Psyllid ID: psy1969

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------

MSLDLEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLSNVIGFPSTNVPLGLGSNGLPVGLQAGQQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQVCETASVAQSVTSFGVSTHSRLIPSTPQYLDNIDSPRRSTAVDYVWTQVKGFINIKLMFVVKITSHLVDYWSPALHKVMAGPNQDRLCLAVAKKLEDIFYGWTMPNSTGMLVEYRD

cHHHHHHHccccEEEcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccHHHHHHcccccccEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccEEEEEEEEEEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccEEEEcc

cccEHHHcccccEEEEcccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHccccccEcccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEHHHHHcHHEHEEHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccEEEEcc

msldleilgtdgvliyptfpaqaqrhgeiLLTTSGVYYAMLSNvigfpstnvplglgsnglpvglQAGQQLASYITdgeeilgtdgvliyptfpaqaqrhgeiLLTTSGVYYAMLANVigfpstnvplglgsnglpvglqVCETASVAQSVTsfgvsthsrlipstpqyldnidsprrstaVDYVWTQVKGFINIKLMFVVKITSHLVdywspalhkvmagpnqDRLCLAVAKKLEDIfygwtmpnstgmlveyrd

MSLDLEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLSNVIGFPSTNVPLGLGSNGLPVGLQAGQQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQVCETASVAQSVTSfgvsthsrlipstpqyldnidsprRSTAVDYVWTQVKGFINIKLMFVVKITSHLVDYWSPALHKVMAGPNQDRLCLAVAKKLEDifygwtmpnstgmlveyrd

****LEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLSNVIGFPSTNVPLGLGSNGLPVGLQAGQQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQVCETASVAQSVTSFGVSTHSRLIPSTPQYLDNIDSPRRSTAVDYVWTQVKGFINIKLMFVVKITSHLVDYWSPALHKVMAGPNQDRLCLAVAKKLEDIFYGWTMPNSTGML*****

*SLDLEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLSNVIGFPSTNVPLGLGSNGLPVGLQAGQQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQVCETASVAQSVTSFGVSTHSRLIPSTPQYLDNIDSPRRSTAVDYVWTQVKGFINIKLMFVVKITSHLVDYWSPALHKVMAGPNQDRLCLAVAKKLEDIFYGWTMPNSTGMLVEYR*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		256	2.2.26 [Sep-21-2011]
Q6DH69		532	Fatty-acid amide hydrolas	yes	N/A	0.285	0.137	0.452	2e-11
Q05AM4		526	Fatty-acid amide hydrolas	no	N/A	0.285	0.138	0.397	2e-08
Q6GMR7		532	Fatty-acid amide hydrolas	yes	N/A	0.242	0.116	0.403	3e-06
Q7XJJ7		607	Fatty acid amide hydrolas	yes	N/A	0.199	0.084	0.415	6e-05
Q1GUW3		493	Glutamyl-tRNA(Gln) amidot	yes	N/A	0.332	0.172	0.314	0.0006
Q8DK65		482	Glutamyl-tRNA(Gln) amidot	yes	N/A	0.269	0.143	0.4	0.0006
Q2G4F5		494	Glutamyl-tRNA(Gln) amidot	yes	N/A	0.292	0.151	0.354	0.0006
B8D125		477	Glutamyl-tRNA(Gln) amidot	yes	N/A	0.253	0.136	0.367	0.0008
A6W7L7		516	Glutamyl-tRNA(Gln) amidot	yes	N/A	0.332	0.164	0.355	0.0008

>sp\|Q6DH69\|FAH2A_DANRE Fatty-acid amide hydrolase 2-A OS=Danio rerio GN=faah2a PE=2 SV=1	Back alignment and function desciption

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%)

Query: 69  QQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPL 128
           QQ  S   + EE+LGTDGVL+YP+ P  AQ+H   + T     Y  + N++G P T  PL
Sbjct: 426 QQKESLQQELEELLGTDGVLLYPSHPLIAQKHHHPIFTPFNFSYTGIFNILGLPVTQCPL 485

Query: 129 GLGSNGLPVGLQV 141
           GL + GLP+G+Q+
Sbjct: 486 GLSAEGLPLGVQI 498

Danio rerio (taxid: 7955)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 9EC: 9

>sp\|Q05AM4\|FAH2B_DANRE Fatty-acid amide hydrolase 2-B OS=Danio rerio GN=faah2b PE=2 SV=1	Back alignment and function description

>sp\|Q6GMR7\|FAAH2_HUMAN Fatty-acid amide hydrolase 2 OS=Homo sapiens GN=FAAH2 PE=2 SV=1	Back alignment and function description

>sp\|Q7XJJ7\|FAAH_ARATH Fatty acid amide hydrolase OS=Arabidopsis thaliana GN=FAAH PE=1 SV=1	Back alignment and function description

>sp\|Q1GUW3\|GATA_SPHAL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gatA PE=3 SV=1	Back alignment and function description

>sp\|Q8DK65\|GATA_THEEB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermosynechococcus elongatus (strain BP-1) GN=gatA PE=3 SV=2	Back alignment and function description

>sp\|Q2G4F5\|GATA_NOVAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Novosphingobium aromaticivorans (strain DSM 12444) GN=gatA PE=3 SV=1	Back alignment and function description

>sp\|B8D125\|GATA_HALOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gatA PE=3 SV=1	Back alignment and function description

>sp\|A6W7L7\|GATA_KINRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=gatA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		256
347967739		519	AGAP002377-PA [Anopheles gambiae str. PE	0.296	0.146	0.486	7e-11
158287258		537	AGAP011315-PA [Anopheles gambiae str. PE	0.347	0.165	0.428	1e-10
91076824		515	PREDICTED: similar to amidase isoform 1	0.304	0.151	0.462	1e-10
270012569		490	hypothetical protein TcasGA2_TC006725 [T	0.246	0.128	0.507	1e-10
157124584		519	amidase [Aedes aegypti] gi\|108873923\|gb\|	0.289	0.142	0.480	2e-10
91089461		524	PREDICTED: similar to amidase [Tribolium	0.246	0.120	0.507	2e-10
157104752		519	amidase [Aedes aegypti] gi\|108869136\|gb\|	0.289	0.142	0.480	2e-10
260782504		658	hypothetical protein BRAFLDRAFT_132230 [	0.285	0.110	0.479	2e-10
260782364		505	hypothetical protein BRAFLDRAFT_254371 [	0.285	0.144	0.479	5e-10
347967737		519	AGAP013161-PA [Anopheles gambiae str. PE	0.285	0.140	0.460	6e-10

>gi\|347967739\|ref\|XP_563817.3\| AGAP002377-PA [Anopheles gambiae str. PEST] gi\|333468322\|gb\|EAL40937.3\| AGAP002377-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 46/76 (60%)

Query: 66  QAGQQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTN 125
           Q  QQ A+      + LGTDGV  +PT+P  A RH E      GV Y ML N +G P+T+
Sbjct: 416 QYQQQAAALRKQMIDTLGTDGVFFFPTYPTAALRHYESFGHIMGVGYTMLFNALGLPATH 475

Query: 126 VPLGLGSNGLPVGLQV 141
           VPLG   NGLP+G+QV
Sbjct: 476 VPLGFDRNGLPIGIQV 491

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|158287258\|ref\|XP_309335.4\| AGAP011315-PA [Anopheles gambiae str. PEST] gi\|157019565\|gb\|EAA05257.5\| AGAP011315-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|91076824\|ref\|XP_967870.1\| PREDICTED: similar to amidase isoform 1 [Tribolium castaneum] gi\|270001790\|gb\|EEZ98237.1\| hypothetical protein TcasGA2_TC000676 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|270012569\|gb\|EFA09017.1\| hypothetical protein TcasGA2_TC006725 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|157124584\|ref\|XP_001654117.1\| amidase [Aedes aegypti] gi\|108873923\|gb\|EAT38148.1\| AAEL009925-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|91089461\|ref\|XP_968383.1\| PREDICTED: similar to amidase [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|157104752\|ref\|XP_001648552.1\| amidase [Aedes aegypti] gi\|108869136\|gb\|EAT33361.1\| AAEL014361-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|260782504\|ref\|XP_002586326.1\| hypothetical protein BRAFLDRAFT_132230 [Branchiostoma floridae] gi\|229271429\|gb\|EEN42337.1\| hypothetical protein BRAFLDRAFT_132230 [Branchiostoma floridae]	Back alignment and taxonomy information

>gi\|260782364\|ref\|XP_002586258.1\| hypothetical protein BRAFLDRAFT_254371 [Branchiostoma floridae] gi\|229271357\|gb\|EEN42269.1\| hypothetical protein BRAFLDRAFT_254371 [Branchiostoma floridae]	Back alignment and taxonomy information

>gi\|347967737\|ref\|XP_003436103.1\| AGAP013161-PA [Anopheles gambiae str. PEST] gi\|333468323\|gb\|EGK96910.1\| AGAP013161-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		256
FB\|FBgn0033717		529	CG8839 [Drosophila melanogaste	0.246	0.119	0.5	7.9e-15
FB\|FBgn0037547		530	CG7910 [Drosophila melanogaste	0.273	0.132	0.410	9.6e-13
FB\|FBgn0039341		523	CG5112 [Drosophila melanogaste	0.246	0.120	0.412	2.7e-11
ZFIN\|ZDB-GENE-040718-453		532	faah2a "fatty acid amide hydro	0.285	0.137	0.452	1.6e-10
WB\|WBGene00013164		535	Y53F4B.18 [Caenorhabditis eleg	0.246	0.117	0.460	2.8e-10
FB\|FBgn0038803		552	CG5191 [Drosophila melanogaste	0.339	0.157	0.387	2e-07
UNIPROTKB\|Q6GMR7		532	FAAH2 "Fatty-acid amide hydrol	0.242	0.116	0.403	6.3e-10
FB\|FBgn0037548		536	CG7900 [Drosophila melanogaste	0.261	0.125	0.462	4e-09
ZFIN\|ZDB-GENE-061027-358		526	faah2b "fatty acid amide hydro	0.246	0.119	0.444	1.1e-07
TAIR\|locus:2179371		607	FAAH "AT5G64440" [Arabidopsis	0.199	0.084	0.415	0.00038

FB\|FBgn0033717 CG8839 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 160 (61.4 bits), Expect = 7.9e-15, Sum P(2) = 7.9e-15
 Identities = 32/64 (50%), Positives = 42/64 (65%)

Query:    79 EEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLG-LGSNGLPV 137
             + +LG +GVLIYPT P  A  H E +       Y  + NV+GFP+T VPLG LGS GLP+
Sbjct:   435 QSLLGDNGVLIYPTHPTVAPYHNEPITRPINFAYTGIVNVLGFPATAVPLGKLGSEGLPL 494

Query:   138 GLQV 141
             G+Q+
Sbjct:   495 GVQI 498

GO:0017064 "fatty acid amide hydrolase activity" evidence=ISS

GO:0016884 "carbon-nitrogen ligase activity, with glutamine as amido-N-donor" evidence=IEA

GO:0005811 "lipid particle" evidence=IDA

FB\|FBgn0037547 CG7910 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0039341 CG5112 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040718-453 faah2a "fatty acid amide hydrolase 2a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00013164 Y53F4B.18 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

FB\|FBgn0038803 CG5191 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6GMR7 FAAH2 "Fatty-acid amide hydrolase 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

FB\|FBgn0037548 CG7900 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061027-358 faah2b "fatty acid amide hydrolase 2b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

TAIR\|locus:2179371 FAAH "AT5G64440" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		256
pfam01425		431	pfam01425, Amidase, Amidase	5e-09
pfam01425		431	pfam01425, Amidase, Amidase	4e-08
COG0154		475	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransf	5e-07
COG0154		475	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransf	2e-06
PRK06170		490	PRK06170, PRK06170, amidase; Provisional	7e-05
TIGR00132		460	TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) a	1e-04
PRK06170		490	PRK06170, PRK06170, amidase; Provisional	2e-04
PRK06061		483	PRK06061, PRK06061, amidase; Provisional	5e-04
PRK06061		483	PRK06061, PRK06061, amidase; Provisional	6e-04
PRK00012		459	PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransf	6e-04
TIGR00132		460	TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) a	0.002
PRK00012		459	PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransf	0.003

>gnl\|CDD\|216494 pfam01425, Amidase, Amidase	Back alignment and domain information

 Score = 55.8 bits (135), Expect = 5e-09
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 87  VLIYPTFPAQAQRHGEILLTTSGVYYAM-------LANVIGFPSTNVPLGLGSNGLPVGL 139
           VL+ PT P  A R GE   + + +Y  +        AN+ G P+ ++P G   +GLPVGL
Sbjct: 359 VLLSPTTPTPAPRLGEAADSPTVLYNLLDFTANTVPANLAGLPAISLPAGFSEDGLPVGL 418

Query: 140 QV 141
           Q+
Sbjct: 419 QI 420

Length = 431

>gnl\|CDD\|216494 pfam01425, Amidase, Amidase	Back alignment and domain information

>gnl\|CDD\|223232 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|223232 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|235723 PRK06170, PRK06170, amidase; Provisional	Back alignment and domain information

>gnl\|CDD\|232842 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit	Back alignment and domain information

>gnl\|CDD\|235723 PRK06170, PRK06170, amidase; Provisional	Back alignment and domain information

>gnl\|CDD\|235686 PRK06061, PRK06061, amidase; Provisional	Back alignment and domain information

>gnl\|CDD\|235686 PRK06061, PRK06061, amidase; Provisional	Back alignment and domain information

>gnl\|CDD\|234572 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed	Back alignment and domain information

>gnl\|CDD\|232842 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit	Back alignment and domain information

>gnl\|CDD\|234572 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		256
KOG1212\|consensus		560		99.75
PRK06170		490	amidase; Provisional	99.73
COG0154		475	GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A su	99.69
PRK06169		466	putative amidase; Provisional	99.68
PRK06102		452	hypothetical protein; Provisional	99.68
PRK07042		464	amidase; Provisional	99.68
PRK06061		483	amidase; Provisional	99.67
PRK12470		462	amidase; Provisional	99.66
PRK06529		482	amidase; Provisional	99.65
PRK07486		484	amidase; Provisional	99.64
PRK07056		454	amidase; Provisional	99.64
PRK09201		465	amidase; Provisional	99.64
TIGR02715		452	amido_AtzE amidohydrolase, AtzE family. Members of	99.63
PRK07488		472	indole acetimide hydrolase; Validated	99.63
PRK07235		502	amidase; Provisional	99.63
TIGR00132		460	gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)	99.62
PRK08310		395	amidase; Provisional	99.61
PRK05962		424	amidase; Validated	99.61
PRK07869		468	amidase; Provisional	99.61
PRK07487		469	amidase; Provisional	99.59
PLN02722		422	indole-3-acetamide amidohydrolase	99.58
PRK00012		459	gatA aspartyl/glutamyl-tRNA amidotransferase subun	99.58
PRK07139		439	amidase; Provisional	99.58
PRK08137		497	amidase; Provisional	99.57
TIGR02713		561	allophanate_hyd allophanate hydrolase. Allophanate	99.56
PRK08186		600	allophanate hydrolase; Provisional	99.56
PF01425		441	Amidase: Amidase; InterPro: IPR000120 Amidase sign	99.4
PRK06828		491	amidase; Provisional	99.3
PRK06707		536	amidase; Provisional	99.25
PRK11910		615	amidase; Provisional	99.13
PRK06565		566	amidase; Validated	99.02
KOG1211\|consensus		506		98.65
PRK06529		482	amidase; Provisional	98.11
PRK12470		462	amidase; Provisional	98.09
COG0154		475	GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A su	98.07
PRK07042		464	amidase; Provisional	98.07
PRK06061		483	amidase; Provisional	98.03
PRK07235		502	amidase; Provisional	98.03
PRK06170		490	amidase; Provisional	98.02
PRK07869		468	amidase; Provisional	98.01
PRK06169		466	putative amidase; Provisional	98.01
PRK00012		459	gatA aspartyl/glutamyl-tRNA amidotransferase subun	98.0
PRK09201		465	amidase; Provisional	97.98
TIGR02715		452	amido_AtzE amidohydrolase, AtzE family. Members of	97.97
TIGR00132		460	gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)	97.96
PRK07139		439	amidase; Provisional	97.91
PRK07488		472	indole acetimide hydrolase; Validated	97.91
PLN02722		422	indole-3-acetamide amidohydrolase	97.9
PRK07487		469	amidase; Provisional	97.89
PRK07486		484	amidase; Provisional	97.87
PRK06102		452	hypothetical protein; Provisional	97.87
PRK08310		395	amidase; Provisional	97.79
PRK07056		454	amidase; Provisional	97.71
PRK05962		424	amidase; Validated	97.66
PRK08137		497	amidase; Provisional	97.63
TIGR02713		561	allophanate_hyd allophanate hydrolase. Allophanate	97.56
PRK08186		600	allophanate hydrolase; Provisional	97.48
KOG1212\|consensus		560		97.47
PF01425		441	Amidase: Amidase; InterPro: IPR000120 Amidase sign	97.31
PRK06828		491	amidase; Provisional	95.93
PRK06707		536	amidase; Provisional	92.29
KOG1211\|consensus		506		91.76
PRK11910		615	amidase; Provisional	86.08

>KOG1212\|consensus	Back alignment and domain information

Probab=99.75  E-value=3.3e-18  Score=165.85  Aligned_cols=126  Identities=36%  Similarity=0.516  Sum_probs=92.9

Q ss_pred             hHHHHHHHHHHHh--ccCCceeccCCCCCCcccccccccccccccchhhhhhCCceEEecCCCCCCCCceEEEEeecccc
Q psy1969          70 QLASYITDGEEIL--GTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQVCETASV  147 (256)
Q Consensus        70 ~r~~l~~~~~~~~--~~~D~Il~Pt~p~~Ap~~~~~~~~~~~~~yT~~~NllG~PAisVP~G~~~~glPvGlQi~~~~~~  147 (256)
                      +++.++.++...|  .+.||||||+.+.+|++|+.+.....++.||.+||++|+||++||++.+......   +      
T Consensus       431 ~~e~yrlk~~~~~~~~~~dVll~Ps~~~pA~~h~~P~~~~~~~~Yt~LfN~Ld~Pag~vpvt~v~~~d~~---~------  501 (560)
T KOG1212|consen  431 DIESYRLKFILYWLLGKDDVLICPSFPTPAPPHNYPLLLVNGFSYTGLFNVLDFPAGVVPVTTVTQKDEK---E------  501 (560)
T ss_pred             HHHHHHHHHHHHHHcCCCCEEEeCCCCCCCCcCCCchhhccchhHHHHHHhccCCcccccccccchhhhc---c------
Confidence            3444555554444  5799999999999999999876666778999999999999999999976432211   1      


Q ss_pred             ccccccccccccccCCCCCCcccCCCCCCCccccccchhhhhcchhhhhhhhhhhhccC-CcccCCCeeeEeecCCCchH
Q psy1969         148 AQSVTSFGVSTHSRLIPSTPQYLDNIDSPRRSTAVDYVWTQVKGFINIKLMFVVKITSH-LVDYWSPALHKVMAGPNQDR  226 (256)
Q Consensus       148 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~Pv~~Qvvg~~~~de  226 (256)
                                         ..|      + .+  |.+.+.               ...+ .+..|+|+||||||.+|+||
T Consensus       502 -------------------~~~------~-~~--D~~~~~---------------~~~g~~~s~GlPigVQVVa~p~~de  538 (560)
T KOG1212|consen  502 -------------------EEY------P-MN--DKWATK---------------VPKGSLDSRGLPIGVQVVANPNQDE  538 (560)
T ss_pred             -------------------ccc------c-cc--cHHHHh---------------CcccccCCCCCceeEEEecCCCchH
Confidence                               001      0 11  112111               1123 34458999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCCC
Q psy1969         227 LCLAVAKKLEDIFYGWTMPNS  247 (256)
Q Consensus       227 ~~L~~a~~ie~~~~~~~~~~~  247 (256)
                      .||++|++||+.++||..|..
T Consensus       539 lcL~va~~lE~~~gg~~~p~~  559 (560)
T KOG1212|consen  539 LCLAVARELERKFGGWVRPGP  559 (560)
T ss_pred             HHHHHHHHHHHHhCCccCCCC
Confidence            999999999999999998864

>PRK06170 amidase; Provisional	Back alignment and domain information

>COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK06169 putative amidase; Provisional	Back alignment and domain information

>PRK06102 hypothetical protein; Provisional	Back alignment and domain information

>PRK07042 amidase; Provisional	Back alignment and domain information

>PRK06061 amidase; Provisional	Back alignment and domain information

>PRK12470 amidase; Provisional	Back alignment and domain information

>PRK06529 amidase; Provisional	Back alignment and domain information

>PRK07486 amidase; Provisional	Back alignment and domain information

>PRK07056 amidase; Provisional	Back alignment and domain information

>PRK09201 amidase; Provisional	Back alignment and domain information

>TIGR02715 amido_AtzE amidohydrolase, AtzE family	Back alignment and domain information

>PRK07488 indole acetimide hydrolase; Validated	Back alignment and domain information

>PRK07235 amidase; Provisional	Back alignment and domain information

>TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit	Back alignment and domain information

>PRK08310 amidase; Provisional	Back alignment and domain information

>PRK05962 amidase; Validated	Back alignment and domain information

>PRK07869 amidase; Provisional	Back alignment and domain information

>PRK07487 amidase; Provisional	Back alignment and domain information

>PLN02722 indole-3-acetamide amidohydrolase	Back alignment and domain information

>PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed	Back alignment and domain information

>PRK07139 amidase; Provisional	Back alignment and domain information

>PRK08137 amidase; Provisional	Back alignment and domain information

>TIGR02713 allophanate_hyd allophanate hydrolase	Back alignment and domain information

>PRK08186 allophanate hydrolase; Provisional	Back alignment and domain information

>PF01425 Amidase: Amidase; InterPro: IPR000120 Amidase signature (AS) enzymes are a large group of hydrolytic enzymes that contain a conserved stretch of approximately 130 amino acids known as the AS sequence	Back alignment and domain information

>PRK06828 amidase; Provisional	Back alignment and domain information

>PRK06707 amidase; Provisional	Back alignment and domain information

>PRK11910 amidase; Provisional	Back alignment and domain information

>PRK06565 amidase; Validated	Back alignment and domain information

>KOG1211\|consensus	Back alignment and domain information

>PRK06529 amidase; Provisional	Back alignment and domain information

>PRK12470 amidase; Provisional	Back alignment and domain information

>COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07042 amidase; Provisional	Back alignment and domain information

>PRK06061 amidase; Provisional	Back alignment and domain information

>PRK07235 amidase; Provisional	Back alignment and domain information

>PRK06170 amidase; Provisional	Back alignment and domain information

>PRK07869 amidase; Provisional	Back alignment and domain information

>PRK06169 putative amidase; Provisional	Back alignment and domain information

>PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed	Back alignment and domain information

>PRK09201 amidase; Provisional	Back alignment and domain information

>TIGR02715 amido_AtzE amidohydrolase, AtzE family	Back alignment and domain information

>TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit	Back alignment and domain information

>PRK07139 amidase; Provisional	Back alignment and domain information

>PRK07488 indole acetimide hydrolase; Validated	Back alignment and domain information

>PLN02722 indole-3-acetamide amidohydrolase	Back alignment and domain information

>PRK07487 amidase; Provisional	Back alignment and domain information

>PRK07486 amidase; Provisional	Back alignment and domain information

>PRK06102 hypothetical protein; Provisional	Back alignment and domain information

>PRK08310 amidase; Provisional	Back alignment and domain information

>PRK07056 amidase; Provisional	Back alignment and domain information

>PRK05962 amidase; Validated	Back alignment and domain information

>PRK08137 amidase; Provisional	Back alignment and domain information

>TIGR02713 allophanate_hyd allophanate hydrolase	Back alignment and domain information

>PRK08186 allophanate hydrolase; Provisional	Back alignment and domain information

>KOG1212\|consensus	Back alignment and domain information

>PF01425 Amidase: Amidase; InterPro: IPR000120 Amidase signature (AS) enzymes are a large group of hydrolytic enzymes that contain a conserved stretch of approximately 130 amino acids known as the AS sequence	Back alignment and domain information

>PRK06828 amidase; Provisional	Back alignment and domain information

>PRK06707 amidase; Provisional	Back alignment and domain information

>KOG1211\|consensus	Back alignment and domain information

>PRK11910 amidase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		256
1m22_A		503	Peptide amidase, PAM; eleven-stranded beta sheet,	1e-05
1m22_A		503	Peptide amidase, PAM; eleven-stranded beta sheet,	4e-05
3ppm_A		573	Fatty-acid amide hydrolase 1; protein-inhibitor co	1e-05
3ppm_A		573	Fatty-acid amide hydrolase 1; protein-inhibitor co	1e-04
3a2q_A		493	6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet	1e-05
3a2q_A		493	6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet	7e-05
2dc0_A		434	Probable amidase; structural genomics, NPPSFA, nat	1e-04
2dc0_A		434	Probable amidase; structural genomics, NPPSFA, nat	4e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
3a1k_A		521	Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo	2e-04
3a1k_A		521	Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo	6e-04
1o9p_A		414	Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja	3e-04

>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503	Back alignment and structure

 Score = 45.3 bits (108), Expect = 1e-05
 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 3/54 (5%)

Query: 87  VLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQ 140
            L+ PT         E        Y    A V G+PS  VP+G   +GLPVGL 
Sbjct: 412 ALVAPTTGVAWPIRSEGDDFPGESY--SAAAVAGYPSLTVPMGQ-IDGLPVGLL 462

PyMOL of 1m22

>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503	Back alignment and structure

>3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Length = 573	Back alignment and structure

>3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Length = 573	Back alignment and structure

>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493	Back alignment and structure

>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493	Back alignment and structure

>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434	Back alignment and structure

>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521	Back alignment and structure

>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521	Back alignment and structure

>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Length = 414	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		256
3ppm_A		573	Fatty-acid amide hydrolase 1; protein-inhibitor co	99.78
1o9p_A		414	Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja	99.69
3a2q_A		493	6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet	99.68
3kfu_E		471	Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP	99.68
2dc0_A		434	Probable amidase; structural genomics, NPPSFA, nat	99.65
3a1k_A		521	Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo	99.65
3h0l_A		478	Glutamyl-tRNA(Gln) amidotransferase subunit A; mul	99.64
3ip4_A		485	Glutamyl-tRNA(Gln) amidotransferase subunit A; mul	99.63
2gi3_A		476	Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1	99.63
1m22_A		503	Peptide amidase, PAM; eleven-stranded beta sheet,	99.61
3kfu_E		471	Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP	98.05
3h0l_A		478	Glutamyl-tRNA(Gln) amidotransferase subunit A; mul	98.0
1o9p_A		414	Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja	97.99
3a2q_A		493	6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet	97.97
3ip4_A		485	Glutamyl-tRNA(Gln) amidotransferase subunit A; mul	97.96
2dc0_A		434	Probable amidase; structural genomics, NPPSFA, nat	97.92
2gi3_A		476	Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1	97.9
3a1k_A		521	Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo	97.89
1m22_A		503	Peptide amidase, PAM; eleven-stranded beta sheet,	97.2
3ppm_A		573	Fatty-acid amide hydrolase 1; protein-inhibitor co	96.8

>3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A*	Back alignment and structure

Probab=99.78  E-value=2e-19  Score=175.97  Aligned_cols=130  Identities=19%  Similarity=0.183  Sum_probs=90.0

Q ss_pred             hhhhhHHHHHHHHHHHhc--cCCceeccCCCCCCcccccccccccccccchhhhhhCCceEEecCCCCCCCCceEEEEee
Q psy1969          66 QAGQQLASYITDGEEILG--TDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNVPLGLGSNGLPVGLQVCE  143 (256)
Q Consensus        66 Qla~~r~~l~~~~~~~~~--~~D~Il~Pt~p~~Ap~~~~~~~~~~~~~yT~~~NllG~PAisVP~G~~~~glPvGlQi~~  143 (256)
                      +...++++++++|.+.|.  ++|+||||+ +.+|++|+.......+..||.+||++|||+++||+|+++.....   .  
T Consensus       440 ~~~~~r~~~r~~~~~~w~~~~lDaLL~Pt-~~pA~~h~~~~~~~~~~~YT~l~NLLDyPA~vVPvg~v~~~~d~---~--  513 (573)
T 3ppm_A          440 KLQHEIEMYRQSVIAQWKAMNLDVLLTPM-LGPALDLNTPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDDA---Q--  513 (573)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCSEEEEEC-CCSCCBTTCGGGCGGGGHHHHHHHHTTCCEEEEEEEECCHHHHH---H--
T ss_pred             HHHHHHHHHHHHHHHHHhhcCCCEeeCCC-CCCCcCCccccccccccchhhhhHhhCCCeEEEecccccccccc---c--
Confidence            334567788999999996  499999999 56899988643333457899999999999999999875321000   0  


Q ss_pred             ccccccccccccccccccCCCCCCcccCCCCCCCccccccchhhhhcchhhhhhhhhhhhccCCccc-CCCeeeEeecCC
Q psy1969         144 TASVAQSVTSFGVSTHSRLIPSTPQYLDNIDSPRRSTAVDYVWTQVKGFINIKLMFVVKITSHLVDY-WSPALHKVMAGP  222 (256)
Q Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~Pv~~Qvvg~~  222 (256)
                                            ...|..       ...+.+.+..|             ..  ++.+ |+||||||||+|
T Consensus       514 ----------------------~~~~~~-------~~~~~~d~~~~-------------~~--~~~~~GlPVgVQiVGrr  549 (573)
T 3ppm_A          514 ----------------------MELYKG-------YFGDIWDIILK-------------KA--MKNSVGLPVAVQCVALP  549 (573)
T ss_dssp             ----------------------HTTCCC-------SSCSHHHHHHH-------------HH--TCSCTTCEEEEEEECCT
T ss_pred             ----------------------cccccc-------ccchhhhhhhh-------------hh--hhccCCCceEEEEeCCC
Confidence                                  001100       00001111111             11  3334 899999999999


Q ss_pred             CchHHHHHHHHHHHHHhcCCCCC
Q psy1969         223 NQDRLCLAVAKKLEDIFYGWTMP  245 (256)
Q Consensus       223 ~~de~~L~~a~~ie~~~~~~~~~  245 (256)
                      |+||+||++|++||+++++++.|
T Consensus       550 ~~EEklL~~a~~IE~~l~~~~~~  572 (573)
T 3ppm_A          550 WQEELCLRFMREVEQLMTPQKQP  572 (573)
T ss_dssp             TCHHHHHHHHHHHHHHHCTTSCC
T ss_pred             CcHHHHHHHHHHHHHHHhcccCC
Confidence            99999999999999999987655

PyMOL of 3ppm

>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A	Back alignment and structure

>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A	Back alignment and structure

>3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus}	Back alignment and structure

>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus}	Back alignment and structure

>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A	Back alignment and structure

>3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A*	Back alignment and structure

>3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} SCOP: c.117.1.1 PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A	Back alignment and structure

>2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A*	Back alignment and structure

>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A*	Back alignment and structure

>3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus}	Back alignment and structure

>3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A*	Back alignment and structure

>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A	Back alignment and structure

>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A	Back alignment and structure

>3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} SCOP: c.117.1.1 PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A	Back alignment and structure

>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus}	Back alignment and structure

>2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A*	Back alignment and structure

>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A	Back alignment and structure

>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A*	Back alignment and structure

>3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		256
d2gi3a1		475	c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransf	1e-08
d2gi3a1		475	c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransf	7e-08
d1ocka_		412	c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium jap	1e-08
d1ocka_		412	c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium jap	9e-08
d2f2aa1		485	c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransf	2e-08
d2f2aa1		485	c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransf	1e-07
d1m22a_		490	c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomon	4e-07
d1m22a_		490	c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomon	2e-06
d1mt5a_		537	c.117.1.1 (A:) Fatty acid amide hydrolase (oleamid	3e-06
d1mt5a_		537	c.117.1.1 (A:) Fatty acid amide hydrolase (oleamid	3e-05

>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Amidase signature (AS) enzymes
superfamily: Amidase signature (AS) enzymes
family: Amidase signature (AS) enzymes
domain: Glutamyl-tRNA(Gln) amidotransferase subunit A
species: Thermotoga maritima [TaxId: 2336]

 Score = 52.9 bits (126), Expect = 1e-08
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 79  EEILGTDGVLIYPTFPAQAQRHGEI---LLTTSGVYYAMLANVIGFPSTNVPLGLGSNGL 135
            E+L     ++ PT P  A + GEI   L       + + AN+ G P+ +VP G  SN L
Sbjct: 375 NEVLSQYDAILTPTSPVTAFKIGEIKDPLTYYLMDIFTIPANLAGLPAISVPFGF-SNNL 433

Query: 136 PVGLQV 141
           PVG+QV
Sbjct: 434 PVGVQV 439

PyMOL of d2gi3a1

>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475	Back information, alignment and structure

>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412	Back information, alignment and structure

>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412	Back information, alignment and structure

>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485	Back information, alignment and structure

>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485	Back information, alignment and structure

>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490	Back information, alignment and structure

>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490	Back information, alignment and structure

>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537	Back information, alignment and structure

>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		256
d1ocka_		412	Malonamidase E2 {Bradyrhizobium japonicum [TaxId:	99.71
d1mt5a_		537	Fatty acid amide hydrolase (oleamide hydrolase) {R	99.66
d2gi3a1		475	Glutamyl-tRNA(Gln) amidotransferase subunit A {The	99.62
d2f2aa1		485	Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta	99.61
d1m22a_		490	Peptide amidase Pam {Stenotrophomonas maltophilia	99.59
d1ocka_		412	Malonamidase E2 {Bradyrhizobium japonicum [TaxId:	98.12
d2gi3a1		475	Glutamyl-tRNA(Gln) amidotransferase subunit A {The	98.0
d2f2aa1		485	Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta	97.93
d1mt5a_		537	Fatty acid amide hydrolase (oleamide hydrolase) {R	97.72
d1m22a_		490	Peptide amidase Pam {Stenotrophomonas maltophilia	97.61

>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Amidase signature (AS) enzymes
superfamily: Amidase signature (AS) enzymes
family: Amidase signature (AS) enzymes
domain: Malonamidase E2
species: Bradyrhizobium japonicum [TaxId: 375]

Probab=99.71  E-value=4e-18  Score=156.26  Aligned_cols=113  Identities=27%  Similarity=0.279  Sum_probs=91.0

Q ss_pred             CeeeeeccccCCCCchhhhhh-hhHHHHHHHHHHHhccCCceeccCCCCCCcccccccccccccccchhhhhhCCceEEe
Q psy1969          48 PSTNVPLGLGSNGLPVGLQAG-QQLASYITDGEEILGTDGVLIYPTFPAQAQRHGEILLTTSGVYYAMLANVIGFPSTNV  126 (256)
Q Consensus        48 PaV~~pl~~g~~~lp~gyQla-~~r~~l~~~~~~~~~~~D~Il~Pt~p~~Ap~~~~~~~~~~~~~yT~~~NllG~PAisV  126 (256)
                      |.+...+..+.......|..+ ..|..+++++.++|+++|+||+|++|.+||+++..  ......||.+||++|+|++||
T Consensus       298 ~~~~~~~~~~~~~~~~~~~~a~~~r~~~~~~~~~~f~~~D~ll~Pt~p~~ap~~~~~--~~~~~~~t~~~nl~G~Paisv  375 (412)
T d1ocka_         298 PMLRASLDATVGLTPKEYDEARRIGRRGRRELGEVFEGVDVLLTYSAPGTAPAKALA--STGDPRYNRLWTLMGNPCVNV  375 (412)
T ss_dssp             HHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHTTTCSEEEEESSSSSCCBGGGC--CCCCCTTTHHHHHHCCCEEEE
T ss_pred             hhhhhhhhhhhccccccchhhhhhHHHHHHHHHHHHcCCCEEEeCCCCCCCcccccc--ccCChHHhHHHHHHCCCeEEE
Confidence            344444445555566667666 45777899999999999999999999999987642  223456899999999999999


Q ss_pred             cCCCCCCCCceEEEEeeccccccccccccccccccCCCCCCcccCCCCCCCccccccchhhhhcchhhhhhhhhhhhccC
Q psy1969         127 PLGLGSNGLPVGLQVCETASVAQSVTSFGVSTHSRLIPSTPQYLDNIDSPRRSTAVDYVWTQVKGFINIKLMFVVKITSH  206 (256)
Q Consensus       127 P~G~~~~glPvGlQi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  206 (256)
                      |+|. .+|||+|+||                                                                 
T Consensus       376 P~g~-~~GlPvGlQi-----------------------------------------------------------------  389 (412)
T d1ocka_         376 PVLK-VGGLPIGVQV-----------------------------------------------------------------  389 (412)
T ss_dssp             EEEE-ETTEEEEEEE-----------------------------------------------------------------
T ss_pred             eccC-CCCceEeEEE-----------------------------------------------------------------
Confidence            9975 5677777777                                                                 


Q ss_pred             CcccCCCeeeEeecCCCchHHHHHHHHHHHHHhc
Q psy1969         207 LVDYWSPALHKVMAGPNQDRLCLAVAKKLEDIFY  240 (256)
Q Consensus       207 ~~~~~~Pv~~Qvvg~~~~de~~L~~a~~ie~~~~  240 (256)
                                  ||++++|++||++|+.+|++++
T Consensus       390 ------------ig~~~~D~~lL~~A~~~E~alg  411 (412)
T d1ocka_         390 ------------IARFGNDAHALATAWFLEDALA  411 (412)
T ss_dssp             ------------EECTTCHHHHHHHHHHHHHHHT
T ss_pred             ------------ECCCCCHHHHHHHHHHHHHHhC
Confidence                        9999999999999999999985

PyMOL of d1ocka_

>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]}	Back information, alignment and structure

>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]}	Back information, alignment and structure