Psyllid ID: psy2134


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
YGQVEKVVIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLFDHNDFSG
cccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccEEEEEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHcccEEcccEEEEEEccccccccccccc
ccccccHcHHHHHHHHHccccEEEEEEEEEcccccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcHHHHccccccc
YGQVEKVVIYNekqsddeaygQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAelydqslfdhndfsg
ygqvekvviynekqsddeaygqVEKVVIYnekqsddeasEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELydqslfdhndfsg
YGQVEKVVIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLFDHNDFSG
*******VIY*********YGQVEKVVIYNE******ASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLF*******
YGQVEKVVIYNEKQSDDEAYGQVEKVVIYNEKQ******EVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLFDHNDF**
YGQVEKVVIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLFDHNDFSG
YGQVEKVVIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLFDH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YGQVEKVVIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMVRAELYDQSLFDHNDFSG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
Q8T6B9637 Poly(U)-binding-splicing no N/A 0.75 0.122 0.458 7e-15
Q5R469558 Poly(U)-binding-splicing yes N/A 0.673 0.125 0.458 2e-13
Q9UHX1559 Poly(U)-binding-splicing yes N/A 0.673 0.125 0.458 2e-13
Q9WV25564 Poly(U)-binding-splicing yes N/A 0.673 0.124 0.447 6e-13
Q3UEB3564 Poly(U)-binding-splicing yes N/A 0.673 0.124 0.447 6e-13
Q2HJG2530 Poly(U)-binding-splicing yes N/A 0.673 0.132 0.447 2e-12
Q6IQE0516 Poly(U)-binding-splicing no N/A 0.673 0.135 0.447 4e-11
P42698387 DNA-damage-repair/tolerat yes N/A 0.653 0.175 0.321 0.0004
>sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 Back     alignment and function desciption
 Score = 79.3 bits (194), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 57/96 (59%), Gaps = 18/96 (18%)

Query: 12  EKQSDDEAYGQVEKVVIYNEKQS---DDEASEVIVKIFVSFSKMQEAEYARDALNGRFFA 68
           E Q +   +G V +V+I+NEKQ+   DD+ +E+IVKIFV FS                 A
Sbjct: 557 EIQEECSKFGTVSRVIIFNEKQTENEDDDEAEIIVKIFVEFSAG---------------A 601

Query: 69  EAEYARDALNGRFFAGRMVRAELYDQSLFDHNDFSG 104
           EA   ++AL+GRFF GR V AELYDQ +FD  D SG
Sbjct: 602 EAMRGKEALDGRFFGGRRVVAELYDQGIFDQGDLSG 637




Splicing factor that regulates oogenesis and controls both mitosis and mRNA localization in the germline by regulating mRNA splicing of a subset of genes within the ovary. Probably acts by regulating the alternative splice site selection of the otu transcript. Also regulates the alternative splicing of eIF-4E and grk, while it is not involved in the splicing of par-1, sqd and psq.
Drosophila melanogaster (taxid: 7227)
>sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 Back     alignment and function description
>sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 Back     alignment and function description
>sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 Back     alignment and function description
>sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=2 SV=2 Back     alignment and function description
>sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 Back     alignment and function description
>sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 Back     alignment and function description
>sp|P42698|DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana GN=DRT111 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
242021379 571 Poly U-binding-splicing factor half pint 0.75 0.136 0.548 3e-20
270001539 591 hypothetical protein TcasGA2_TC000381 [T 0.788 0.138 0.530 5e-20
307195017 561 Poly(U)-binding-splicing factor half pin 0.75 0.139 0.553 9e-20
307177474 510 Poly(U)-binding-splicing factor half pin 0.75 0.152 0.553 9e-20
383861059 592 PREDICTED: poly(U)-binding-splicing fact 0.75 0.131 0.553 1e-19
380016392 592 PREDICTED: poly(U)-binding-splicing fact 0.75 0.131 0.553 1e-19
340725363 592 PREDICTED: poly(U)-binding-splicing fact 0.75 0.131 0.553 1e-19
328783360 592 PREDICTED: poly(U)-binding-splicing fact 0.75 0.131 0.553 1e-19
345484300 605 PREDICTED: LOW QUALITY PROTEIN: poly(U)- 0.75 0.128 0.531 6e-19
328704296 572 PREDICTED: poly(U)-binding-splicing fact 0.75 0.136 0.526 8e-19
>gi|242021379|ref|XP_002431122.1| Poly U-binding-splicing factor half pint, putative [Pediculus humanus corporis] gi|212516371|gb|EEB18384.1| Poly U-binding-splicing factor half pint, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/93 (54%), Positives = 63/93 (67%), Gaps = 15/93 (16%)

Query: 12  EKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAE 71
           E Q +   YG VE+V+IYNEKQSD++ S++IVKIFV FS+  EAE ARD           
Sbjct: 494 EIQDECSKYGVVERVIIYNEKQSDNDDSDIIVKIFVEFSRTSEAESARD----------- 542

Query: 72  YARDALNGRFFAGRMVRAELYDQSLFDHNDFSG 104
               ALNGR+F GR+V+  LYDQ LFDH+DFSG
Sbjct: 543 ----ALNGRYFGGRLVKCSLYDQVLFDHSDFSG 571




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270001539|gb|EEZ97986.1| hypothetical protein TcasGA2_TC000381 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307195017|gb|EFN77085.1| Poly(U)-binding-splicing factor half pint [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307177474|gb|EFN66601.1| Poly(U)-binding-splicing factor half pint [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383861059|ref|XP_003706004.1| PREDICTED: poly(U)-binding-splicing factor half pint-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380016392|ref|XP_003692169.1| PREDICTED: poly(U)-binding-splicing factor half pint-like [Apis florea] Back     alignment and taxonomy information
>gi|340725363|ref|XP_003401040.1| PREDICTED: poly(U)-binding-splicing factor half pint-like [Bombus terrestris] gi|350403872|ref|XP_003486932.1| PREDICTED: poly(U)-binding-splicing factor half pint-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328783360|ref|XP_001121000.2| PREDICTED: poly(U)-binding-splicing factor half pint-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345484300|ref|XP_003424998.1| PREDICTED: LOW QUALITY PROTEIN: poly(U)-binding-splicing factor half pint-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328704296|ref|XP_001948399.2| PREDICTED: poly(U)-binding-splicing factor half pint-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
FB|FBgn0028577637 pUf68 "poly U binding factor 6 0.778 0.127 0.454 7.3e-13
UNIPROTKB|F1P1V2522 LOC426301 "Uncharacterized pro 0.663 0.132 0.464 3.6e-11
UNIPROTKB|E2RA48543 PUF60 "Uncharacterized protein 0.663 0.127 0.464 3.8e-11
UNIPROTKB|Q9UHX1559 PUF60 "Poly(U)-binding-splicin 0.663 0.123 0.464 4e-11
UNIPROTKB|J9P4I7560 PUF60 "Uncharacterized protein 0.663 0.123 0.464 4e-11
UNIPROTKB|F1N238530 PUF60 "Poly(U)-binding-splicin 0.663 0.130 0.464 4.7e-11
UNIPROTKB|Q2HJG2530 PUF60 "Poly(U)-binding-splicin 0.663 0.130 0.464 9.8e-11
MGI|MGI:1915209564 Puf60 "poly-U binding splicing 0.663 0.122 0.452 1.1e-10
RGD|621674564 Puf60 "poly-U binding splicing 0.663 0.122 0.452 1.1e-10
UNIPROTKB|I3LVL9406 PUF60 "Uncharacterized protein 0.634 0.162 0.469 2.1e-10
FB|FBgn0028577 pUf68 "poly U binding factor 68kD" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 180 (68.4 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 45/99 (45%), Positives = 59/99 (59%)

Query:     9 IYNEKQSDDEAYGQVEKVVIYNEKQS---DDEASEVIVKIFVSFSKMQEAEYARDALNGR 65
             +  E Q +   +G V +V+I+NEKQ+   DD+ +E+IVKIFV FS             G 
Sbjct:   554 LQEEIQEECSKFGTVSRVIIFNEKQTENEDDDEAEIIVKIFVEFSA------------G- 600

Query:    66 FFAEAEYARDALNGRFFAGRMVRAELYDQSLFDHNDFSG 104
               AEA   ++AL+GRFF GR V AELYDQ +FD  D SG
Sbjct:   601 --AEAMRGKEALDGRFFGGRRVVAELYDQGIFDQGDLSG 637


GO:0008266 "poly(U) RNA binding" evidence=ISS;NAS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS;IMP;NAS
GO:0003729 "mRNA binding" evidence=ISS
GO:0006376 "mRNA splice site selection" evidence=NAS;IMP
GO:0007282 "cystoblast division" evidence=IMP
GO:0000380 "alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005634 "nucleus" evidence=IC;IDA
GO:0051726 "regulation of cell cycle" evidence=IMP
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043234 "protein complex" evidence=IPI
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0001558 "regulation of cell growth" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1P1V2 LOC426301 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RA48 PUF60 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UHX1 PUF60 "Poly(U)-binding-splicing factor PUF60" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P4I7 PUF60 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N238 PUF60 "Poly(U)-binding-splicing factor PUF60" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJG2 PUF60 "Poly(U)-binding-splicing factor PUF60" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915209 Puf60 "poly-U binding splicing factor 60" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621674 Puf60 "poly-U binding splicing factor 60" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LVL9 PUF60 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 4e-26
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 5e-21
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 6e-11
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 1e-10
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 3e-05
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 7e-05
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 8e-05
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 0.001
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
 Score = 92.5 bits (230), Expect = 4e-26
 Identities = 41/84 (48%), Positives = 52/84 (61%), Gaps = 15/84 (17%)

Query: 20  YGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNG 79
           +G V +V+IY EKQ ++E +E+IVKIFV FS                  EAE A  ALNG
Sbjct: 30  FGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSLPS---------------EAEKAIQALNG 74

Query: 80  RFFAGRMVRAELYDQSLFDHNDFS 103
           R+F GR V+AELYDQ+ FD +D S
Sbjct: 75  RWFGGRKVKAELYDQTKFDASDLS 98


This subgroup corresponds to the RRM3 of PUF60, also termed FUSE-binding protein-interacting repressor (FBP-interacting repressor or FIR), or Ro-binding protein 1 (RoBP1), or Siah-binding protein 1 (Siah-BP1), an essential splicing factor that functions as a poly-U RNA-binding protein required to reconstitute splicing in depleted nuclear extracts. Its function is enhanced through interaction with U2 auxiliary factor U2AF65. PUF60 also controls human c-myc gene expression by binding and inhibiting the transcription factor far upstream sequence element (FUSE)-binding-protein (FBP), an activator of c-myc promoters. PUF60 contains two central RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a C-terminal U2AF (U2 auxiliary factor) homology motifs (UHM) that harbors another RRM and binds to tryptophan-containing linear peptide motifs (UHM ligand motifs, ULMs) in several nuclear proteins. The research indicates that PUF60 binds FUSE as a dimer, and only the first two RRM domains participate in the single-stranded DNA recognition. . Length = 98

>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.87
KOG0124|consensus544 99.85
KOG1996|consensus378 99.8
KOG0120|consensus500 99.68
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.63
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.58
KOG0147|consensus549 99.5
smart0036170 RRM_1 RNA recognition motif. 99.47
KOG1548|consensus382 99.46
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.26
KOG2202|consensus 260 99.04
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.65
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.58
smart0036071 RRM RNA recognition motif. 98.48
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.47
KOG0107|consensus 195 98.42
smart0036272 RRM_2 RNA recognition motif. 98.39
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.38
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.33
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.2
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.17
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.9
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.87
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.86
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 97.85
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.83
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 97.79
KOG0124|consensus544 97.79
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 97.79
PLN03120 260 nucleic acid binding protein; Provisional 97.69
KOG4207|consensus 256 97.68
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 97.58
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 97.58
KOG0125|consensus 376 97.56
COG0724 306 RNA-binding proteins (RRM domain) [General functio 97.47
KOG0114|consensus124 97.39
KOG0148|consensus321 97.32
KOG0148|consensus 321 97.28
PLN03121 243 nucleic acid binding protein; Provisional 97.15
KOG0108|consensus 435 97.13
KOG0127|consensus 678 97.03
KOG0123|consensus 369 96.82
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.78
KOG0144|consensus 510 96.67
KOG0113|consensus 335 96.61
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 96.6
KOG0117|consensus 506 96.55
PLN03213 759 repressor of silencing 3; Provisional 96.15
KOG0122|consensus270 96.03
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.03
KOG1456|consensus 494 95.89
KOG0105|consensus 241 95.88
KOG0109|consensus 346 95.81
KOG4206|consensus 221 95.72
KOG0144|consensus 510 95.46
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.01
KOG0145|consensus 360 94.97
KOG4660|consensus 549 94.81
KOG0110|consensus 725 94.66
KOG2314|consensus 698 94.62
KOG4208|consensus214 94.62
KOG0123|consensus 369 94.46
KOG0121|consensus153 94.46
KOG0145|consensus360 94.3
KOG4209|consensus231 93.71
KOG0117|consensus 506 92.3
KOG0132|consensus 894 92.18
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 91.56
KOG0149|consensus 247 91.46
KOG1190|consensus 492 91.32
KOG0127|consensus 678 91.26
KOG0126|consensus219 91.07
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 91.05
PF15023166 DUF4523: Protein of unknown function (DUF4523) 90.44
KOG0131|consensus 203 90.24
KOG0130|consensus170 89.69
KOG0146|consensus 371 89.38
KOG4661|consensus 940 89.28
KOG4285|consensus350 89.18
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 89.11
KOG0533|consensus243 88.26
KOG0111|consensus 298 88.05
KOG0106|consensus 216 86.96
KOG4212|consensus608 86.77
KOG0415|consensus 479 84.48
KOG0147|consensus 549 83.34
KOG0146|consensus371 82.1
KOG0110|consensus725 81.8
KOG1190|consensus 492 81.05
KOG0153|consensus377 80.95
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 80.41
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
Probab=99.87  E-value=2.1e-22  Score=174.56  Aligned_cols=82  Identities=50%  Similarity=0.801  Sum_probs=76.3

Q ss_pred             eehhHHHHHhhhCCceeEEEEecCCCCCcccccceEEEEEEeCCHHHHHHHHHhhccchhhhhhhhhhhhcCceeCCeEE
Q psy2134           8 VIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMV   87 (104)
Q Consensus         8 ~i~~ev~~Ec~kyG~V~kV~I~~~~~~~~~~~~~~vkifV~F~~~~~A~~A~~~~~~r~f~~~~~~~~~LnGR~F~GR~V   87 (104)
                      +|++||++||+|||.|++|+|+.+++.+..+.+++|+|||+|++.++|.+|++               .||||||+||+|
T Consensus       531 dl~eDV~eEC~K~G~V~~v~I~~~~~~~~~~~~~~g~VfV~F~~~~~A~~A~~---------------~LnGR~F~GR~V  595 (612)
T TIGR01645       531 FLEGEIREECGKFGVVDRVIINFEKQGEEEDAEIIVKIFVEFSDSMEVDRAKA---------------ALDGRFFGGRTV  595 (612)
T ss_pred             HHHHHHHHHhhcCceeEEEEEecCCCCccccccceEEEEEEECCHHHHHHHHH---------------HhcCCeECCeEE
Confidence            58999999999999999999999776545566789999999999999999999               999999999999


Q ss_pred             EEEEeccccccccCCCC
Q psy2134          88 RAELYDQSLFDHNDFSG  104 (104)
Q Consensus        88 ~a~~yd~~~f~~~~~~~  104 (104)
                      .|+|||+++|+++||+|
T Consensus       596 ~a~~yd~~~f~~~~l~~  612 (612)
T TIGR01645       596 VAEAYDQILFDHADLSG  612 (612)
T ss_pred             EEEEcCHHHhhccccCC
Confidence            99999999999999987



In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.

>KOG0124|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
3dxb_A222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 1e-13
2dny_A119 Solution Structure Of The Third Rna Binding Domain 1e-13
3ue2_A118 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-13
2pe8_A105 Crystal Structure Of The Uhm Domain Of Human Spf45 7e-04
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure

Iteration: 1

Score = 71.6 bits (174), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 39/84 (46%), Positives = 51/84 (60%), Gaps = 15/84 (17%) Query: 20 YGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNG 79 +G V +V+IY EKQ ++E +E+IVKIFV FS +E A ALNG Sbjct: 153 FGAVNRVIIYQEKQGEEEDAEIIVKIFVEFS---------------IASETHKAIQALNG 197 Query: 80 RFFAGRMVRAELYDQSLFDHNDFS 103 R+FAGR V AE+YDQ FD++D S Sbjct: 198 RWFAGRKVVAEVYDQERFDNSDLS 221
>pdb|2DNY|A Chain A, Solution Structure Of The Third Rna Binding Domain Of Fbp- Interacting Repressor, Siahbp1 Length = 119 Back     alignment and structure
>pdb|3UE2|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 1.23 A Resolution Length = 118 Back     alignment and structure
>pdb|2PE8|A Chain A, Crystal Structure Of The Uhm Domain Of Human Spf45 (free Form) Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 4e-28
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 2e-17
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 9e-13
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-10
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 2e-10
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 8e-10
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-09
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-04
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
 Score =  100 bits (251), Expect = 4e-28
 Identities = 39/85 (45%), Positives = 51/85 (60%), Gaps = 15/85 (17%)

Query: 20  YGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNG 79
           +G V +V+IY EKQ ++E +E+IVKIFV FS                 +E   A  ALNG
Sbjct: 153 FGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIA---------------SETHKAIQALNG 197

Query: 80  RFFAGRMVRAELYDQSLFDHNDFSG 104
           R+FAGR V AE+YDQ  FD++D S 
Sbjct: 198 RWFAGRKVVAEVYDQERFDNSDLSA 222


>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.87
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.81
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.79
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.76
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.71
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.55
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.45
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.92
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.9
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.87
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.85
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.85
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.85
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.83
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.8
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.8
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.8
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.79
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.77
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.77
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.76
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.76
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.76
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.75
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.75
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.75
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.75
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.75
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.74
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.73
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.71
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.7
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.7
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.69
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.69
1x5p_A97 Negative elongation factor E; structure genomics, 98.69
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.68
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.68
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.67
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.67
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.67
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.66
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.66
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.65
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.65
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.65
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.65
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.65
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.65
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.65
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.64
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.64
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.64
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.64
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.63
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.63
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.63
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.62
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.62
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.62
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.61
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.61
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.61
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.61
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.61
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.61
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.6
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.59
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.59
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.59
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.58
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.58
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.58
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.57
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.57
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.56
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.56
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.56
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.56
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.56
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.55
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.55
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.55
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.55
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.54
2div_A99 TRNA selenocysteine associated protein; structural 98.54
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.54
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.53
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.53
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.52
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.51
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.51
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.51
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.51
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.51
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.51
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.48
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.48
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.47
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.47
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.47
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.46
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.45
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.45
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.45
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.45
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.44
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.44
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.43
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.43
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.43
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.43
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.42
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.42
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.42
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.42
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.42
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.41
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.41
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.4
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.4
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.39
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.39
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.38
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.38
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.37
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.36
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.36
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.35
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.35
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.34
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.33
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.33
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.32
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.32
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.31
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.31
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.3
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.3
2dis_A109 Unnamed protein product; structural genomics, RRM 98.29
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.28
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.28
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.27
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.25
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.23
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.22
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.22
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.22
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.22
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.22
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.21
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.21
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.2
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.2
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.2
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.19
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.17
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 98.17
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.17
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.15
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.12
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.1
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.09
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.07
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.34
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.03
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.02
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.02
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.01
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 97.99
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.99
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.99
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.98
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 97.97
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 97.95
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.92
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.85
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.85
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.84
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 97.81
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.79
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 97.77
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 97.77
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.73
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.69
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.62
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 97.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 97.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.59
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.54
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.52
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 97.36
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.35
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 97.35
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 97.32
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.3
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.25
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 96.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.92
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 96.39
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 95.49
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 90.59
2i2y_A150 Fusion protein consists of immunoglobin G- binding 85.04
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
Probab=99.87  E-value=1.5e-22  Score=140.37  Aligned_cols=82  Identities=49%  Similarity=0.761  Sum_probs=73.9

Q ss_pred             eehhHHHHHhhhCCceeEEEEecCCCCCcccccceEEEEEEeCCHHHHHHHHHhhccchhhhhhhhhhhhcCceeCCeEE
Q psy2134           8 VIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRMV   87 (104)
Q Consensus         8 ~i~~ev~~Ec~kyG~V~kV~I~~~~~~~~~~~~~~vkifV~F~~~~~A~~A~~~~~~r~f~~~~~~~~~LnGR~F~GR~V   87 (104)
                      +|++|+++||++||+|.+|.|+.+..+........|.+||+|++.++|.+|+.               +||||+|+||.|
T Consensus        37 dleedl~eef~k~G~V~~v~I~~~~~~~~~~~~~~G~~FV~F~~~e~A~~Ai~---------------~LnGr~f~GR~i  101 (118)
T 3ue2_A           37 DLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQ---------------ALNGRWFAGRKV  101 (118)
T ss_dssp             THHHHHHHHHTTTSCEEEEEEEEEEESSSTTCEEEEEEEEEESSHHHHHHHHH---------------HHTTCEETTEEC
T ss_pred             HHHHHHHHHHhccCCEeEEEEeecCCCcccCCcceEEEEEEECCHHHHHHHHH---------------HHCCCEECCcEE
Confidence            58899999999999999999998765322334567999999999999999999               999999999999


Q ss_pred             EEEEeccccccccCCCC
Q psy2134          88 RAELYDQSLFDHNDFSG  104 (104)
Q Consensus        88 ~a~~yd~~~f~~~~~~~  104 (104)
                      .+.||+++.|.+++|+|
T Consensus       102 ~v~~~~~~~f~~~~~~~  118 (118)
T 3ue2_A          102 VAEVYDQERFDNSDLSA  118 (118)
T ss_dssp             EEEEECHHHHHTTCCCC
T ss_pred             EEEEcChHhccccccCC
Confidence            99999999999999997



>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.003
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor U2AF 65 KDa subunit
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.7 bits (100), Expect = 3e-07
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 69  EAEYARDALNGRFFAGRMVRAELYDQSLFDHNDF 102
           + + A   L GR FA R+V  +  D   +   DF
Sbjct: 70  DCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 103


>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.83
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.68
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.51
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.98
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.95
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.94
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.9
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.89
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.89
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.85
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.85
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.84
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.83
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.83
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.81
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.78
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.76
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.75
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.75
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.74
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.74
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.74
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.73
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.73
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.73
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.73
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.71
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.7
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.7
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.68
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.66
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.65
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.65
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.64
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.63
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.63
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.58
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.54
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.54
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.51
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.51
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.49
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.48
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.47
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.47
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.47
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.46
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.45
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.45
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.45
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.44
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.43
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.43
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.41
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.39
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.39
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.37
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.33
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.32
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.32
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.32
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.31
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.3
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.29
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.28
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.25
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.23
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.21
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.17
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.0
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.95
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.89
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.85
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.84
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.8
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 97.78
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.76
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.56
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.55
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.49
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.87
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.54
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.62
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor U2AF 65 KDa subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=1.8e-21  Score=129.62  Aligned_cols=79  Identities=27%  Similarity=0.393  Sum_probs=70.5

Q ss_pred             heehhHHHHHhhhCCceeEEEEecCCCCCcccccceEEEEEEeCCHHHHHHHHHhhccchhhhhhhhhhhhcCceeCCeE
Q psy2134           7 VVIYNEKQSDDEAYGQVEKVVIYNEKQSDDEASEVIVKIFVSFSKMQEAEYARDALNGRFFAEAEYARDALNGRFFAGRM   86 (104)
Q Consensus         7 v~i~~ev~~Ec~kyG~V~kV~I~~~~~~~~~~~~~~vkifV~F~~~~~A~~A~~~~~~r~f~~~~~~~~~LnGR~F~GR~   86 (104)
                      -+|.+|+++||++||.|++|+|+.+.+.  ..+...|.+||+|.++++|.+|+.               .||||+|+||.
T Consensus        25 ~~i~edi~~e~~k~G~v~~v~I~~~~~~--~~~~~~g~vfV~f~~~e~A~~A~~---------------~l~Gr~f~gR~   87 (104)
T d1o0pa_          25 EEIVEDVRDECSKYGLVKSIEIPRPVDG--VEVPGCGKIFVEFTSVFDCQKAMQ---------------GLTGRKFANRV   87 (104)
T ss_dssp             HHHHHHHHHHHTTTSCEEEEECCCCTTS--SSCTTCCEEEEEESCHHHHHHHHH---------------HHSSCCSSSSC
T ss_pred             HHHHHHHHHHhcccCceEEEEEeecCCC--CccCCceEEEEEECCHHHHHHHHH---------------HHCCCEECCeE
Confidence            4688999999999999999999876543  334566899999999999999999               99999999999


Q ss_pred             EEEEEeccccccccCC
Q psy2134          87 VRAELYDQSLFDHNDF  102 (104)
Q Consensus        87 V~a~~yd~~~f~~~~~  102 (104)
                      |.+.||+++.|..++|
T Consensus        88 v~v~f~~~~~y~~~~f  103 (104)
T d1o0pa_          88 VVTKYCDPDSYHRRDF  103 (104)
T ss_dssp             CEEEEECHHHHHHTSC
T ss_pred             EEEEEcCHHHhhhccC
Confidence            9999999999999887



>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure