE 749

Query: 856  LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG 915
            LE+ TVPEIQR +LGN VL+LK+LGI+DL+HFDFLDPPP+ETL+LALEQLYALGALNH G
Sbjct: 750  LEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLG 809

Query: 916  DLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADT 975
            +LT  GR+MAE P+DPM+ KM+LASEKY C EEI+T+A+MLSVN +IFYRPKDK++HAD 
Sbjct: 810  ELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADN 869

Query: 976  ARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVE 1035
            AR NFF+ GGDHLVLLN+Y QWA++ +S+QWCYENF+Q RSM+RARDVREQL GL++RVE
Sbjct: 870  ARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVE 929

Query: 1036 MELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVL 1095
            + L S   + + +RKAITAGYFYH A+L++SG Y+T K  QTV IHPNSSLFE+ PRW+L
Sbjct: 930  VGLSSCQGDYIRVRKAITAGYFYHTARLTRSG-YRTVKQQQTVFIHPNSSLFEQQPRWLL 988

Query: 1096 YHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAELG 1151
            YHELV TTKEFMRQV EIES WLLEVAPHYYK +ELED   KKMPK +GK+R ELG
Sbjct: 989  YHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREELG 1044
Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
Pan troglodytes (taxid: 9598)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 Back     alignment and function description
>sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 Back     alignment and function description
>sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1320
383857775889 PREDICTED: putative pre-mRNA-splicing fa 0.261 0.388 0.881 0.0
91082873892 PREDICTED: similar to pre-mRNA-splicing 0.263 0.390 0.877 0.0
193579972871 PREDICTED: putative pre-mRNA-splicing fa 0.268 0.406 0.878 0.0
110762132831 PREDICTED: probable pre-mRNA-splicing fa 0.221 0.352 0.875 0.0
380013661884 PREDICTED: LOW QUALITY PROTEIN: putative 0.262 0.391 0.875 0.0
345490812884 PREDICTED: putative pre-mRNA-splicing fa 0.262 0.392 0.877 0.0
340723935 1425 PREDICTED: putative pre-mRNA-splicing fa 0.256 0.237 0.885 0.0
307190231840 Putative pre-mRNA-splicing factor ATP-de 0.231 0.364 0.861 0.0
157127158892 ATP-dependent RNA helicase [Aedes aegypt 0.260 0.385 0.866 0.0
350424938 1516 PREDICTED: putative pre-mRNA-splicing fa 0.254 0.221 0.893 0.0
>gi|383857775|ref|XP_003704379.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/354 (88%), Positives = 332/354 (93%)

Query: 796  VYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHE 855
            VYVIDPGF KQNNFNSRTGMESL VVPISKASANQRAGRAGRVA GKCFRLYTAWAY+HE
Sbjct: 533  VYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRVAPGKCFRLYTAWAYQHE 592

Query: 856  LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG 915
            LEDNTVPEIQRINLGNAVL LKALGINDL+HFDFLDPPPHETLVLALEQLYALGALNH G
Sbjct: 593  LEDNTVPEIQRINLGNAVLTLKALGINDLVHFDFLDPPPHETLVLALEQLYALGALNHRG 652

Query: 916  DLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADT 975
            +LTKLGRRMAEFPLDPMM KMLLASE+Y+C EE+ TIA+MLSVNGAIFYRPKDKIIHADT
Sbjct: 653  ELTKLGRRMAEFPLDPMMAKMLLASEQYRCSEEVATIAAMLSVNGAIFYRPKDKIIHADT 712

Query: 976  ARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVE 1035
            ARKNF + GGDHL LLN+YNQW  +DFST WCYENFIQHRSMKRARDVREQL+GL+QRVE
Sbjct: 713  ARKNFHVPGGDHLTLLNVYNQWQQSDFSTHWCYENFIQHRSMKRARDVREQLVGLMQRVE 772

Query: 1036 MELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVL 1095
            M+LVS  TETVNIRKAITAGYFYH+A+LSK G YKTAKHNQTV IHPNSSLF+ELPRW+L
Sbjct: 773  MDLVSGITETVNIRKAITAGYFYHVARLSKGGHYKTAKHNQTVSIHPNSSLFQELPRWLL 832

Query: 1096 YHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAE 1149
            YHELVFTTKEFMRQVTEIESKWLLEVAPHYYKP+ELEDSTNKKMPK  G+SR +
Sbjct: 833  YHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPKELEDSTNKKMPKVTGRSRPD 886

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91082873|ref|XP_971279.1| PREDICTED: similar to pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 [Tribolium castaneum] gi|270007078|gb|EFA03526.1| hypothetical protein TcasGA2_TC013528 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193579972|ref|XP_001943062.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|110762132|ref|XP_001122325.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380013661|ref|XP_003690869.1| PREDICTED: LOW QUALITY PROTEIN: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Apis florea] Back     alignment and taxonomy information
>gi|345490812|ref|XP_001601553.2| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340723935|ref|XP_003400342.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307190231|gb|EFN74342.1| Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157127158|ref|XP_001661061.1| ATP-dependent RNA helicase [Aedes aegypti] gi|108873026|gb|EAT37251.1| AAEL010732-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|350424938|ref|XP_003493961.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1320
FB|FBgn0086444894 l(2)37Cb "lethal (2) 37Cb" [Dr 0.267 0.394 0.842 2.9e-273
ZFIN|ZDB-GENE-030131-85891054 dhx16 "DEAH (Asp-Glu-Ala-His) 0.268 0.336 0.727 2.7e-246
UNIPROTKB|F1PGL21042 DHX16 "Uncharacterized protein 0.268 0.340 0.713 9.6e-242
UNIPROTKB|E1BF681045 DHX16 "Uncharacterized protein 0.268 0.339 0.713 2.6e-241
UNIPROTKB|F1RU831045 DHX16 "Putative pre-mRNA-splic 0.268 0.339 0.713 4.2e-241
UNIPROTKB|Q767K61045 DHX16 "Putative pre-mRNA-splic 0.268 0.339 0.713 4.2e-241
RGD|13029631044 Dhx16 "DEAH (Asp-Glu-Ala-His) 0.268 0.340 0.710 5.3e-241
UNIPROTKB|O602311041 DHX16 "Putative pre-mRNA-splic 0.268 0.341 0.710 6.8e-241
WB|WBGene000033921008 mog-4 [Caenorhabditis elegans 0.267 0.350 0.689 9.4e-233
UNIPROTKB|O452441008 mog-4 "Probable pre-mRNA-splic 0.267 0.350 0.689 9.4e-233
FB|FBgn0086444 l(2)37Cb "lethal (2) 37Cb" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1583 (562.3 bits), Expect = 2.9e-273, Sum P(2) = 2.9e-273
 Identities = 299/355 (84%), Positives = 321/355 (90%)

Query:   796 VYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQXXXXXXXXXXXKCFRLYTAWAYKHE 855
             +YVIDPGF KQNNFNSRTGMESL VVPISKASANQ           KCFRLYTAWAYKHE
Sbjct:   540 IYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKHE 599

Query:   856 LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG 915
             LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG
Sbjct:   600 LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG 659

Query:   916 DLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADT 975
             +LTKLGRRMAEFP+DPMMGKMLLASEKYKC EE+VTIA+MLSVN AIFYRPKDKIIHADT
Sbjct:   660 ELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHADT 719

Query:   976 ARKNFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVE 1035
             ARKNF  + GDHL LL +YNQWA+ D+STQWCYENFIQ+RSMKRARDVREQL+GL+QRVE
Sbjct:   720 ARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVE 779

Query:  1036 MELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQTVMIHPNSSLFEELPRWVL 1095
             +++VS   ETVN+RKA TAGYFYH+A+LSK G YKT KHNQTVMIHPNSSLFEELPRWVL
Sbjct:   780 IDMVSCLPETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELPRWVL 839

Query:  1096 YHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGKSRAEL 1150
             YHELVFT+KE+MRQV EIESKWLLEVAPHYYK +ELEDSTNKKMPK  G  RAE+
Sbjct:   840 YHELVFTSKEYMRQVIEIESKWLLEVAPHYYKAKELEDSTNKKMPKVAG--RAEM 892
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-030131-8589 dhx16 "DEAH (Asp-Glu-Ala-His) box polypeptide 16" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGL2 DHX16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF68 DHX16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU83 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q767K6 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1302963 Dhx16 "DEAH (Asp-Glu-Ala-His) box polypeptide 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60231 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00003392 mog-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O45244 mog-4 "Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1320
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-97
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-87
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 4e-55
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 9e-55
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 1e-51
TIGR019671283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-50
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-48
PRK111311294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-47
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-44
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 9e-38
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 7e-36
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 5e-35
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 5e-35
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-33
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 3e-28
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-25
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 6e-25
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 3e-21
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 2e-20
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-19
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 5e-18
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-17
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 6e-14
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-08
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 6e-08
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 8e-08
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-07
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 4e-07
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-05
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 6e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 8e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.002
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
COG4717984 COG4717, COG4717, Uncharacterized conserved protei 0.004
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  332 bits (853), Expect = 1e-97
 Identities = 125/231 (54%), Positives = 156/231 (67%), Gaps = 7/231 (3%)

Query: 1   MTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIVRF-RSDLKLLISSAT 59
           MTDG L RE  ++P L+ YSV+IIDEAHER+L+TDIL GL+KD++   R DLKL+I SAT
Sbjct: 145 MTDGILLREIQNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSAT 204

Query: 60  LDAQKFSEFFDDAPVFRIPGRRFPVDIYYTKAPEADYI-DACVVSILQIHATQPLGDILV 118
           LDA++FS +F +APV  I GR +PV+I Y    EADYI    +V+ + IH  +  G ILV
Sbjct: 205 LDAERFSAYFGNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIHLREGSGSILV 264

Query: 119 FLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLA 178
           FL GQ EIE   E L+     LG    +L ILP+Y  L  + Q ++F P P   RKVVLA
Sbjct: 265 FLPGQREIERTAEWLEKA--ELGD---DLEILPLYGALSAEEQVRVFEPAPGGKRKVVLA 319

Query: 179 TNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAG 229
           TNIAETSLTI  I YVID G  K+  ++ RTG+  L   PISKASA+QRAG
Sbjct: 320 TNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAG 370

Length = 845
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1320
KOG0923|consensus902 100.0
KOG0924|consensus1042 100.0
KOG0922|consensus674 100.0
KOG0925|consensus699 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0926|consensus1172 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0920|consensus924 100.0
KOG0923|consensus902 100.0
KOG0922|consensus674 100.0
PRK111311294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0924|consensus1042 100.0
TIGR019671283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0925|consensus699 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0926|consensus1172 100.0
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0920|consensus924 100.0
KOG0921|consensus1282 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0345|consensus567 100.0
KOG0331|consensus519 99.97
KOG0330|consensus476 99.96
KOG0921|consensus1282 99.95
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.95
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.94
PTZ00110545 helicase; Provisional 99.94
KOG0343|consensus758 99.93
KOG0328|consensus400 99.93
KOG0342|consensus543 99.93
KOG0333|consensus673 99.93
KOG0336|consensus629 99.93
PRK01172674 ski2-like helicase; Provisional 99.93
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.93
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.92
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.92
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.92
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.92
KOG0340|consensus442 99.92
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.91
PRK02362737 ski2-like helicase; Provisional 99.91
KOG0338|consensus691 99.91
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.91
KOG0339|consensus731 99.91
PTZ00424401 helicase 45; Provisional 99.91
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.9
KOG0335|consensus482 99.9
KOG0326|consensus459 99.9
PRK00254720 ski2-like helicase; Provisional 99.89
KOG0348|consensus708 99.88
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.88
KOG0332|consensus477 99.88
KOG0341|consensus610 99.87
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.87
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.86
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.86
KOG0347|consensus731 99.85
PRK097511490 putative ATP-dependent helicase Lhr; Provisional 99.85
PRK13767876 ATP-dependent helicase; Provisional 99.84
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.83
KOG0334|consensus997 99.81
KOG0327|consensus397 99.81
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.8
KOG4284|consensus980 99.8
KOG0350|consensus620 99.79
PRK106891147 transcription-repair coupling factor; Provisional 99.79
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.79
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.79
KOG0346|consensus569 99.77
COG1204766 Superfamily II helicase [General function predicti 99.77
KOG0344|consensus593 99.76
COG1202830 Superfamily II helicase, archaea-specific [General 99.76
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.75
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.74
PRK01172674 ski2-like helicase; Provisional 99.74
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.73
COG1201814 Lhr Lhr-like helicases [General function predictio 99.71
KOG0337|consensus529 99.69
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.69
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.63
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.62
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.61
KOG0349|consensus725 99.61
PHA02558501 uvsW UvsW helicase; Provisional 99.61
PRK13766773 Hef nuclease; Provisional 99.6
PRK094011176 reverse gyrase; Reviewed 99.58
COG1205851 Distinct helicase family with a unique C-terminal 99.56
PRK09694878 helicase Cas3; Provisional 99.54
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.54
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.52
PRK14701 1638 reverse gyrase; Provisional 99.52
PRK02362737 ski2-like helicase; Provisional 99.52
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.48
TIGR010541171 rgy reverse gyrase. Generally, these gyrases are e 99.48
KOG0354|consensus746 99.45
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.44
KOG0947|consensus1248 99.42
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.4
KOG0948|consensus1041 99.39
KOG0950|consensus1008 99.39
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.38
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.36
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.35
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.35
PRK05298652 excinuclease ABC subunit B; Provisional 99.32
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.31
PRK00254720 ski2-like helicase; Provisional 99.3
PRK05580679 primosome assembly protein PriA; Validated 99.3
KOG0351|consensus941 99.3
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.29
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.29
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.28
KOG0329|consensus387 99.27
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.21
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.19
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.19
KOG0952|consensus1230 99.18
PRK04914956 ATP-dependent helicase HepA; Validated 99.17
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.17
KOG0951|consensus1674 99.11
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.1
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.08
KOG0352|consensus641 99.08
COG1204766 Superfamily II helicase [General function predicti 99.05
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.02
smart0049082 HELICc helicase superfamily c-terminal domain. 99.0
KOG4150|consensus1034 98.99
PTZ00424401 helicase 45; Provisional 98.97
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.97
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.93
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.93
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.9
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 98.9
PTZ00110545 helicase; Provisional 98.85
smart00487201 DEXDc DEAD-like helicases superfamily. 98.83
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.82
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.82
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 98.81
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.8
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 98.78
KOG0353|consensus695 98.76
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.75
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 98.73
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 98.73
PRK12904830 preprotein translocase subunit SecA; Reviewed 98.7
PRK13107908 preprotein translocase subunit SecA; Reviewed 98.69
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.68
COG1202830 Superfamily II helicase, archaea-specific [General 98.65
KOG0953|consensus700 98.65
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.57
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.56
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.51
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 98.46
KOG0949|consensus1330 98.29
KOG0390|consensus776 98.18
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.15
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.08
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 98.0
COG4096875 HsdR Type I site-specific restriction-modification 98.0
PHA02558501 uvsW UvsW helicase; Provisional 97.97
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.96
PRK13767 876 ATP-dependent helicase; Provisional 97.95
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.92
KOG0354|consensus746 97.91
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.9
KOG0952|consensus 1230 97.88
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 97.87
PRK09401 1176 reverse gyrase; Reviewed 97.85
TIGR00643630 recG ATP-dependent DNA helicase RecG. 97.81
PRK12326764 preprotein translocase subunit SecA; Reviewed 97.78
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 97.77
PF1324576 AAA_19: Part of AAA domain 97.76
PRK13766 773 Hef nuclease; Provisional 97.76
KOG0948|consensus 1041 97.73
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 97.72
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.69
PRK14701 1638 reverse gyrase; Provisional 97.69
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.68
KOG0330|consensus476 97.67
PLN031421033 Probable chromatin-remodeling complex ATPase chain 97.65
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.64
COG1198730 PriA Primosomal protein N' (replication factor Y) 97.63
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 97.62
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.56
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 97.53
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.51
KOG1123|consensus776 97.47
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.44
PRK05580679 primosome assembly protein PriA; Validated 97.44
COG1201 814 Lhr Lhr-like helicases [General function predictio 97.42
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 97.4
PRK106891147 transcription-repair coupling factor; Provisional 97.36
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.28
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 97.22
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.2
KOG0343|consensus758 97.19
KOG0345|consensus567 97.12
KOG0342|consensus543 97.08
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 97.04
KOG0331|consensus519 97.04
CHL00122870 secA preprotein translocase subunit SecA; Validate 97.02
COG1205 851 Distinct helicase family with a unique C-terminal 97.0
TIGR00595505 priA primosomal protein N'. All proteins in this f 96.99
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 96.98
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.98
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.91
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 96.88
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.86
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 96.82
KOG0352|consensus641 96.77
smart00382148 AAA ATPases associated with a variety of cellular 96.77
PRK04296190 thymidine kinase; Provisional 96.74
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.71
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.71
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.69
COG11101187 Reverse gyrase [DNA replication, recombination, an 96.65
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.63
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.62
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 96.61
KOG0338|consensus691 96.6
KOG0387|consensus923 96.6
KOG0953|consensus700 96.58
PRK09200790 preprotein translocase subunit SecA; Reviewed 96.55
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.55
PRK09694878 helicase Cas3; Provisional 96.49
KOG0947|consensus 1248 96.39
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.36
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.35
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.34
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.33
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.32
PRK10536262 hypothetical protein; Provisional 96.31
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.29
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.28
COG4098441 comFA Superfamily II DNA/RNA helicase required for 96.27
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.25
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.24
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 96.19
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.19
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.19
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.17
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.15
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 96.13
PRK14974336 cell division protein FtsY; Provisional 96.08
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 95.97
PF13173128 AAA_14: AAA domain 95.97
KOG1803|consensus649 95.95
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.84
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.83
PRK06526254 transposase; Provisional 95.8
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.75
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 95.74
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.73
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 95.6
PRK10867433 signal recognition particle protein; Provisional 95.57
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 95.54
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.53
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 95.53
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.48
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 95.47
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.45
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.45
PRK10416318 signal recognition particle-docking protein FtsY; 95.42
PRK12904830 preprotein translocase subunit SecA; Reviewed 95.41
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.39
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.22
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.19
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.17
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.17
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.16
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 95.14
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.14
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.11
cd03115173 SRP The signal recognition particle (SRP) mediates 95.08
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.03
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.97
PRK00771437 signal recognition particle protein Srp54; Provisi 94.97
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.96
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.96
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.94
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.93
PRK13107 908 preprotein translocase subunit SecA; Reviewed 94.9
smart00487201 DEXDc DEAD-like helicases superfamily. 94.86
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.84
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.82
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 94.81
KOG0350|consensus620 94.74
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.69
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 94.66
PRK13833323 conjugal transfer protein TrbB; Provisional 94.64
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.61
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 94.6
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.6
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.57
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.56
PRK08181269 transposase; Validated 94.56
TIGR00064272 ftsY signal recognition particle-docking protein F 94.52
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 94.51
PRK13851344 type IV secretion system protein VirB11; Provision 94.49
PRK14873665 primosome assembly protein PriA; Provisional 94.49
TIGR00376637 DNA helicase, putative. The gene product may repre 94.48
CHL00122 870 secA preprotein translocase subunit SecA; Validate 94.45
TIGR00959428 ffh signal recognition particle protein. This mode 94.43
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 94.4
PRK04195482 replication factor C large subunit; Provisional 94.38
KOG0391|consensus1958 94.34
PRK12402337 replication factor C small subunit 2; Reviewed 94.32
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 94.29
PF02399824 Herpes_ori_bp: Origin of replication binding prote 94.29
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.27
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.21
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.18
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 94.17
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.15
cd01128249 rho_factor Transcription termination factor rho is 94.13
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.1
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.1
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.07
KOG0733|consensus802 94.07
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.06
PRK08116268 hypothetical protein; Validated 94.06
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 94.05
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.05
PHA02244383 ATPase-like protein 94.01
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 93.99
KOG0335|consensus482 93.96
PRK138261102 Dtr system oriT relaxase; Provisional 93.96
PHA00729226 NTP-binding motif containing protein 93.95
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 93.91
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 93.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.87
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 93.86
PRK06921266 hypothetical protein; Provisional 93.86
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 93.85
PRK13889988 conjugal transfer relaxase TraA; Provisional 93.84
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.82
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 93.81
PRK09183259 transposase/IS protein; Provisional 93.8
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.77
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 93.76
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.7
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 93.69
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 93.59
PF1355562 AAA_29: P-loop containing region of AAA domain 93.57
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.56
PRK08084235 DNA replication initiation factor; Provisional 93.52
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 93.52
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 93.49
PRK10865857 protein disaggregation chaperone; Provisional 93.48
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 93.46
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 93.38
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 93.36
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.26
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.25
PF05729166 NACHT: NACHT domain 93.23
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 93.17
KOG0344|consensus593 93.14
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 93.14
KOG0340|consensus442 93.13
KOG0348|consensus708 93.13
PRK08727233 hypothetical protein; Validated 93.11
PRK11823446 DNA repair protein RadA; Provisional 93.1
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.08
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.08
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 93.06
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 93.05
PRK06835329 DNA replication protein DnaC; Validated 93.01
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 93.0
KOG0333|consensus673 92.98
PRK06893229 DNA replication initiation factor; Validated 92.97
PRK06067234 flagellar accessory protein FlaH; Validated 92.96
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.94
PRK07952244 DNA replication protein DnaC; Validated 92.92
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.91
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 92.91
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.89
PRK10436462 hypothetical protein; Provisional 92.89
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.88
COG3910233 Predicted ATPase [General function prediction only 92.87
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 92.86
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 92.84
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.83
PTZ00293211 thymidine kinase; Provisional 92.8
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 92.77
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 92.73
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 92.72
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 92.71
PRK09435332 membrane ATPase/protein kinase; Provisional 92.67
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.64
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 92.63
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 92.61
PRK00440319 rfc replication factor C small subunit; Reviewed 92.56
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.55
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 92.54
KOG0951|consensus1674 92.51
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 92.51
PRK09112351 DNA polymerase III subunit delta'; Validated 92.49
KOG0385|consensus971 92.44
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.42
PHA02544316 44 clamp loader, small subunit; Provisional 92.41
KOG0392|consensus1549 92.38
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 92.34
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 92.26
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.26
PLN03025319 replication factor C subunit; Provisional 92.23
cd03246173 ABCC_Protease_Secretion This family represents the 92.23
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.16
KOG1000|consensus689 92.15
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.14
CHL00181287 cbbX CbbX; Provisional 92.14
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 92.11
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 92.09
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.09
cd01393226 recA_like RecA is a bacterial enzyme which has rol 92.08
cd03216163 ABC_Carb_Monos_I This family represents the domain 91.98
PRK09087226 hypothetical protein; Validated 91.92
PRK12377248 putative replication protein; Provisional 91.91
PRK12326764 preprotein translocase subunit SecA; Reviewed 91.77
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 91.68
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 91.68
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 91.63
PRK04914 956 ATP-dependent helicase HepA; Validated 91.6
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 91.59
COG2255332 RuvB Holliday junction resolvasome, helicase subun 91.59
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 91.51
TIGR00362405 DnaA chromosomal replication initiator protein Dna 91.5
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 91.48
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 91.42
KOG0339|consensus731 91.38
PRK00149450 dnaA chromosomal replication initiation protein; R 91.36
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 91.31
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 91.23
KOG2373|consensus514 91.14
COG1126240 GlnQ ABC-type polar amino acid transport system, A 91.1
COG1136226 SalX ABC-type antimicrobial peptide transport syst 91.09
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 91.07
PRK13342413 recombination factor protein RarA; Reviewed 91.05
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 91.03
PRK14087450 dnaA chromosomal replication initiation protein; P 91.02
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 90.99
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 90.88
PRK13695174 putative NTPase; Provisional 90.85
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 90.76
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.75
TIGR02688449 conserved hypothetical protein TIGR02688. Members 90.69
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 90.61
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 90.61
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 90.59
PRK14738206 gmk guanylate kinase; Provisional 90.55
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 90.55
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 90.44
KOG0336|consensus629 90.43
PRK03992389 proteasome-activating nucleotidase; Provisional 90.34
PRK12422445 chromosomal replication initiation protein; Provis 90.3
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 90.27
KOG1805|consensus1100 90.25
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 90.17
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 90.15
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 90.08
PF00005137 ABC_tran: ABC transporter This structure is on hol 90.05
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 90.03
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 90.01
PRK08939306 primosomal protein DnaI; Reviewed 89.97
TIGR00767415 rho transcription termination factor Rho. Members 89.92
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 89.91
COG1117253 PstB ABC-type phosphate transport system, ATPase c 89.89
PRK07940394 DNA polymerase III subunit delta'; Validated 89.86
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 89.83
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 89.76
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 89.73
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 89.63
PRK10865857 protein disaggregation chaperone; Provisional 89.62
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 89.59
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 89.57
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 89.51
PRK00300205 gmk guanylate kinase; Provisional 89.49
COG4096875 HsdR Type I site-specific restriction-modification 89.44
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 89.42
PRK14088440 dnaA chromosomal replication initiation protein; P 89.36
KOG1970|consensus634 89.17
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 89.16
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 89.15
PRK05973237 replicative DNA helicase; Provisional 89.13
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 89.09
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 88.94
CHL00095821 clpC Clp protease ATP binding subunit 88.93
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 88.91
PRK05642234 DNA replication initiation factor; Validated 88.85
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 88.84
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 88.81
cd03114148 ArgK-like The function of this protein family is u 88.79
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 88.78
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 88.73
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 88.71
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 88.71
>KOG0923|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.2e-182  Score=1563.43  Aligned_cols=692  Identities=66%  Similarity=1.080  Sum_probs=653.1

Q ss_pred             CCcchhHhHHHHHHHHhhhhhhhhccccccccchHHHHHHHHHhhhhHHhhhhhhhHHHHHHHHHHhHHHHHHHHHHHHH
Q psy1907         447 DSDDDRKERDEFSERLKNRDKNNTKNVATSRQDKRAYEEAAKRLKLEAESRDKIIPKLRIESRRKYLEKRKEDKVAELEA  526 (1320)
Q Consensus       447 ~~~~d~~erd~~a~r~~~rd~~rt~~~~~~~~~~~~~~e~~~r~~~~~~~~~~~~~~lR~~sR~~Yl~kRe~~kl~~~~~  526 (1320)
                      ++..|.+||++|++|+++||++||++++|+   |..++++++|++++.++..    .||+.||++||+|||.+|+++|++
T Consensus        41 ~~~~d~~eR~e~e~~l~~kdk~rtr~~~e~---k~~~ee~~~r~~~~~ed~~----~lR~~Sr~eyl~~r~~~k~e~L~~  113 (902)
T KOG0923|consen   41 ERQNDLKERDELEERLEKKDKDRTRNVVER---KKSYEEAAKRKALEPEDRT----KLRKKSRREYLKKREQKKLEELEA  113 (902)
T ss_pred             HHhhhHHHHHHHHHHHHHhhHHhhhhcccc---hhhHHHHHHhhccCcchhh----HHhhhhhhhhhhhHHHHHHHHHHh
Confidence            355689999999999999999999999997   3367888888866655543    499999999999999999999999


Q ss_pred             hhhhhhhhchhhhccHHHHHHHHHHHHHHHHHHHHHH-HHhhhhhc-ccccCCC-CC-CCCcchhh-hhhccCcchhhhh
Q psy1907         527 DILDDEYLFSEQELTERERRDREHKRKLLELAKEHDK-ARELEKVQ-RYYMPKG-TK-GPEKYEEV-DEKEKVPHYEQRK  601 (1320)
Q Consensus       527 ~~~~~~~~~~~~~lt~~E~~e~~~kk~~l~l~~~~~~-~~~~~~~~-~~~~~~~-~~-~~~~~~~~-~~~~~~~~~~~~~  601 (1320)
                      +|.|+++||++++||++|++|+++|+++|++.+++.+ +++..... .|++|.. ++ .+.+|++. ++.+..+.++|+.
T Consensus       114 ~i~D~~~lf~~eklt~~e~~ele~kkell~~~~~~~~~~~~~~e~~~~y~~~~~~d~~~~~ry~d~~~~e~~~p~~eq~~  193 (902)
T KOG0923|consen  114 EIEDEEYLFGDEKLTKREIRELEYKKELLDRGTKETESASEVEEYRSRYDQPGELDKVEPQRYVDLDEEEKVNPGAEQRA  193 (902)
T ss_pred             hhcchhhhcccchhhhhhHhhhhhHHhhhhhhhhhhhcccchHHHHhhhcccccchhhhhHHHhcccchhccChHHHHHH
Confidence            9999999999999999999999999999997765544 33334444 7888953 33 38899884 4455677899999


Q ss_pred             hHHHhhhhhhhhcCccchh-hhhhhhhhhhhh--hhhHHhccCCCCCCCchhhhhHHHhhhhhHHHHhccCCChhhHHHH
Q psy1907         602 WEDEQMSSAIFRVGAKDRE-HQEQYELLLDNQ--IDFIQALSLPGNRDKGEEEMTEKQKKKLNIEETKKSLPIYPFKQDL  678 (1320)
Q Consensus       602 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~r~~LPi~~~~~~i  678 (1320)
                      ||++|+++|..++|+++.. .+++|++|||++  |||+++..++|.++...........+..+|++.|++||||.+|++|
T Consensus       194 WEd~ql~~a~~~~ga~~~~~~~~~ye~vfdd~~~idF~~e~~~~~~~e~~~~~~~~~~~~~~~iee~RksLPVy~ykdel  273 (902)
T KOG0923|consen  194 WEDHQLGNAMLKFGAKDAKEGSDGYEFVFDDQIVIDFIQESKLAGSNEEDAKDAPTAYERRESIEEVRKSLPVYPYKDEL  273 (902)
T ss_pred             HHHHHhhhhHhhcCCCcCcccccCceeeccchhhhhHHHhhhccccCccccchhhHHHHHHHHHHHHHhcCCchhhHHHH
Confidence            9999999999999999986 589999999996  9999999999998766555445555789999999999999999999


Q ss_pred             HHHHHhCCEEEEEcCCCCchhcHHHHHHHHccCCCCCcEEEEecccHHHHHHHHHHHHHHhCCCCCCeeeEEeecCccCC
Q psy1907         679 IDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKDKMKIGCTQPRRVAAMSVSARVAEEMGVKLGCEVGYAIRFEDCTS  758 (1320)
Q Consensus       679 l~~i~~~~v~ii~geTGsGKTTqvPq~l~e~~~~~~~~~I~~tQPRRvAA~svA~rva~e~~~~lG~~VGY~irfe~~~s  758 (1320)
                      |.+|++|||+||+|||||||||||||||+|+||+++|++|+|||||||||||||.|||+|||++||++|||+||||||||
T Consensus       274 l~av~e~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~EMgvkLG~eVGYsIRFEdcTS  353 (902)
T KOG0923|consen  274 LKAVKEHQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAEEMGVKLGHEVGYSIRFEDCTS  353 (902)
T ss_pred             HHHHHhCcEEEEEcCCCCCccccccHHHHhcccccCCceEeecCcchHHHHHHHHHHHHHhCcccccccceEEEeccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccEEEEccHHHHHHHhcCCCCCCccEEEEcccccc-------------------------------------------
Q psy1907         759 ERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPK-------------------------------------------  795 (1320)
Q Consensus       759 ~~T~i~y~TdG~Llrel~~dp~L~~ys~iIiDE~HER-------------------------------------------  795 (1320)
                      ++|+|+|||||||||||++||+|++||||||||||||                                           
T Consensus       354 ekTvlKYMTDGmLlREfL~epdLasYSViiiDEAHERTL~TDILfgLvKDIar~RpdLKllIsSAT~DAekFS~fFDdap  433 (902)
T KOG0923|consen  354 EKTVLKYMTDGMLLREFLSEPDLASYSVIIVDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATMDAEKFSAFFDDAP  433 (902)
T ss_pred             cceeeeeecchhHHHHHhccccccceeEEEeehhhhhhhhhhHHHHHHHHHHhhCCcceEEeeccccCHHHHHHhccCCc
Confidence            9999999999999999999999999999999999999                                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy1907         796 --------------------------------------------------------------------------------  795 (1320)
Q Consensus       796 --------------------------------------------------------------------------------  795 (1320)
                                                                                                      
T Consensus       434 IF~iPGRRyPVdi~Yt~~PEAdYldAai~tVlqIH~tqp~GDILVFltGQeEIEt~~e~l~~~~~~LGski~eliv~PiY  513 (902)
T KOG0923|consen  434 IFRIPGRRYPVDIFYTKAPEADYLDAAIVTVLQIHLTQPLGDILVFLTGQEEIETVKENLKERCRRLGSKIRELIVLPIY  513 (902)
T ss_pred             EEeccCcccceeeecccCCchhHHHHHHhhheeeEeccCCccEEEEeccHHHHHHHHHHHHHHHHHhccccceEEEeecc
Confidence                                                                                            


Q ss_pred             --------------------------------------eEEEcCCccceeeccCCCCcceeEEEEecHhhHHHHhcccCC
Q psy1907         796 --------------------------------------VYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGR  837 (1320)
Q Consensus       796 --------------------------------------~~ViD~G~~k~~~y~~~~~~~~L~~~~iSkasa~QR~GRAGR  837 (1320)
                                                            .||||+||+|++.|||++||++|.++|||||||+||+|||||
T Consensus       514 aNLPselQakIFePtP~gaRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynprtGmesL~v~piSKAsA~QRaGRAGR  593 (902)
T KOG0923|consen  514 ANLPSELQAKIFEPTPPGARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNPRTGMESLLVTPISKASANQRAGRAGR  593 (902)
T ss_pred             ccCChHHHHhhcCCCCCCceeEEEeecchhhceeecCeEEEecCccccccCcCCCcCceeEEEeeechhhhhhhccccCC
Confidence                                                  699999999999999999999999999999999999999999


Q ss_pred             ccCCeEEEecchHHhhhhccCCCchhhhccChHHHHHHHHHcCCCCcccccCCCCCChHHHHHHHHHHHHccccCCCCCc
Q psy1907         838 VAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGDL  917 (1320)
Q Consensus       838 ~~pG~cyrLyt~~~~~~~l~~~~~PEI~R~~L~~~vL~lk~lgi~d~~~f~fldpP~~~~l~~Ale~L~~LgAld~~g~L  917 (1320)
                      |+||+||||||.++|.+++++.++|||||+||+++||.||+|||+|+++||||||||.++|..|+++||+|||||..|+|
T Consensus       594 tgPGKCfRLYt~~aY~~eLE~~t~PEIqRtnL~nvVL~LkSLGI~Dl~~FdFmDpPp~etL~~aLE~LyaLGALn~~GeL  673 (902)
T KOG0923|consen  594 TGPGKCFRLYTAWAYEHELEEMTVPEIQRTNLGNVVLLLKSLGIHDLIHFDFLDPPPTETLLKALEQLYALGALNHLGEL  673 (902)
T ss_pred             CCCCceEEeechhhhhhhhccCCCcceeeccchhHHHHHHhcCcchhcccccCCCCChHHHHHHHHHHHHhhccccccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccCChhhHHHHHhhhhccchHHHHHHHhhcccCCccccCChhHHHHHHHHHhhhcccCCCHHHHHHHHHHH
Q psy1907         918 TKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADTARKNFFMLGGDHLVLLNIYNQW  997 (1320)
Q Consensus       918 T~lG~~ma~lPldP~laK~Ll~s~~~~c~~e~ltIaA~Lsv~~~~f~~p~~~~~~a~~~r~~f~~~~gDhltllnvy~~w  997 (1320)
                      |.+|++|++||+||+++|||+++..++|++|++||+||||+++++||+|+++.++||++++.|..+.|||+++|++|++|
T Consensus       674 Tk~GrrMaEfP~dPmlsKmi~as~ky~cs~EiitiaamlS~~~svfyrpk~~~v~ad~a~~~f~~~~gDhi~~L~vyn~w  753 (902)
T KOG0923|consen  674 TKLGRRMAEFPVDPMLSKMIVASEKYKCSEEIITIAAMLSVGASVFYRPKDKQVHADNARKNFEEPVGDHIVLLNVYNQW  753 (902)
T ss_pred             hhhhhhhhhcCCCHHHHhHHhhhccccchHHHHHHHHHHhcCchheecchhhhhhhhhhhhccCCCCcchhhhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcccchhhHHhhccchhhHHHHHHHHHHHHHHHHhhhccccCCCccchHHHHHHHhccccchhhcccCCCcccccCCce
Q psy1907         998 ADADFSTQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNPTETVNIRKAITAGYFYHIAKLSKSGSYKTAKHNQT 1077 (1320)
Q Consensus       998 ~~~~~~~~wC~~n~l~~~~l~~a~~ir~QL~~~l~r~~~~~~s~~~~~~~i~kal~aG~~~nvA~l~~~g~y~t~~~~~~ 1077 (1320)
                      ..++++.+||++||+++++|++|+++|.||.+++.++++...++..+...|++|+.+|||+|+|++.++|+|+++++.+.
T Consensus       754 ~es~~s~~wC~e~~iq~~sm~rardir~qL~gll~~v~~~~~s~~~~~~~irk~i~aGff~h~a~l~~~g~y~tvk~~~t  833 (902)
T KOG0923|consen  754 KESKYSTQWCYENFIQYRSMKRARDIRDQLEGLLERVEIDLSSNQNDLDKIRKAITAGFFYHTAKLSKGGHYRTVKHPQT  833 (902)
T ss_pred             hhcchhhHHHHHhhhhHHHHHHHHHHHHHHHHHhhhccccccCChHHHHHHHHHHhccccccceeccCCCcceeeccCcc
Confidence            99999999999999999999999999999999999999999999888899999999999999999999999999999999


Q ss_pred             EEECCCCCCCccCCcccchhhhhcchHhHhhheeeeChhchHhhcCCCcccccccccccccCcccccc
Q psy1907        1078 VMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKMPKTLGK 1145 (1320)
Q Consensus      1078 v~iHPsS~l~~~~p~~vvy~elv~Tsk~y~r~vt~I~~~wLle~ap~~~~~k~~~~~~~kk~~~~~~~ 1145 (1320)
                      |++||.|++|...|.||+||++|+|+|+|||++++|.++||+++|||||+.+++++..++|||+..++
T Consensus       834 v~~hp~S~l~~~~P~wvvy~eLv~tske~mr~~~e~e~~Wlie~aphyyk~kdled~~~kk~~k~~g~  901 (902)
T KOG0923|consen  834 VSIHPNSGLFEQLPRWVVYHELVLTSKEFMRQVIEIEEEWLIEVAPHYYKLKDLEDATNKKMPKKIGK  901 (902)
T ss_pred             eeecCcccccccCCceEEEeehhcChHHHHHHHHhhhhhHHHHhchhhhhhhhccccccccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999988765

>KOG0924|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1320
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-78
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 4e-25
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-78
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 4e-25
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 2e-70
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 3e-42
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-10
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  291 bits (745), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 153/341 (44%), Positives = 219/341 (64%), Gaps = 13/341 (3%)
Query: 796  VYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQXXXXXXXXXXXKCFRLYTAWAYKHE 855
            VYV+DPGF KQ  +N R  +ESL V PISKASA Q           KCFRLYT  A++ E
Sbjct: 389  VYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKE 448
Query: 856  LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG 915
            L + + PEI R NL + VL LK LGI+DL+HFDF+DPP  ET++ ALE+L  L  L+  G
Sbjct: 449  LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEG 508
Query: 916  DLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADT 975
            +LT LGR  ++FPLDPM+  ML+ S +++C +EI+TI +MLSV   +F RP      AD 
Sbjct: 509  NLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPN-VFIRPTKDKKRADD 567
Query: 976  ARKNFFMLGGDHLVLLNIYNQW-ADADFST---QWCYENFIQHRSMKRARDVREQLIGLV 1031
            A+  F    GDH+ LLN+Y+ + +D  +     +WC ++++ +RS+  A ++R QL  L+
Sbjct: 568  AKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLM 627
Query: 1032 QRVEMELVSNPTETV----NIRKAITAGYFYHIAKLSKSGS--YKTAKHNQTVMIHPNSS 1085
             R  +EL +   E+     NIRKA+ +G+F  +AK  +SG+  Y T K NQ V+IHP++ 
Sbjct: 628  NRYNLELNTTDYESPKYFDNIRKALASGFFMQVAK-KRSGAKGYITVKDNQDVLIHPSTV 686
Query: 1086 LFEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYY 1126
            L  +   WV+Y+E V T+K ++R VT +  +WL+E+AP YY
Sbjct: 687  LGHD-AEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYY 726
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1320
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 0.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-138
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-71
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 7e-67
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 1e-146
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 7e-84
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 6e-70
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-35
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 2e-62
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 8e-38
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-32
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-60
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-37
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-19
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-57
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 7e-31
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-18
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-57
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-35
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 5e-34
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 5e-57
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-29
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 4e-28
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-54
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-33
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-18
1yks_A440 Genome polyprotein [contains: flavivirin protease 4e-54
1yks_A440 Genome polyprotein [contains: flavivirin protease 1e-29
1yks_A440 Genome polyprotein [contains: flavivirin protease 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  589 bits (1521), Expect = 0.0
 Identities = 159/353 (45%), Positives = 223/353 (63%), Gaps = 11/353 (3%)

Query: 796  VYVIDPGFCKQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHE 855
            VYV+DPGF KQ  +N R  +ESL V PISKASA QRAGRAGR   GKCFRLYT  A++ E
Sbjct: 389  VYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKE 448

Query: 856  LEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHG 915
            L + + PEI R NL + VL LK LGI+DL+HFDF+DPP  ET++ ALE+L  L  L+  G
Sbjct: 449  LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEG 508

Query: 916  DLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKIIHADT 975
            +LT LGR  ++FPLDPM+  ML+ S +++C +EI+TI +MLSV   +F RP      AD 
Sbjct: 509  NLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSV-PNVFIRPTKDKKRADD 567

Query: 976  ARKNFFMLGGDHLVLLNIYNQWADADFST----QWCYENFIQHRSMKRARDVREQLIGLV 1031
            A+  F    GDH+ LLN+Y+ +   +       +WC ++++ +RS+  A ++R QL  L+
Sbjct: 568  AKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLM 627

Query: 1032 QRVEMELVS----NPTETVNIRKAITAGYFYHIAKLSKSG-SYKTAKHNQTVMIHPNSSL 1086
             R  +EL +    +P    NIRKA+ +G+F  +AK       Y T K NQ V+IHP++ L
Sbjct: 628  NRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVL 687

Query: 1087 FEELPRWVLYHELVFTTKEFMRQVTEIESKWLLEVAPHYYKPRELEDSTNKKM 1139
              +   WV+Y+E V T+K ++R VT +  +WL+E+AP YY     +    K  
Sbjct: 688  GHD-AEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYYDLSNFQKGDVKLS 739
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1320
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.97
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.97
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.97
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.96
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.96
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.93
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.92
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.92
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.91
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.91
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.91
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.91
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.91
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.9
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.9
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.9
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.9
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.89
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.89
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.89
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.89
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.88
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.88
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.88
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.88
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.88
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.88
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.87
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.87
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.87
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.87
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.86
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.86
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.85
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.85
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.85
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.84
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.83
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.83
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.82
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.82
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.82
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.81
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.79
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.78
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.78
4ddu_A1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.78
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.77
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.75
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.74
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.74
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.74
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.74
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.73
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.73
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.73
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.72
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.72
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.72
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.71
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.71
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.7
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.7
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.69
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.67
3h1t_A590 Type I site-specific restriction-modification syst 99.65
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.65
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.63
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.43
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.6
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.56
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.56
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.54
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.52
3jux_A822 Protein translocase subunit SECA; protein transloc 99.5
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.5
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.47
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.47
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.45
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.42
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.4
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.39
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.38
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.33
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.32
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.31
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.31
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.3
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.29
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.29
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.26
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.23
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.16
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.09
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.08
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.06
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.06
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.05
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.02
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.99
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.98
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.96
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.95
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.94
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.94
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.94
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.94
3bor_A237 Human initiation factor 4A-II; translation initiat 98.92
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.87
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.86
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.86
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.85
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.84
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.84
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.81
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.8
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 98.75
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.73
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.7
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.69
4gl2_A699 Interferon-induced helicase C domain-containing P; 98.66
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.64
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.62
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.61
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.57
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.55
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.55
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.51
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.48
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.46
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 98.45
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.44
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 98.39
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 98.36
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.08
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.06
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.01
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.96
3h1t_A590 Type I site-specific restriction-modification syst 97.93
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.92
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.92
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.91
3bor_A237 Human initiation factor 4A-II; translation initiat 97.9
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.89
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.87
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.86
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.82
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.74
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.72
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.69
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.64
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 97.4
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.24
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.13
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 97.11
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.1
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.07
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.99
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.88
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.81
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 96.75
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 96.71
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 96.5
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.3
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.25
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 96.05
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.9
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 95.78
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 95.68
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.61
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 95.56
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 95.49
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 95.47
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.45
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.42
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.36
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 95.16
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.1
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.99
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.91
3bos_A242 Putative DNA replication factor; P-loop containing 94.91
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.86
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.84
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.8
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.71
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.68
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.67
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.64
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.62
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.62
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.44
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.43
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.4
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.22
2qgz_A308 Helicase loader, putative primosome component; str 94.2
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 94.1
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.05
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 93.88
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.85
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.72
3pvs_A447 Replication-associated recombination protein A; ma 93.65
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 93.64
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.62
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 93.6
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 93.52
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.5
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.49
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.48
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.36
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.25
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.25
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.2
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.19
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.09
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.02
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.96
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.9
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 92.86
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 92.85
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 92.8
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.79
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 92.72
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.7
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 92.62
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 92.42
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 92.27
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 92.22
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 92.18
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 92.16
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.11
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.04
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 91.94
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.84
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 91.83
2r62_A268 Cell division protease FTSH homolog; ATPase domain 91.71
2r44_A331 Uncharacterized protein; putative ATPase, structur 91.6
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 91.54
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 91.5
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.49
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 91.45
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.37
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.3
2chq_A319 Replication factor C small subunit; DNA-binding pr 91.3
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 91.19
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 91.16
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 90.99
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 90.87
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.8
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 90.77
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.71
2oap_1511 GSPE-2, type II secretion system protein; hexameri 90.66
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 90.58
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 90.55
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 90.25
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 90.22
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.2
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.2
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 90.17
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.08
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 89.97
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 89.95
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 89.79
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 89.75
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.62
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 89.62
2gno_A305 DNA polymerase III, gamma subunit-related protein; 89.57
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 89.47
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.35
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 89.27
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 89.11
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.99
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.94
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 88.91
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 88.71
3vaa_A199 Shikimate kinase, SK; structural genomics, center 88.66
3jux_A 822 Protein translocase subunit SECA; protein transloc 88.58
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 88.57
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 88.56
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 88.48
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 88.48
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 88.38
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 88.3
3co5_A143 Putative two-component system transcriptional RES 88.29
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 88.27
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 88.2
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 88.19
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 88.15
2ewv_A372 Twitching motility protein PILT; pilus retraction 88.14
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.14
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.03
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.0
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 87.95
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 87.93
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 87.69
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 87.65
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 87.63
2xxa_A433 Signal recognition particle protein; protein trans 87.6
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.6
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 87.58
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 87.56
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 87.47
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 87.46
4a74_A231 DNA repair and recombination protein RADA; hydrola 87.44
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 87.43
1kag_A173 SKI, shikimate kinase I; transferase, structural g 87.42
2cvh_A220 DNA repair and recombination protein RADB; filamen 87.41
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 87.41
3b6e_A216 Interferon-induced helicase C domain-containing P; 87.17
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 87.13
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 87.12
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 86.99
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 86.78
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 86.77
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 86.72
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 86.72
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 86.71
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 86.7
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.68
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 86.67
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 86.67
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 86.54
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 86.52
3kta_A182 Chromosome segregation protein SMC; structural mai 86.42
1g6h_A257 High-affinity branched-chain amino acid transport 86.39
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 86.38
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 86.34
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.32
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 86.26
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 86.25
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 86.23
1sgw_A214 Putative ABC transporter; structural genomics, P p 86.23
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 86.23
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 86.2
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 86.19
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 86.15
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 86.14
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 86.02
2ghi_A260 Transport protein; multidrug resistance protein, M 86.02
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.87
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 85.8
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 85.78
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 85.77
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 85.71
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 85.68
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.65
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 85.64
3tlx_A243 Adenylate kinase 2; structural genomics, structura 85.64
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 85.62
1p9r_A418 General secretion pathway protein E; bacterial typ 85.61
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 85.6
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.6
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.59
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 85.53
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 85.41
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 85.4
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 85.36
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 85.32
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 85.31
2www_A349 Methylmalonic aciduria type A protein, mitochondri 85.29
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 85.18
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 85.14
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 85.05
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 84.98
2og2_A359 Putative signal recognition particle receptor; nuc 84.97
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 84.91
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 84.9
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 84.9
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 84.88
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 84.84
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 84.84
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 84.64
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 84.59
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 84.56
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 84.55
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 84.54
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 84.48
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 84.48
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 84.45
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 84.39
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 84.39
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 84.3
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 84.18
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 84.16
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.14
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 84.1
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 83.95
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 83.84
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 83.76
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 83.7
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 83.7
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 83.53
2vli_A183 Antibiotic resistance protein; transferase, tunica 83.49
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 83.49
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 83.42
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 83.37
1xjc_A169 MOBB protein homolog; structural genomics, midwest 83.28
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 83.12
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 83.03
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 82.99
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 82.99
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 82.9
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 82.81
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 82.62
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 82.6
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 82.6
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 82.54
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 82.5
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 82.41
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 82.37
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 82.37
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 82.34
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 82.29
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 82.28
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 82.19
2z43_A324 DNA repair and recombination protein RADA; archaea 82.17
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 82.07
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 81.92
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 81.87
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 81.75
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 81.7
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 81.48
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 81.45
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 81.39
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 81.33
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 81.25
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 81.17
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 81.14
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 81.12
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 81.0
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 80.96
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 80.87
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 80.78
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 80.74
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 80.61
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 80.57
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 80.57
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 80.49
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 80.47
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 80.42
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 80.37
1via_A175 Shikimate kinase; structural genomics, transferase 80.34
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 80.26
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 80.2
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 80.02
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=1.6e-83  Score=822.79  Aligned_cols=474  Identities=48%  Similarity=0.832  Sum_probs=444.2

Q ss_pred             hhhhHHHHhccCCChhhHHHHHHHHHhCCEEEEEcCCCCchhcHHHHHHHHccCCCC-CcEEEEecccHHHHHHHHHHHH
Q psy1907         658 KKLNIEETKKSLPIYPFKQDLIDAVRDHQVLIIEGETGSGKTTQIPQYLHEAGFTKD-KMKIGCTQPRRVAAMSVSARVA  736 (1320)
Q Consensus       658 ~~~~i~~~r~~LPi~~~~~~il~~i~~~~v~ii~geTGsGKTTqvPq~l~e~~~~~~-~~~I~~tQPRRvAA~svA~rva  736 (1320)
                      +..++.+.|..||++.++++|..++..+++++|+|+||||||||+|+++++.++..+ +.+|+|++|||.+|.++|++++
T Consensus        82 ~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~  161 (773)
T 2xau_A           82 KYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVA  161 (773)
T ss_dssp             HHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHH
T ss_pred             HHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHH
Confidence            455677788899999999999999999999999999999999999999998776543 5579999999999999999999


Q ss_pred             HHhCCCCCCeeeEEeecCccCCCCccEEEEccHHHHHHHhcCCCCCCccEEEEcccccc---------------------
Q psy1907         737 EEMGVKLGCEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEPDLASYSVMIIDEAHPK---------------------  795 (1320)
Q Consensus       737 ~e~~~~lG~~VGY~irfe~~~s~~T~i~y~TdG~Llrel~~dp~L~~ys~iIiDE~HER---------------------  795 (1320)
                      +++|..+|..|||++++++..+.++.|+|+|.|+|+|.++.++.|.++++|||||+|+|                     
T Consensus       162 ~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~~~  241 (773)
T 2xau_A          162 EEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDL  241 (773)
T ss_dssp             HHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCTTC
T ss_pred             HHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhCCCc
Confidence            99999999999999999999999999999999999999999999999999999999997                     


Q ss_pred             --------------------------------------------------------------------------------
Q psy1907         796 --------------------------------------------------------------------------------  795 (1320)
Q Consensus       796 --------------------------------------------------------------------------------  795 (1320)
                                                                                                      
T Consensus       242 ~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~  321 (773)
T 2xau_A          242 KIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVR  321 (773)
T ss_dssp             EEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHH
T ss_pred             eEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHH
Confidence                                                                                            


Q ss_pred             -------------------------------------------------------------------eEEEcCCccceee
Q psy1907         796 -------------------------------------------------------------------VYVIDPGFCKQNN  808 (1320)
Q Consensus       796 -------------------------------------------------------------------~~ViD~G~~k~~~  808 (1320)
                                                                                         .+|||+|+.|.+.
T Consensus       322 ~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~  401 (773)
T 2xau_A          322 KISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKV  401 (773)
T ss_dssp             HHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEE
T ss_pred             HHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCcccee
Confidence                                                                               5899999999999


Q ss_pred             ccCCCCcceeEEEEecHhhHHHHhcccCCccCCeEEEecchHHhhhhccCCCchhhhccChHHHHHHHHHcCCCCccccc
Q psy1907         809 FNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFD  888 (1320)
Q Consensus       809 y~~~~~~~~L~~~~iSkasa~QR~GRAGR~~pG~cyrLyt~~~~~~~l~~~~~PEI~R~~L~~~vL~lk~lgi~d~~~f~  888 (1320)
                      |||++|+++|.+.|+|++++.||+|||||..||+||+||++..|...|++++.|||+|++|.+++|+++++|++++..|+
T Consensus       402 yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~  481 (773)
T 2xau_A          402 YNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFD  481 (773)
T ss_dssp             EETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCCGGGCC
T ss_pred             eccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHHHcCCCChhhcc
Confidence            99999999999999999999999999999999999999999999777999999999999999999999999999999999


Q ss_pred             CCCCCChHHHHHHHHHHHHccccCCCCCccccccccccccCChhhHHHHHhhhhccchHHHHHHHhhcccCCccccCChh
Q psy1907         889 FLDPPPHETLVLALEQLYALGALNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKD  968 (1320)
Q Consensus       889 fldpP~~~~l~~Ale~L~~LgAld~~g~LT~lG~~ma~lPldP~laK~Ll~s~~~~c~~e~ltIaA~Lsv~~~~f~~p~~  968 (1320)
                      |+|||+.+++..|++.|+.+||||++|+||++|+.|+.||+||++||||+.|..++|++++++|+||||+++ +|++|.+
T Consensus       482 ~~~~p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~l~i~a~ls~~~-~f~~~~~  560 (773)
T 2xau_A          482 FMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPN-VFIRPTK  560 (773)
T ss_dssp             CSSCCCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHHHGGGGTCHHHHHHHHHHHTSCC-CBCCCTT
T ss_pred             ccCCCcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHHhhcccCchhHHHHHHHhcccCC-cccCChH
Confidence            999999999999999999999999999999999999999999999999999999999999999999999974 8999999


Q ss_pred             HHHHHHHHHhhhcccCCCHHHHHHHHHHHhhcc---cc-hhhHHhhccchhhHHHHHHHHHHHHHHHHhhhccccCCC--
Q psy1907         969 KIIHADTARKNFFMLGGDHLVLLNIYNQWADAD---FS-TQWCYENFIQHRSMKRARDVREQLIGLVQRVEMELVSNP-- 1042 (1320)
Q Consensus       969 ~~~~a~~~r~~f~~~~gDhltllnvy~~w~~~~---~~-~~wC~~n~l~~~~l~~a~~ir~QL~~~l~r~~~~~~s~~-- 1042 (1320)
                      +..+++.+++.|..++|||++++|+|++|...+   .+ .+||.+|||++++|+++.++|.||.++|.+.+++..+++  
T Consensus       561 ~~~~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~~~~~~~~~~~~~~~  640 (773)
T 2xau_A          561 DKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYE  640 (773)
T ss_dssp             CHHHHHHHHHTTCCTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCCCCCTT
T ss_pred             HHHHHHHHHHhccCCCCcHHHHHHHHHHHHHhccccchHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhcCCCcCCCCCC
Confidence            999999999999999999999999999997655   44 789999999999999999999999999999888765543  


Q ss_pred             --ccchHHHHHHHhccccchhhcccCCC-cccccCCceEEECCCCCCCccCCcccchhhhhcchHhHhhheeeeChhchH
Q psy1907        1043 --TETVNIRKAITAGYFYHIAKLSKSGS-YKTAKHNQTVMIHPNSSLFEELPRWVLYHELVFTTKEFMRQVTEIESKWLL 1119 (1320)
Q Consensus      1043 --~~~~~i~kal~aG~~~nvA~l~~~g~-y~t~~~~~~v~iHPsS~l~~~~p~~vvy~elv~Tsk~y~r~vt~I~~~wLl 1119 (1320)
                        .+...|++||++|||+|+|++.++|. |.++.+|+.|+|||+|+|. ..|+||||+|++.|++.|||.|++|+|+||.
T Consensus       641 ~~~~~~~i~~~l~~g~~~~~a~~~~~~~~y~~~~~~~~~~ihp~s~l~-~~~~~~v~~e~~~t~~~~~~~~~~i~~~~l~  719 (773)
T 2xau_A          641 SPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVLG-HDAEWVIYNEFVLTSKNYIRTVTSVRPEWLI  719 (773)
T ss_dssp             STTHHHHHHHHHHHHHTTSEEEECCC--CEEETTTCCEEEECTTCCCC-TTCSEEEEEEEEESSSEEEEEEEECCHHHHH
T ss_pred             chhhHHHHHHHHHHhChHhheeeccCCCcceEeeCCCEEEECCCcccC-CCCCEEEEEEeeccchhheeecccCCHHHHH
Confidence              23477999999999999999888776 9999999999999999994 4589999999999999999999999999999


Q ss_pred             hhcCCCcccccccc
Q psy1907        1120 EVAPHYYKPRELED 1133 (1320)
Q Consensus      1120 e~ap~~~~~k~~~~ 1133 (1320)
                      +++|+||...+++.
T Consensus       720 ~~~~~~~~~~~~~~  733 (773)
T 2xau_A          720 EIAPAYYDLSNFQK  733 (773)
T ss_dssp             HHCTTTSCGGGCCS
T ss_pred             HHHHHheeeccCCc
Confidence            99999998777653
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1320
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-51
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-22
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 9e-07
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 8e-22
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-18
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-10
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 6e-17
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 1e-09
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 5e-09
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 0.001
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 4e-04
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  182 bits (462), Expect = 1e-51
 Identities = 36/230 (15%), Positives = 63/230 (27%), Gaps = 37/230 (16%)

Query: 796  VYVIDPGFC-KQNNFNSRTGMESLTVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKH 854
              V+D     K    +    +     + IS +SA QR GR GR    +    Y    Y  
Sbjct: 101  ERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNP-NRDGDSYY---YSE 156

Query: 855  ELEDNTVPEIQR----INLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGA 910
               +N    +      + L N  +    +     +        P E  +   ++      
Sbjct: 157  PTSENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFREL 216

Query: 911  LNHHGDLTKLGRRMAEFPLDPMMGKMLLASEKYKCVEEIVTIASMLSVNGAIFYRPKDKI 970
            + +      L  ++A+  L     K                           F  P++  
Sbjct: 217  VRNCDLPVWLSWQVAKAGLKTNDRKWC-------------------------FEGPEEHE 251

Query: 971  IHADTARK-NFFMLGGDHLVLLNIYNQWADADFSTQWCYENFIQHRSMKR 1019
            I  D+         GG    L   +    +   S Q     FI+    +R
Sbjct: 252  ILNDSGETVKCRAPGGAKKPLRPRW--CDERVSSDQSALSEFIKFAEGRR 299
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1320
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.86
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.85
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.82
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.77
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.77
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.77
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.76
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.76
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.76
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.74
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.74
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.73
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.71
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.62
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.52
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.5
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.43
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.39
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.27
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.24
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.23
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.23
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.13
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.91
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.75
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.73
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.56
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.46
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.25
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.23
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.18
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.17
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.16
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.16
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.12
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.12
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.11
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.08
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.06
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.06
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.01
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.01
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.01
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.0
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.96
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 97.93
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.89
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.86
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.76
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.54
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.52
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.5
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.4
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.22
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 96.89
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.73
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.71
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.6
d1vmaa2213 GTPase domain of the signal recognition particle r 96.47
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.38
d2qy9a2211 GTPase domain of the signal recognition particle r 96.12
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.09
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 95.71
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.64
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.54
d1okkd2207 GTPase domain of the signal recognition particle r 95.33
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.31
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.26
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.16
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.95
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.86
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.82
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.78
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.66
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.59
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.49
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.47
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.35
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.16
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.04
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.01
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.67
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 93.64
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.64
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.57
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.51
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.41
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 93.27
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.11
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.09
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.02
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 92.83
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 92.7
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.53
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.2
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.18
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.07
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.02
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.02
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.89
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.8
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.56
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.56
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.56
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 91.51
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.45
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.15
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.96
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.96
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.71
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.64
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 90.59
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 90.53
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.53
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.53
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 90.5
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.32
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 90.22
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.06
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.64
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.5
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.46
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.38
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.33
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.26
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.2
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.02
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.94
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.89
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 88.81
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.8
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.78
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 88.68
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.64
d2hyda1255 Putative multidrug export ATP-binding/permease pro 88.55
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.52
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.35
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 88.31
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 88.28
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.22
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.19
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 88.15
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 88.1
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.92
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.77
d2awna2232 Maltose transport protein MalK, N-terminal domain 87.64
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.54
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.53
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 87.53
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.44
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.41
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 87.31
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 87.12
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.03
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.91
d1g2912240 Maltose transport protein MalK, N-terminal domain 86.85
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 86.74
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 86.52
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 86.35
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.99
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 85.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 85.77
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 85.59
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 85.45
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.26
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 85.02
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 84.7
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 84.58
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 84.37
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 84.28
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.24
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 84.21
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 84.02
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 83.78
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 83.69
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 83.55
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 83.26
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.16
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 83.12
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 83.12
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 82.58
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.51
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 82.12
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 81.97
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.93
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.77
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 81.57
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 81.03
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 80.99
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 80.9
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.81
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.66
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 80.55
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 80.55
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 80.33
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 80.3
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=99.86  E-value=4.9e-23  Score=231.64  Aligned_cols=188  Identities=15%  Similarity=-0.016  Sum_probs=143.0

Q ss_pred             CCCEEEEcCCHHHHHHHHHHHHHHHHhhcCCCCCeEEEEecCCCCHHHHHHHcCCCCCCCeEEEEeCcccccCCCCCCcc
Q psy1907         113 LGDILVFLTGQEEIETCNEILQDRVRRLGSKIKELIILPVYSNLPTDMQTKIFLPTPPNARKVVLATNIAETSLTIDNII  192 (1320)
Q Consensus       113 ~g~iLVFl~t~~eie~l~~~L~~~~~~l~~~~~~~~v~~LH~~l~~~~r~~i~~~~~~g~~kVlvATdIAe~gldIp~I~  192 (1320)
                      +|++||||||..+++.++..|.+.         +..|++|||.++.+++.+    +++|.++|||||||||+|||| +|+
T Consensus        36 ~g~~~~F~~s~~~~~~~a~~L~~~---------g~~V~~l~~~~~~~e~~~----~~~~~~~~~~~t~~~~~~~~~-~~~  101 (299)
T d1yksa2          36 KRPTAWFLPSIRAANVMAASLRKA---------GKSVVVLNRKTFEREYPT----IKQKKPDFILATDIAEMGANL-CVE  101 (299)
T ss_dssp             CSCEEEECSCHHHHHHHHHHHHHT---------TCCEEECCSSSCC------------CCCSEEEESSSTTCCTTC-CCS
T ss_pred             CCCEEEEeCCHHHHHHHHHHHHhc---------CCeEEEEcCcCcHhHHhh----hhcCCcCEEEEechhhhceec-Cce
Confidence            699999999999999999999873         567999999999888764    567899999999999999999 599


Q ss_pred             EEEcCCC-CccccccCCCCccccceeccCHhhHHHHhhhcCCCCCCCCceEEEEecCHHHHhhcccccCCccccCCcchh
Q psy1907         193 YVIDPGF-CKQNNFNSRTGMESLTVVPISKASANQRAGVITGFNPLSDFRGCAHVLGEEVLRGCAHVLGEEVLRPEVSQP  271 (1320)
Q Consensus       193 ~VID~g~-~k~~~yd~~~g~~~l~~~piSk~s~~QR~GRAGR~g~g~~fg~~~~L~~~~~~~~l~~~~~pei~~~~l~~~  271 (1320)
                      +|||+|+ .+...||+.+++..+...|+|++++.||+||+||.+.+ +  .||.+|+.....    ...+.+...++   
T Consensus       102 ~vid~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~qr~gr~gr~~~~-~--~~~~~y~~~~~~----d~~~~~~~te~---  171 (299)
T d1yksa2         102 RVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNR-D--GDSYYYSEPTSE----NNAHHVCWLEA---  171 (299)
T ss_dssp             EEEECCEEEEEEEETTTTEEEEEEEEECCHHHHHHHHTTSSCCTTC-C--CEEEEECSCCCC----CCTTBHHHHHH---
T ss_pred             EEEecCceeceeeecCCCCeeEEeeeecCHHHHHHhcccccccCCC-c--eEEEEeCCCCCC----cccchhhhhhH---
Confidence            9999999 47888999999999999999999999999999998665 3  245555532111    01111111111   


Q ss_pred             hhhhccccccccccccccccccceecccccccccchhhhhhcCCChhhhhhhcccccccccc-ccccccC
Q psy1907         272 FRSFGYLGVMQDCRYIGTYLVGFIWHWKNHYIQDQTLVTFMLTHLPTTYIKRKSSEYKVGNG-EDSFCVS  340 (1320)
Q Consensus       272 ~L~~~~l~~~~~~~~~~~~~~~~il~~~~l~~~d~~~f~~~~~p~~~~~~~~~~~L~~lG~~-~~~~~v~  340 (1320)
                                      +..+.++.+.++.++..+++.|+|+.+|++...+.+++.++.||++ ++++|++
T Consensus       172 ----------------~i~l~~i~l~~~~~g~~~~~e~~~~~~p~g~~~L~~~~~l~~l~aL~~~d~p~~  225 (299)
T d1yksa2         172 ----------------SMLLDNMEVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDLPVW  225 (299)
T ss_dssp             ----------------HHHHTTSCCGGGCCCCCSTTHHHHSSSCTTTTCCCHHHHHHHHHHHHTTCCCHH
T ss_pred             ----------------HHHhhCcccccccccccchhhhccccCCCchhhhhHhHHHHHHHHHhhcCCCcc
Confidence                            0113344566778899999999999999999888899999999876 5566644
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure