Psyllid ID: psy1973


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSYLMEEECQPVAV
cEEEEEEccccEEEEEEcccccHHHHHHHHHHHHccccccEEEEEcccccccccccccccccccccEEEEEEEEccccccccccccccEEEcccHHHHHHHHccccccccccEEEEEEEccccHHHHHHHHHHHHHccccccEEEEEccEEcccccccccccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccc
cEEEEEEccccEEEEEEcccccHHHHHHHHHHHccccccHcEEEEccccccccccHccccccccccEEEEEEEcccccccccccccccccEccccccccccEEEEEEccccEEEEEEEEcccccHHHHHHHHHHcccccccccEEEEccccccccccHccccccccccEEEEEEEccccccEEEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccc
MKISVKVLQGQEIFLDVNSEMSILELKNKINEAlkipvsdqkllatgrplldtkqildypqikegtkLNLVVKRALKessqsvaggsnvtiLRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEAlkipvsdqkllatgrplldtkqildypqikegtkLNLVVKRALKessqsvaggsnvtiLRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSYlmeeecqpvav
mkisvkvlqgqeifldvNSEMSILELKNKINEALKIPVSDQkllatgrplldtkqildypqikegtklNLVVKRALkessqsvaggsnvtilrDASYKFLRKYFTetqsnkiadefIKVNSEMSILELKNKINEALKIPVSDQkllatgrplldtkqildypqikegtklNLVVKRALkessqsvaggsnvtilrDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSylmeeecqpvav
MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSIstlslddlealassYLMEEECQPVAV
*****KVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRAL******VAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRAL******VAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALA**************
MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRAL*************TILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVV***********************SYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSYLMEE*******
MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRAL*********GSNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRAL*********GSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSYLME********
MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKES*****G*SNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSYLMEEECQPV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALASSYLMEEECQPVAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
B2KIK3160 Ubiquitin-like protein 4A N/A N/A 0.507 0.8 0.323 7e-13
Q7ZWB2157 Ubiquitin-like protein 4A yes N/A 0.496 0.796 0.357 3e-12
A4QND0148 Ubiquitin-like protein 4A yes N/A 0.476 0.810 0.365 4e-12
P21126157 Ubiquitin-like protein 4A yes N/A 0.464 0.745 0.344 4e-11
B2GV38157 Ubiquitin-like protein 4A yes N/A 0.464 0.745 0.344 5e-11
Q0D261148 Ubiquitin-like protein 4A N/A N/A 0.480 0.817 0.338 5e-11
B1MTV8157 Ubiquitin-like protein 4A N/A N/A 0.464 0.745 0.344 6e-11
B7NZQ9157 Ubiquitin-like protein 4A yes N/A 0.507 0.815 0.315 1e-10
P11441157 Ubiquitin-like protein 4A yes N/A 0.460 0.738 0.349 2e-10
C1BGZ8154 Ubiquitin-like protein 4A N/A N/A 0.476 0.779 0.323 3e-10
>sp|B2KIK3|UBL4A_RHIFE Ubiquitin-like protein 4A OS=Rhinolophus ferrumequinum GN=UBL4A PE=3 SV=1 Back     alignment and function desciption
 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 117 IKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVK- 175
           ++V+ +  +  LK+ ++E L +PV  Q+LL  G+ L D K++ DY  I   +KLNLVVK 
Sbjct: 15  LQVSEDELVSTLKHVVSEKLNVPVRQQRLLFKGKALADGKRLSDY-SIGPNSKLNLVVKP 73

Query: 176 --RALKESSQSVAGGSNVTILRDASY----KFLRKYFTETQSNKIADEFIKEFNKSISTL 229
             + L E S +    +   + R  ++    K L ++F+   ++++ D+  +++ +S+S L
Sbjct: 74  LEKVLLEESAAACRLTEAPLPRPPAWQLIAKVLARHFSAADASRVLDQLQRDYERSLSRL 133

Query: 230 SLDDLEALASSYLMEE 245
           +LDD+E LAS +L  E
Sbjct: 134 TLDDIERLASRFLHPE 149




Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
Rhinolophus ferrumequinum (taxid: 59479)
>sp|Q7ZWB2|UBL4A_DANRE Ubiquitin-like protein 4A OS=Danio rerio GN=ubl4a PE=2 SV=1 Back     alignment and function description
>sp|A4QND0|UBL4A_XENTR Ubiquitin-like protein 4A OS=Xenopus tropicalis GN=ubl4a PE=2 SV=1 Back     alignment and function description
>sp|P21126|UBL4A_MOUSE Ubiquitin-like protein 4A OS=Mus musculus GN=Ubl4a PE=2 SV=1 Back     alignment and function description
>sp|B2GV38|UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus GN=Ubl4a PE=2 SV=1 Back     alignment and function description
>sp|Q0D261|UBL4A_XENLA Ubiquitin-like protein 4A OS=Xenopus laevis GN=ubl4a PE=2 SV=1 Back     alignment and function description
>sp|B1MTV8|UBL4A_CALMO Ubiquitin-like protein 4A OS=Callicebus moloch GN=UBL4A PE=3 SV=1 Back     alignment and function description
>sp|B7NZQ9|UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus GN=UBL4A PE=3 SV=1 Back     alignment and function description
>sp|P11441|UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens GN=UBL4A PE=1 SV=1 Back     alignment and function description
>sp|C1BGZ8|UB4AA_ONCMY Ubiquitin-like protein 4A-A OS=Oncorhynchus mykiss GN=ubl4aa PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
242247242139 ubiquitin-like protein 4A-like [Acyrthos 0.476 0.863 0.453 1e-23
195055426125 GH17339 [Drosophila grimshawi] gi|193892 0.404 0.816 0.461 4e-19
195389823125 GJ23969 [Drosophila virilis] gi|19415165 0.404 0.816 0.444 3e-18
340729633150 PREDICTED: ubiquitin-like protein 4A-lik 0.496 0.833 0.411 2e-17
383859237150 PREDICTED: ubiquitin-like protein 4A-lik 0.488 0.82 0.412 1e-16
332372640129 unknown [Dendroctonus ponderosae] 0.448 0.875 0.433 2e-16
195107359125 GI23879 [Drosophila mojavensis] gi|19391 0.452 0.912 0.418 2e-16
66514137150 PREDICTED: ubiquitin-like protein 4A-lik 0.496 0.833 0.404 2e-16
195444789127 GK11832 [Drosophila willistoni] gi|19416 0.404 0.803 0.444 3e-16
195569997130 GD20202 [Drosophila simulans] gi|1941989 0.452 0.876 0.403 7e-16
>gi|242247242|ref|NP_001156073.1| ubiquitin-like protein 4A-like [Acyrthosiphon pisum] gi|239791366|dbj|BAH72158.1| ACYPI001055 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 87/130 (66%), Gaps = 10/130 (7%)

Query: 119 VNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKRAL 178
           V SEM+I ELKN + EALK+PV DQ+LL TGRPL D K ++DYPQIK+GT+LNL+VK  +
Sbjct: 17  VQSEMTIAELKNHVFEALKVPVKDQRLLLTGRPLCDEKTLVDYPQIKDGTRLNLIVKPQI 76

Query: 179 KESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKEFNKSISTLSLDDLEALA 238
            ++ +          L +   K +R++++   + K+  EF+KEF++S++  SLDD E +A
Sbjct: 77  IKTDE----------LEEMITKHVREHYSTEDTVKVLKEFMKEFDRSLTQFSLDDYERMA 126

Query: 239 SSYLMEEECQ 248
            S L  +E Q
Sbjct: 127 ESLLTNDEQQ 136




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195055426|ref|XP_001994620.1| GH17339 [Drosophila grimshawi] gi|193892383|gb|EDV91249.1| GH17339 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195389823|ref|XP_002053573.1| GJ23969 [Drosophila virilis] gi|194151659|gb|EDW67093.1| GJ23969 [Drosophila virilis] Back     alignment and taxonomy information
>gi|340729633|ref|XP_003403102.1| PREDICTED: ubiquitin-like protein 4A-like isoform 1 [Bombus terrestris] gi|350411306|ref|XP_003489305.1| PREDICTED: ubiquitin-like protein 4A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383859237|ref|XP_003705102.1| PREDICTED: ubiquitin-like protein 4A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332372640|gb|AEE61462.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|195107359|ref|XP_001998281.1| GI23879 [Drosophila mojavensis] gi|193914875|gb|EDW13742.1| GI23879 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|66514137|ref|XP_624109.1| PREDICTED: ubiquitin-like protein 4A-like isoform 2 [Apis mellifera] gi|380020628|ref|XP_003694184.1| PREDICTED: ubiquitin-like protein 4A-like [Apis florea] gi|380020630|ref|XP_003694185.1| PREDICTED: ubiquitin-like protein 4A-like [Apis florea] Back     alignment and taxonomy information
>gi|195444789|ref|XP_002070030.1| GK11832 [Drosophila willistoni] gi|194166115|gb|EDW81016.1| GK11832 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195569997|ref|XP_002102995.1| GD20202 [Drosophila simulans] gi|194198922|gb|EDX12498.1| GD20202 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
UNIPROTKB|A4QND0148 ubl4a "Ubiquitin-like protein 0.579 0.986 0.326 1.5e-12
UNIPROTKB|B2KIK3160 UBL4A "Ubiquitin-like protein 0.5 0.787 0.318 3.9e-12
UNIPROTKB|Q0D261148 ubl4a "Ubiquitin-like protein 0.468 0.797 0.32 1.7e-11
ZFIN|ZDB-GENE-040426-1089157 zgc:56596 "zgc:56596" [Danio r 0.488 0.783 0.345 7.4e-11
MGI|MGI:95049157 Ubl4 "ubiquitin-like 4" [Mus m 0.452 0.726 0.327 7.4e-11
RGD|1563983157 Ubl4a "ubiquitin-like 4A" [Rat 0.452 0.726 0.327 7.4e-11
UNIPROTKB|P11441157 UBL4A "Ubiquitin-like protein 0.496 0.796 0.323 7.4e-11
TAIR|locus:505006295154 UBQ7 "AT2G35635" [Arabidopsis 0.285 0.467 0.397 8.6e-11
UNIPROTKB|B1MTV8157 UBL4A "Ubiquitin-like protein 0.452 0.726 0.336 9.6e-11
UNIPROTKB|B5X9S9151 ubl4ab "Ubiquitin-like protein 0.496 0.827 0.312 1.3e-10
UNIPROTKB|A4QND0 ubl4a "Ubiquitin-like protein 4A" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
 Score = 167 (63.8 bits), Expect = 1.5e-12, P = 1.5e-12
 Identities = 51/156 (32%), Positives = 86/156 (55%)

Query:     1 MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYP 60
             M+++VK L+G+E  + V+   ++L +K  + E LK+PVS Q+LL  G+ L D   +  Y 
Sbjct:     1 MQLTVKALKGKEANIQVSEGDTVLAVKRLVEEKLKVPVSQQRLLFRGKALADEHCLAHY- 59

Query:    61 QIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVN 120
              I  G++LNL+VK  +     S  GG+  T  +  S   LRK+F+ T + ++  E+++ +
Sbjct:    60 SIGPGSRLNLMVKEQVAPEGHS--GGN--TAWKSLSV-ILRKHFSPTDAERVL-EYVQKD 113

Query:   121 SE--MSILELKNKINEALKIPVSDQKLLATGRPLLD 154
              E  +S+L L +    A +I +  Q   AT    LD
Sbjct:   114 YERSLSLLSLDDIERLATRI-LHPQYSEATDLGFLD 148


GO:0005829 "cytosol" evidence=ISS
GO:0071816 "tail-anchored membrane protein insertion into ER membrane" evidence=ISS
GO:0071818 "BAT3 complex" evidence=ISS
UNIPROTKB|B2KIK3 UBL4A "Ubiquitin-like protein 4A" [Rhinolophus ferrumequinum (taxid:59479)] Back     alignment and assigned GO terms
UNIPROTKB|Q0D261 ubl4a "Ubiquitin-like protein 4A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1089 zgc:56596 "zgc:56596" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:95049 Ubl4 "ubiquitin-like 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563983 Ubl4a "ubiquitin-like 4A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P11441 UBL4A "Ubiquitin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:505006295 UBQ7 "AT2G35635" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B1MTV8 UBL4A "Ubiquitin-like protein 4A" [Callicebus moloch (taxid:9523)] Back     alignment and assigned GO terms
UNIPROTKB|B5X9S9 ubl4ab "Ubiquitin-like protein 4A-B" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
smart0021372 smart00213, UBQ, Ubiquitin homologues 5e-12
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 4e-11
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 8e-11
cd0180774 cd01807, GDX_N, ubiquitin-like domain of GDX 7e-09
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 9e-08
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 9e-08
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 2e-07
smart0021372 smart00213, UBQ, Ubiquitin homologues 3e-07
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 5e-07
cd0180376 cd01803, Ubiquitin, Ubiquitin 2e-06
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 6e-06
cd0180577 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 7e-06
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 2e-05
cd0180774 cd01807, GDX_N, ubiquitin-like domain of GDX 9e-05
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 1e-04
pfam1197672 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- 3e-04
cd0179280 cd01792, ISG15_repeat1, ISG15 ubiquitin-like prote 0.004
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
 Score = 59.6 bits (145), Expect = 5e-12
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 1  MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYP 60
          ++++VK L G+ I L+V    ++ ELK KI E   IP   Q+L+  G+ L D  + L   
Sbjct: 1  IELTVKTLDGKTITLEVKPSDTVSELKEKIAELTGIPPEQQRLIYKGKVLEDD-RTLADY 59

Query: 61 QIKEGTKLNLVVK 73
           I++G+ ++LV++
Sbjct: 60 GIQDGSTIHLVLR 72


Ubiquitin-mediated proteolysis is involved in the regulated turnover of proteins required for controlling cell cycle progression. Length = 72

>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|176402 cd01807, GDX_N, ubiquitin-like domain of GDX Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|176402 cd01807, GDX_N, ubiquitin-like domain of GDX Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information
>gnl|CDD|176387 cd01792, ISG15_repeat1, ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.79
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.75
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.74
PTZ0004476 ubiquitin; Provisional 99.74
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.73
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.73
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.72
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.72
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.7
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.7
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.7
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.7
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.7
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.7
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.69
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.68
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.68
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.66
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.66
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.65
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.65
KOG0005|consensus70 99.63
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.62
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.62
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.61
PTZ0004476 ubiquitin; Provisional 99.61
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.61
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.6
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.59
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.58
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.58
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.56
KOG0003|consensus128 99.56
KOG0003|consensus128 99.56
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.56
KOG0005|consensus70 99.55
KOG0004|consensus156 99.54
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.54
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.54
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.53
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.53
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.53
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.53
KOG0004|consensus156 99.53
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.52
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.51
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.5
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.49
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 99.49
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.47
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.47
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.45
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.43
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 99.4
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.38
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.37
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.35
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.32
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.32
KOG0011|consensus340 99.29
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.27
KOG0010|consensus 493 99.27
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.27
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.26
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.23
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.23
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.22
KOG0011|consensus 340 99.15
KOG0010|consensus 493 99.1
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.09
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.08
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.98
KOG0001|consensus75 98.87
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.86
PLN02560308 enoyl-CoA reductase 98.84
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.8
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.8
KOG0001|consensus75 98.7
KOG4248|consensus 1143 98.68
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.67
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 98.66
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.63
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.6
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.49
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.45
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.42
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.41
KOG4248|consensus 1143 98.35
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 98.28
PLN02560 308 enoyl-CoA reductase 98.26
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.23
KOG0006|consensus 446 98.21
KOG1872|consensus 473 98.15
KOG3493|consensus73 98.05
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.02
KOG1769|consensus99 97.97
KOG0006|consensus 446 97.82
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 97.8
KOG4495|consensus110 97.73
KOG4495|consensus110 97.44
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 97.4
KOG3493|consensus73 97.37
KOG1872|consensus 473 97.29
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.28
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 97.05
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 97.02
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 96.99
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 96.96
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 96.89
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.77
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.75
PF13019162 Telomere_Sde2: Telomere stability and silencing 96.68
KOG0013|consensus231 96.64
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 96.42
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 96.37
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 96.2
KOG0013|consensus231 96.08
KOG1639|consensus297 96.06
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 95.97
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 95.96
KOG1769|consensus99 95.85
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 95.84
COG541781 Uncharacterized small protein [Function unknown] 95.63
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 95.46
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 95.27
KOG3206|consensus234 95.19
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 94.09
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 94.06
PRK0643767 hypothetical protein; Provisional 93.43
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 93.12
PF14533213 USP7_C2: Ubiquitin-specific protease C-terminal; P 93.0
KOG3206|consensus234 92.73
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 91.97
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 91.91
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 91.75
PF1106998 DUF2870: Protein of unknown function (DUF2870); In 91.23
PF1445357 ThiS-like: ThiS-like ubiquitin 91.05
smart0016680 UBX Domain present in ubiquitin-regulatory protein 90.8
PRK0565966 sulfur carrier protein ThiS; Validated 89.5
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 89.49
PRK0836470 sulfur carrier protein ThiS; Provisional 89.33
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 88.97
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 88.95
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 88.91
smart0045570 RBD Raf-like Ras-binding domain. 88.9
PF12436249 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-sp 88.49
PF13019162 Telomere_Sde2: Telomere stability and silencing 88.42
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 88.3
COG541781 Uncharacterized small protein [Function unknown] 88.24
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 88.1
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 87.74
KOG0012|consensus 380 87.34
PRK0648865 sulfur carrier protein ThiS; Validated 87.05
KOG4583|consensus 391 86.89
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 86.31
PLN0279982 Molybdopterin synthase sulfur carrier subunit 86.28
KOG4583|consensus 391 85.93
KOG1639|consensus 297 85.74
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 85.4
PF12754309 Blt1: Cell-cycle control medial ring component; In 85.29
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 85.03
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 84.74
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 84.48
KOG4250|consensus 732 84.4
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 84.11
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 83.99
PRK0694465 sulfur carrier protein ThiS; Provisional 83.38
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 82.27
cd0599281 PB1 The PB1 domain is a modular domain mediating s 82.02
KOG2982|consensus418 81.65
PRK0805366 sulfur carrier protein ThiS; Provisional 80.45
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 80.37
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
Probab=99.79  E-value=6.3e-19  Score=124.26  Aligned_cols=73  Identities=42%  Similarity=0.643  Sum_probs=71.3

Q ss_pred             CEEEEEeCCCcEEEEEecCCCCHHHHHHHHHHHhCCCCCCeEEEEcCeecCCCccccccCCCCCCCEEEEEEec
Q psy1973           1 MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVKR   74 (252)
Q Consensus         1 M~i~Vk~~~g~~~~~~v~~~~TV~~lK~~I~~~~gi~~~~q~L~~~G~~L~d~~tL~~~~~i~~~s~i~l~~~~   74 (252)
                      |+|+||+.+|+++.++|++++||.+||++|++++|+|+++|+|+|+|+.|+|+.+|++| ||+++++|+|++++
T Consensus         1 m~i~vk~~~G~~~~l~v~~~~tV~~lK~~i~~~~gi~~~~q~L~~~G~~L~d~~~L~~~-~i~~~~~l~l~~~~   73 (74)
T cd01807           1 MFLTVKLLQGRECSLQVSEKESVSTLKKLVSEHLNVPEEQQRLLFKGKALADDKRLSDY-SIGPNAKLNLVVRP   73 (74)
T ss_pred             CEEEEEeCCCCEEEEEECCCCcHHHHHHHHHHHHCCCHHHeEEEECCEECCCCCCHHHC-CCCCCCEEEEEEcC
Confidence            89999999999999999999999999999999999999999999999999999999999 99999999999874



GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain. The function of GDX is unknown.

>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>KOG1639|consensus Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PF14533 USP7_C2: Ubiquitin-specific protease C-terminal; PDB: 2YLM_A Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PF11069 DUF2870: Protein of unknown function (DUF2870); InterPro: IPR021298 This is a eukaryotic family of proteins with unknown function Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG0012|consensus Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>KOG4583|consensus Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>KOG4583|consensus Back     alignment and domain information
>KOG1639|consensus Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
2dzi_A81 2dziSOLUTION STRUCTURE OF THE N-Terminal Ubiquitin- 3e-08
2dzi_A81 2dziSOLUTION STRUCTURE OF THE N-Terminal Ubiquitin- 7e-04
3b08_A152 Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl 4e-07
2zvn_A154 Nemo Cozi Domain Incomplex With Diubiquitin In P212 4e-07
3u30_A172 Crystal Structure Of A Linear-Specific Ubiquitin Fa 4e-07
2y5b_B152 Structure Of Usp21 In Complex With Linear Diubiquit 1e-06
2w9n_A152 Crystal Structure Of Linear Di-Ubiquitin Length = 1 2e-06
3u5g_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 5e-05
4a18_K129 T.Thermophila 60s Ribosomal Subunit In Complex With 5e-05
3m63_B101 Crystal Structure Of Ufd2 In Complex With The Ubiqu 6e-05
2bwe_S77 The Crystal Structure Of The Complex Between The Ub 7e-05
3u5e_m128 The Structure Of The Eukaryotic Ribosome At 3.0 A R 7e-05
3u5c_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 9e-05
1zw7_A82 Elimination Of The C-Cap In Ubiquitin Structure, Dy 9e-05
3olm_D79 Structure And Function Of A Ubiquitin Binding Site 9e-05
4hcn_B98 Crystal Structure Of Burkholderia Pseudomallei Effe 1e-04
1otr_B76 Solution Structure Of A Cue-Ubiquitin Complex Lengt 1e-04
4ii3_B96 Crystal Structure Of S. Pombe Ubiquitin Activating 1e-04
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 1e-04
1bt0_A76 Structure Of Ubiquitin-Like Protein, Rub1 Length = 2e-04
1zgu_B76 Solution Structure Of The Human Mms2-Ubiquitin Comp 2e-04
4gsw_A80 Crystal Structure Of Ubiquitin From Entamoeba Histo 3e-04
3dbh_I88 Structural Dissection Of A Gating Mechanism Prevent 3e-04
2o6v_D76 Crystal Structure And Solution Nmr Studies Of Lys48 3e-04
4ii2_B83 Crystal Structure Of Ubiquitin Activating Enzyme 1 4e-04
2jwz_A76 Mutations In The Hydrophobic Core Of Ubiquitin Diff 4e-04
3ai5_A307 Crystal Structure Of Yeast Enhanced Green Fluoresce 4e-04
3dbl_I88 Structural Dissection Of A Gating Mechanism Prevent 5e-04
3zf7_s128 High-resolution Cryo-electron Microscopy Structure 5e-04
2jvc_A82 Nmr Solution Structure Of Ubiquitin Like Protein Le 5e-04
3k9o_B96 The Crystal Structure Of E2-25k And Ubb+1 Complex L 5e-04
1yx5_B98 Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le 6e-04
3dvg_X80 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 6e-04
2khw_B79 Solution Structure Of The Human Polymerase Iota Ubm 6e-04
4hcp_B78 Crystal Structure Of Burkholderia Pseudomallei Effe 6e-04
3nob_A78 Structure Of K11-Linked Di-Ubiquitin Length = 78 6e-04
3jvz_X81 E2~ubiquitin-Hect Length = 81 6e-04
2k6d_B76 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 7e-04
2bkr_B77 Nedd8 Nedp1 Complex Length = 77 7e-04
2nvu_I81 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 7e-04
3rul_A79 New Strategy To Analyze Structures Of Glycopeptide- 7e-04
2znv_C77 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 7e-04
1xd3_B75 Crystal Structure Of Uchl3-Ubvme Complex Length = 7 7e-04
1cmx_B76 Structural Basis For The Specificity Of Ubiquitin C 7e-04
1aar_A76 Structure Of A Diubiquitin Conjugate And A Model Fo 7e-04
3h7s_B76 Crystal Structures Of K63-Linked Di- And Tri-Ubiqui 7e-04
4f8c_B88 Structure Of The Cif:nedd8 Complex - Yersinia Pseud 8e-04
4ap4_C80 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 8e-04
2ld9_A77 Backbone Structure Of Ubiquitin Determined Using Ba 8e-04
3ons_A72 Crystal Structure Of Human Ubiquitin In A New Cryst 8e-04
2xk5_B76 Crystal Structure Of K6-Linked Diubiquitin Length = 8e-04
1ndd_B76 Structure Of Nedd8 Length = 76 8e-04
3gzn_I82 Structure Of Nedd8-Activating Enzyme In Complex Wit 8e-04
2ojr_A111 Structure Of Ubiquitin Solved By Sad Using The Lant 8e-04
>pdb|2DZI|A Chain A, 2dziSOLUTION STRUCTURE OF THE N-Terminal Ubiquitin-Like Domain In Human Ubiquitin-Like Protein 4a (Gdx) Length = 81 Back     alignment and structure

Iteration: 1

Score = 55.1 bits (131), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Query: 1 MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYP 60 M+++VK LQG+E L V + + LK ++E L +PV Q+LL G+ L D K++ DY Sbjct: 8 MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDY- 66 Query: 61 QIKEGTKLNLVVK 73 I +KLNLVVK Sbjct: 67 SIGPNSKLNLVVK 79
>pdb|2DZI|A Chain A, 2dziSOLUTION STRUCTURE OF THE N-Terminal Ubiquitin-Like Domain In Human Ubiquitin-Like Protein 4a (Gdx) Length = 81 Back     alignment and structure
>pdb|3B08|A Chain A, Crystal Structure Of The Mouse Hoil1-L-Nzf In Complex With Linear Di- Ubiquitin Length = 152 Back     alignment and structure
>pdb|2ZVN|A Chain A, Nemo Cozi Domain Incomplex With Diubiquitin In P212121 Space Group Length = 154 Back     alignment and structure
>pdb|3U30|A Chain A, Crystal Structure Of A Linear-Specific Ubiquitin Fab Bound To Linear Ubiquitin Length = 172 Back     alignment and structure
>pdb|2Y5B|B Chain B, Structure Of Usp21 In Complex With Linear Diubiquitin-Aldehyde Length = 152 Back     alignment and structure
>pdb|2W9N|A Chain A, Crystal Structure Of Linear Di-Ubiquitin Length = 152 Back     alignment and structure
>pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152 Back     alignment and structure
>pdb|4A18|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 129 Back     alignment and structure
>pdb|3M63|B Chain B, Crystal Structure Of Ufd2 In Complex With The Ubiquitin-Like (Ubl) Domain Of Dsk2 Length = 101 Back     alignment and structure
>pdb|2BWE|S Chain S, The Crystal Structure Of The Complex Between The Uba And Ubl Domains Of Dsk2 Length = 77 Back     alignment and structure
>pdb|3U5E|MM Chain m, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 60s Subunit, Ribosome A Length = 128 Back     alignment and structure
>pdb|3U5C|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 152 Back     alignment and structure
>pdb|1ZW7|A Chain A, Elimination Of The C-Cap In Ubiquitin Structure, Dynamics And Thermodynamic Consequences Length = 82 Back     alignment and structure
>pdb|3OLM|D Chain D, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 79 Back     alignment and structure
>pdb|4HCN|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Ubiquitin Length = 98 Back     alignment and structure
>pdb|1OTR|B Chain B, Solution Structure Of A Cue-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|4II3|B Chain B, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme 1 (uba1) In Complex With Ubiquitin And Atp/mg Length = 96 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|1BT0|A Chain A, Structure Of Ubiquitin-Like Protein, Rub1 Length = 76 Back     alignment and structure
>pdb|1ZGU|B Chain B, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|4GSW|A Chain A, Crystal Structure Of Ubiquitin From Entamoeba Histolytica To 2.15 Angstrom Length = 80 Back     alignment and structure
>pdb|3DBH|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 88 Back     alignment and structure
>pdb|2O6V|D Chain D, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|4II2|B Chain B, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 83 Back     alignment and structure
>pdb|2JWZ|A Chain A, Mutations In The Hydrophobic Core Of Ubiquitin Differentially Affect Its Recognition By Receptor Proteins Length = 76 Back     alignment and structure
>pdb|3AI5|A Chain A, Crystal Structure Of Yeast Enhanced Green Fluorescent Protein- Ubiquitin Fusion Protein Length = 307 Back     alignment and structure
>pdb|3DBL|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 88 Back     alignment and structure
>pdb|3ZF7|SS Chain s, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 128 Back     alignment and structure
>pdb|2JVC|A Chain A, Nmr Solution Structure Of Ubiquitin Like Protein Length = 82 Back     alignment and structure
>pdb|3K9O|B Chain B, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 96 Back     alignment and structure
>pdb|1YX5|B Chain B, Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Length = 98 Back     alignment and structure
>pdb|3DVG|X Chain X, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 80 Back     alignment and structure
>pdb|2KHW|B Chain B, Solution Structure Of The Human Polymerase Iota Ubm2- Ubiquitin Complex Length = 79 Back     alignment and structure
>pdb|4HCP|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Nedd8 Length = 78 Back     alignment and structure
>pdb|3NOB|A Chain A, Structure Of K11-Linked Di-Ubiquitin Length = 78 Back     alignment and structure
>pdb|3JVZ|X Chain X, E2~ubiquitin-Hect Length = 81 Back     alignment and structure
>pdb|2K6D|B Chain B, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|2BKR|B Chain B, Nedd8 Nedp1 Complex Length = 77 Back     alignment and structure
>pdb|2NVU|I Chain I, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 81 Back     alignment and structure
>pdb|3RUL|A Chain A, New Strategy To Analyze Structures Of Glycopeptide-Target Complexes Length = 79 Back     alignment and structure
>pdb|2ZNV|C Chain C, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 77 Back     alignment and structure
>pdb|1XD3|B Chain B, Crystal Structure Of Uchl3-Ubvme Complex Length = 75 Back     alignment and structure
>pdb|1CMX|B Chain B, Structural Basis For The Specificity Of Ubiquitin C- Terminal Hydrolases Length = 76 Back     alignment and structure
>pdb|1AAR|A Chain A, Structure Of A Diubiquitin Conjugate And A Model For Interaction With Ubiquitin Conjugating Enzyme (E2) Length = 76 Back     alignment and structure
>pdb|4F8C|B Chain B, Structure Of The Cif:nedd8 Complex - Yersinia Pseudotuberculosis Cycle Inhibiting Factor In Complex With Human Nedd8 Length = 88 Back     alignment and structure
>pdb|4AP4|C Chain C, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 80 Back     alignment and structure
>pdb|2LD9|A Chain A, Backbone Structure Of Ubiquitin Determined Using Backbone Amide Noes And Backbone N-H And N-C Rdcs Length = 77 Back     alignment and structure
>pdb|3ONS|A Chain A, Crystal Structure Of Human Ubiquitin In A New Crystal Form Length = 72 Back     alignment and structure
>pdb|2XK5|B Chain B, Crystal Structure Of K6-Linked Diubiquitin Length = 76 Back     alignment and structure
>pdb|1NDD|B Chain B, Structure Of Nedd8 Length = 76 Back     alignment and structure
>pdb|3GZN|I Chain I, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 82 Back     alignment and structure
>pdb|2OJR|A Chain A, Structure Of Ubiquitin Solved By Sad Using The Lanthanide- Binding Tag Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 5e-17
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 2e-16
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 2e-16
3m62_B106 UV excision repair protein RAD23; armadillo-like r 6e-15
3m62_B106 UV excision repair protein RAD23; armadillo-like r 5e-08
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 9e-15
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 5e-08
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 1e-14
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 3e-07
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 3e-14
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 2e-07
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 5e-14
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 3e-07
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 6e-14
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 2e-07
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 7e-14
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 5e-07
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 7e-14
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 9e-07
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 9e-14
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 8e-07
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 2e-13
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 5e-06
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 2e-13
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 8e-07
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 3e-13
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 1e-06
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 3e-13
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 5e-06
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 5e-13
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 2e-06
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 5e-13
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 1e-06
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 7e-13
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 1e-06
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 7e-13
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 1e-06
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 8e-13
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 4e-06
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 8e-13
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 3e-06
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 9e-13
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 2e-07
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 2e-12
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 4e-06
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 2e-12
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 3e-06
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 2e-12
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 7e-06
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 4e-12
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 6e-06
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 6e-12
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 1e-05
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 6e-12
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 2e-07
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 7e-12
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 9e-08
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 1e-11
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 3e-07
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 1e-11
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 4e-07
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 2e-11
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 2e-05
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 3e-11
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 1e-06
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 5e-11
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 4e-07
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 7e-11
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 4e-07
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 1e-10
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 4e-07
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 1e-10
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 1e-06
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 2e-10
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 9e-05
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 2e-10
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 2e-06
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 3e-10
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 3e-06
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 3e-10
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 6e-10
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 9e-10
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 2e-06
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 9e-10
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 2e-06
1we6_A111 Splicing factor, putative; structural genomics, ub 1e-08
1we6_A111 Splicing factor, putative; structural genomics, ub 3e-06
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 6e-07
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 1e-04
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 1e-06
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 3e-06
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 4e-06
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 2e-04
2fnj_B118 Transcription elongation factor B polypeptide 2; b 5e-06
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 8e-06
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 4e-04
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 6e-05
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 3e-04
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 9e-05
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 4e-04
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 1e-04
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 1e-04
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
 Score = 74.7 bits (183), Expect = 5e-17
 Identities = 46/175 (26%), Positives = 77/175 (44%), Gaps = 27/175 (15%)

Query: 1   MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYP 60
           M+I VK L G+ I L+V    +I  +K KI +   IP   Q+L+  G+ L D + + DY 
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  QIKEGTKLNLVVKRALKESSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVN 120
             KE T   ++  R   +       G  +T+  + S                        
Sbjct: 61  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPS------------------------ 96

Query: 121 SEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVK 175
              +I  +K KI +   IP   Q+L+  G+ L D + + DY  I++ + L+LV++
Sbjct: 97  --DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY-NIQKESTLHLVLR 148


>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Length = 307 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Length = 105 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Length = 105 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Length = 118 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 100.0
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 100.0
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 100.0
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.79
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.78
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.77
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.76
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.76
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.76
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.75
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.74
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.74
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.74
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.74
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.74
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.74
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.74
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.73
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.73
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.73
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.72
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.72
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.72
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.72
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.72
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.72
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.72
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.71
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.71
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.71
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.71
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.71
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.7
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.7
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.7
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.7
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.7
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.69
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.69
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.69
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.69
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.68
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.68
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.5
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.67
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.67
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.66
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.66
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.66
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.66
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.65
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.65
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.65
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.65
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.65
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.65
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.65
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.64
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.64
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.64
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.64
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.64
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.64
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.64
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.64
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.64
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.63
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.62
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.62
1we6_A111 Splicing factor, putative; structural genomics, ub 99.62
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.62
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.62
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.61
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.61
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.61
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.61
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.61
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.6
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.6
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.6
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.6
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.6
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.59
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.59
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.59
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.38
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.59
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.58
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.58
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.58
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.58
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.58
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.57
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.57
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.57
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.57
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.56
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.56
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.56
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.56
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.56
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.56
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.55
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.55
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.55
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.55
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.55
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.55
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.54
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.54
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.54
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.54
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.54
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.53
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.52
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.52
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.52
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.51
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.51
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.51
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.51
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.5
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.5
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.5
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.49
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.49
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.49
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.49
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.48
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.48
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.48
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.48
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.47
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.47
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.46
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.46
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.45
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.45
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.45
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.44
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.44
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.44
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.44
1we6_A111 Splicing factor, putative; structural genomics, ub 99.44
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.44
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.43
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.42
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.41
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.41
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.41
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.4
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.4
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.4
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.39
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.39
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.38
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.38
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.37
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.37
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.37
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.36
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.36
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.34
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.33
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.32
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.29
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.29
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.29
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.28
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.22
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.21
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.2
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.19
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.17
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.12
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.08
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.05
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 98.99
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.96
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 98.91
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 98.86
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 98.8
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 98.8
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 98.78
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 98.72
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.7
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.7
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.64
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.62
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 98.61
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.54
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.43
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.4
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.38
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.25
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.19
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.15
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.1
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 98.1
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 98.08
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.97
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.97
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 97.96
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.92
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 97.9
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.79
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 97.55
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.54
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.5
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.24
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 97.16
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.11
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 96.9
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 96.9
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.69
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 96.64
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.5
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.36
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 96.13
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 96.07
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 95.55
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 95.46
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 94.96
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 94.96
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 94.4
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 94.28
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 94.22
3vej_A41 Ubiquitin-like protein MDY2; alpha helical, dimeri 94.21
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 94.03
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 93.9
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 93.89
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 93.73
2lnz_A64 Ubiquitin-like protein MDY2; dimerization, homodim 93.5
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 93.31
3kuz_A126 Plexin-C1; structural genomics, structural genomic 93.29
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 93.05
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 92.8
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 92.75
2ylm_A530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 92.45
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 92.25
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 91.45
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 91.25
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 90.81
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 89.49
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 89.2
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 88.89
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 88.73
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 88.57
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 88.2
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 87.43
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 86.56
3ig3_A 627 Plxna3 protein; plexin intracellular GAP RBD inact 86.33
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 85.97
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 85.63
3hm6_X 644 Plexin-B1; structural genomics consortium, SGC, me 85.12
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 84.62
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 84.62
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 84.25
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 83.86
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 83.69
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 83.49
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 83.28
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 82.26
3kuz_A126 Plexin-C1; structural genomics, structural genomic 81.45
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 80.36
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
Probab=100.00  E-value=2.8e-35  Score=236.30  Aligned_cols=150  Identities=21%  Similarity=0.307  Sum_probs=141.0

Q ss_pred             CEEEEEeCCCcEEEEEecCCCCHHHHHHHHHHHhCCCCCCeEEE-E-cCeecCCCccccccCCCCCCCEEEEEEeccccc
Q psy1973           1 MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLL-A-TGRPLLDTKQILDYPQIKEGTKLNLVVKRALKE   78 (252)
Q Consensus         1 M~i~Vk~~~g~~~~~~v~~~~TV~~lK~~I~~~~gi~~~~q~L~-~-~G~~L~d~~tL~~~~~i~~~s~i~l~~~~~~~~   78 (252)
                      |+|+||+++|+++.++|++++||.+||++|++.+|+|+++|+|+ | +|+.|+|+.+|++| +|.+|++|+|+++.    
T Consensus         3 m~i~vk~~~g~~~~l~v~~~~tV~~lK~~I~~~~gip~~~QrL~~~~~g~~L~d~~tL~~y-~i~~~~~l~l~~~~----   77 (159)
T 3rt3_B            3 WDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQ-GLGPGSTVLLVVDK----   77 (159)
T ss_dssp             CEEEEEETTSCEEEEECCTTCCHHHHHHHHHHHHCCCGGGEEEEEETTCCBCCTTSCGGGG-TCCTTCEEEEEECC----
T ss_pred             eEEEEEECCCCEEEEEeCCCCcHHHHHHHHHHHhCCCHHHEEEEEcCCCCCCCCCCCHHHc-CCCCCCEEEEEccC----
Confidence            89999999999999999999999999999999999999999999 9 79999999999999 99999999999982    


Q ss_pred             ccccccCCCCcchhhhhHHHHHHHhhccccccccceeeeecCCcccHHHHHHHhhcccCCCCCCeEEEEcCeecCCCCCc
Q psy1973          79 SSQSVAGGSNVTILRDASYKFLRKYFTETQSNKIADEFIKVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQI  158 (252)
Q Consensus        79 ~~~~~~~~~~~~~l~~~m~i~vk~~~~~~~~g~~~~~~i~v~~~~tV~~lK~~i~~~~gip~~~q~L~~~G~~L~d~~tL  158 (252)
                                   +.+.|+++|+..     +|+.  +.++|++++||.+||++|+.+.|+|+++|+|+|+|+.|.|+.+|
T Consensus        78 -------------~~~~m~i~vk~~-----~g~~--~~~~v~~~~tV~~lK~~i~~~~gip~~~q~L~~~G~~L~d~~tL  137 (159)
T 3rt3_B           78 -------------SDEPLSILVRNN-----KGRS--STYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPL  137 (159)
T ss_dssp             -------------CCCCEEEEEECT-----TSCE--EEEEECTTSBHHHHHHHHHHHHTCCGGGEEEEETTEECCTTSBG
T ss_pred             -------------CCCcEEEEEECC-----CCCE--EEEEeCCCCCHHHHHHHHHHHHCCCHHHEEEEECCeecCCCCCH
Confidence                         234577888876     6776  58999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCEEEEEEec
Q psy1973         159 LDYPQIKEGTKLNLVVKR  176 (252)
Q Consensus       159 ~~y~~i~~gs~l~l~~~~  176 (252)
                      ++| +|++|++|||++|.
T Consensus       138 ~~y-~i~~g~~l~l~~rl  154 (159)
T 3rt3_B          138 GEY-GLKPLSTVFMNLRL  154 (159)
T ss_dssp             GGG-TCCTTCEEEEEECC
T ss_pred             HHc-CCCCCCEEEEEEec
Confidence            999 99999999999987



>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>3vej_A Ubiquitin-like protein MDY2; alpha helical, dimerization, homodimerization, protein bindi; 1.23A {Saccharomyces cerevisiae} Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2lnz_A Ubiquitin-like protein MDY2; dimerization, homodimerization, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 8e-14
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 6e-07
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 1e-12
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 2e-05
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 2e-12
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 2e-05
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 2e-12
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 4e-06
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 7e-12
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 3e-05
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 8e-12
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 8e-06
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 5e-11
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 4e-05
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 6e-11
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 1e-04
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 7e-11
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 1e-06
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 1e-10
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 4e-05
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 2e-10
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 1e-07
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 2e-10
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 3e-05
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 2e-10
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 8e-04
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 3e-10
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 4e-07
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 5e-10
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 5e-10
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 2e-06
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 6e-10
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 7e-05
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 2e-09
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 4e-06
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 2e-09
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 6e-09
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 5e-08
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 8e-09
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 5e-05
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 9e-09
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 2e-04
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 1e-08
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 2e-06
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 2e-08
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 1e-04
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 2e-08
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 6e-05
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 1e-07
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 2e-07
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 7e-05
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 2e-07
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 2e-06
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 1e-05
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 3e-05
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 8e-05
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 4e-04
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 3e-04
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 6e-04
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 5e-04
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 7e-04
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 7e-04
d1we6a_111 d.15.1.1 (A:) Splicing factor 3 subunit 1, C-termi 0.002
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 62.6 bits (152), Expect = 8e-14
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 1  MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYP 60
          M+I VK L G+ I L+V    +I  +K KI +   IP   Q+L+  G+ L D + + DY 
Sbjct: 1  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY- 59

Query: 61 QIKEGTKLNLVVK 73
           I++ + L+LV++
Sbjct: 60 NIQKESTLHLVLR 72


>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.84
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.83
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.82
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.81
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.81
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.8
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.79
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.79
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.79
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.78
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.78
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.77
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.77
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.77
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.76
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.76
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.73
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.73
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.72
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.71
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.71
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.7
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.7
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.7
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.69
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.68
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.68
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.67
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.67
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.67
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.67
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.65
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.65
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.65
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.64
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.64
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.63
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.62
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.61
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.6
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.6
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.6
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.6
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.58
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.58
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.57
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.57
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.56
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.56
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.54
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.54
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.54
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.52
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.48
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.45
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.43
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.42
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.41
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.41
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.36
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.32
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.29
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.29
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.27
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.22
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.19
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.13
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.1
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.08
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 98.81
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.39
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.1
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.73
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.17
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.93
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.26
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 95.83
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 95.59
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 93.05
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 91.6
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 90.41
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 88.08
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 87.79
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 87.53
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 86.71
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Rub1
species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.84  E-value=7.8e-21  Score=130.99  Aligned_cols=72  Identities=38%  Similarity=0.591  Sum_probs=70.9

Q ss_pred             CEEEEEeCCCcEEEEEecCCCCHHHHHHHHHHHhCCCCCCeEEEEcCeecCCCccccccCCCCCCCEEEEEEe
Q psy1973           1 MKISVKVLQGQEIFLDVNSEMSILELKNKINEALKIPVSDQKLLATGRPLLDTKQILDYPQIKEGTKLNLVVK   73 (252)
Q Consensus         1 M~i~Vk~~~g~~~~~~v~~~~TV~~lK~~I~~~~gi~~~~q~L~~~G~~L~d~~tL~~~~~i~~~s~i~l~~~   73 (252)
                      |+|+||+++|++++++|++++||.+||++|+++.|+|+++|+|+|+|+.|+|+.+|++| ||++|++|||++|
T Consensus         1 M~I~Vk~~~G~~~~l~V~~~~tV~~lK~~i~~~~gi~~~~qrLi~~Gk~L~d~~tL~~y-~I~~~sti~lvlr   72 (73)
T d1bt0a_           1 MLIKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDY-NIEGGSVLHLVLA   72 (73)
T ss_dssp             CEEEEECTTSCEEEEECCTTCBHHHHHHHHHHHHCCCGGGEEEEETTEECCTTSBTGGG-TCCTTCEEEEEEC
T ss_pred             CEEEEEeCCCCEEEEEECCCCcHHHHHHHHHHHhCCChHHEEEEECCeEcCCCCcHHHc-CCCCCCEEEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999 9999999999986



>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure