Psyllid ID: psy2153

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MEYPHPTPYPLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSLKSFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQDCPVIENVSGTEKPPSMLVMSGGEGYIDFRIARLI
cccccccccccccccccEEEEEEEccEEEEEEccccEEEEEccccccccccccEEEEEccccccccEEEEEccEEEEEEccEEEEEcccccccEEEcccccccEEEEEEEccEEEEEEccccEEEEEEcccccEEEEEccccHHHccccccccccEEEEEEEEEEEEEcccEEEEccccEEEEEEEEEccccEEEEEEccccccccEEEEEEEEEEccccEEEcccccccccccEEEccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEEccccHHHccccccc
ccccccccccHHHccHHEEEEEEccccEEEEEEccEEEEEEccccccccccccEEEEEcccccccEEEEEEccEEEEEEccEEEEEcccHHcEEcccccccccEEEEEEcccEEEEEEEcccEEEEEcHHHHHHHHHccccccHHHccccccEEEEEEEEEEcccEEEEcccEEEEEccccHHccccccccccccccccccccccHHEEEEEHHHHccccEEEEccccEEEEEEEcccccccccccccccccccccccccEEEccccccEEEEEEEccccccccccccccccccccccccccccccEEEEEccccEEEEEccccc
meyphptpyplnkildtalppvhvQGRVVCALadgsvaifrrgpdgqwdlskyhtvtlglphhsVRSLAAVYNKVWcgyknkihvvdpkslksfdahprresqvRQMTWAGDGVWVSIRLDSTLRMYNAhtyqhlqdvdiepyvskMLGMYTFCSCVTIRTLLAEtiispfgwyannpadILESFTVCQSHLLciasvpgtgklgFSFVRITALLISSSRLwigtasgkapsgvrvfsepatsvitpgtfipyCSMAQAQLSFHGHRDAVKFFvsvpgsgglsaatsvpqdcpvienvsgtekppsmlvmsggegyiDFRIARLI
MEYPHPTPYPLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKihvvdpkslksfdahprresqvrqmtwagdGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQDCPVIenvsgtekppsmlvmsggegyiDFRIARLI
MEYPHPTPYPLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSLKSFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQDCPVIENVSGTEKPPSMLVMSGGEGYIDFRIARLI
*********PLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPK**************VRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLS********C*V******************GEGYIDFRI****
***********NKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSLKSFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQ**************LGFSFVRITALLISSSRL*******************************YCSMAQAQLSFHGHRDAVKFFVS*********************************VMSGGEGYIDFRIARL*
MEYPHPTPYPLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSLKSFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQDCPVIENVSGTEKPPSMLVMSGGEGYIDFRIARLI
*****PTPYPLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSLKSFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGS************************PPSMLVMSGGEGYIDFRIARLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYPHPTPYPLNKILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSLKSFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQDCPVIENVSGTEKPPSMLVMSGGEGYIDFRIARLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query325 2.2.26 [Sep-21-2011]
Q58A651321 C-Jun-amino-terminal kina yes N/A 0.796 0.196 0.508 1e-89
O602711321 C-Jun-amino-terminal kina yes N/A 0.793 0.195 0.519 4e-89
Q9UPT61336 C-Jun-amino-terminal kina no N/A 0.793 0.193 0.501 4e-85
Q9ESN91337 C-Jun-amino-terminal kina no N/A 0.796 0.193 0.494 1e-84
Q9GQF11227 JNK-interacting protein 3 yes N/A 0.766 0.202 0.490 5e-74
Q29EP61235 JNK-interacting protein 3 yes N/A 0.747 0.196 0.484 1e-72
P346091157 JNK-interacting protein O yes N/A 0.76 0.213 0.422 7e-65
Q80U352057 Rho guanine nucleotide ex no N/A 0.750 0.118 0.236 2e-16
Q96PE22063 Rho guanine nucleotide ex no N/A 0.747 0.117 0.245 1e-15
O150131369 Rho guanine nucleotide ex no N/A 0.390 0.092 0.291 5e-11
>sp|Q58A65|JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus GN=Spag9 PE=1 SV=2 Back     alignment and function desciption
 Score =  330 bits (845), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 172/338 (50%), Positives = 210/338 (62%), Gaps = 79/338 (23%)

Query: 13   KILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVY 72
            K+ D+ L  VHV+G V+ ALADG++AIF RG DGQWDLS YH + LG PHHS+R +  V+
Sbjct: 998  KLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVH 1057

Query: 73   NKVWCGYKNKIHVVDPKSLK---SFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNA 129
            +KVWCGY+NKI+VV PK++K   SFDAHPR+ESQVRQ+ W GDGVWVSIRLDSTLR+Y+A
Sbjct: 1058 DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHA 1117

Query: 130  HTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVCQ 189
            HTYQHLQDVDIEPYVSKMLG                                        
Sbjct: 1118 HTYQHLQDVDIEPYVSKMLG---------------------------------------- 1137

Query: 190  SHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTASG-------------------KA 230
                       TGKLGFSFVRITAL++S +RLW+GT +G                   + 
Sbjct: 1138 -----------TGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRP 1186

Query: 231  PSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQ 290
             S +RV+ +  +  +TPGTFIPYCSMA AQL FHGHRDAVKFFV+VPG      ++S   
Sbjct: 1187 GSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGA 1246

Query: 291  DCPVIENVSGTEKP------PSMLVMSGGEGYIDFRIA 322
            D    +  S  ++P       SMLV+SGGEGYIDFR+ 
Sbjct: 1247 DLTADKAGSSAQEPSSQTPLKSMLVISGGEGYIDFRMG 1284
The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module.
Mus musculus (taxid: 10090)
>sp|O60271|JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens GN=SPAG9 PE=1 SV=4 Back     alignment and function description
>sp|Q9UPT6|JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens GN=MAPK8IP3 PE=1 SV=3 Back     alignment and function description
>sp|Q9ESN9|JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus GN=Mapk8ip3 PE=1 SV=1 Back     alignment and function description
>sp|Q9GQF1|JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster GN=syd PE=1 SV=1 Back     alignment and function description
>sp|Q29EP6|JIP3_DROPS JNK-interacting protein 3 OS=Drosophila pseudoobscura pseudoobscura GN=syd PE=3 SV=2 Back     alignment and function description
>sp|P34609|JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans GN=unc-16 PE=1 SV=3 Back     alignment and function description
>sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 Back     alignment and function description
>sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 Back     alignment and function description
>sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query325
307176985 1284 C-jun-amino-terminal kinase-interacting 0.747 0.189 0.538 8e-92
340714920 1273 PREDICTED: LOW QUALITY PROTEIN: JNK-inte 0.747 0.190 0.532 4e-91
350402040 1273 PREDICTED: LOW QUALITY PROTEIN: JNK-inte 0.747 0.190 0.529 1e-90
328785630 1218 PREDICTED: JNK-interacting protein 3 [Ap 0.747 0.199 0.529 2e-90
345492673 1194 PREDICTED: JNK-interacting protein 3-lik 0.747 0.203 0.532 3e-90
301612945 1209 PREDICTED: c-Jun-amino-terminal kinase-i 0.796 0.214 0.514 6e-90
345492675 1217 PREDICTED: JNK-interacting protein 3-lik 0.744 0.198 0.530 9e-90
291222819 1104 PREDICTED: sunday driver-like, partial [ 0.766 0.225 0.519 9e-90
307197481 645 C-jun-amino-terminal kinase-interacting 0.747 0.376 0.535 1e-89
363740927 1307 PREDICTED: c-Jun-amino-terminal kinase-i 0.778 0.193 0.526 2e-89
>gi|307176985|gb|EFN66291.1| C-jun-amino-terminal kinase-interacting protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  343 bits (879), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 184/342 (53%), Positives = 210/342 (61%), Gaps = 99/342 (28%)

Query: 13   KILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVY 72
            K+ D AL  VHVQGRV+ ALADG+V IFRRG DGQWDLS+YH +TLG P HS+R + AV 
Sbjct: 936  KLKDAALAIVHVQGRVLVALADGTVTIFRRGADGQWDLSQYHVITLGSPQHSIRCMTAVS 995

Query: 73   NK-VWCGYKNKIHVVDPKSLK---SFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYN 128
             K VWCGY+NKIHV+DP S+    + DAHPRRESQVRQ+ W GDGVW+SIRLDSTLR+Y+
Sbjct: 996  GKTVWCGYRNKIHVIDPISMTLECTVDAHPRRESQVRQLAWLGDGVWISIRLDSTLRLYH 1055

Query: 129  AHTYQHLQDVDIEPYVSKMLGMYTFCSCVTIRTLLAETIISPFGWYANNPADILESFTVC 188
            AHTYQHLQDVDIEPYVSKMLG                                       
Sbjct: 1056 AHTYQHLQDVDIEPYVSKMLG--------------------------------------- 1076

Query: 189  QSHLLCIASVPGTGKLGFSFVRITALLISSSRLWIGTAS--------------------- 227
                        TGKLGFSFVRITALLISS+RLWIGT +                     
Sbjct: 1077 ------------TGKLGFSFVRITALLISSNRLWIGTGNGVIISVPLSESAGGSMAVSRI 1124

Query: 228  ------GKAPS-GVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSG 280
                  G AP  GVR+F+  +   +TPG+FIPYCSMA AQLSFHGHRDAVK FV+VPG G
Sbjct: 1125 QTSGNKGDAPGVGVRIFA--SERGVTPGSFIPYCSMAHAQLSFHGHRDAVKMFVAVPGHG 1182

Query: 281  GLSAATSVPQDCPVIENVSGTEKPPSMLVMSGGEGYIDFRIA 322
            G SA T   Q              P+MLV+SGGEGYIDFR+A
Sbjct: 1183 GQSAVTDGTQ--------------PAMLVLSGGEGYIDFRVA 1210

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340714920|ref|XP_003395970.1| PREDICTED: LOW QUALITY PROTEIN: JNK-interacting protein 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350402040|ref|XP_003486348.1| PREDICTED: LOW QUALITY PROTEIN: JNK-interacting protein 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328785630|ref|XP_396524.4| PREDICTED: JNK-interacting protein 3 [Apis mellifera] Back     alignment and taxonomy information
>gi|345492673|ref|XP_003426905.1| PREDICTED: JNK-interacting protein 3-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|301612945|ref|XP_002935990.1| PREDICTED: c-Jun-amino-terminal kinase-interacting protein 4-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|345492675|ref|XP_003426906.1| PREDICTED: JNK-interacting protein 3-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|291222819|ref|XP_002731412.1| PREDICTED: sunday driver-like, partial [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|307197481|gb|EFN78715.1| C-jun-amino-terminal kinase-interacting protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|363740927|ref|XP_420098.3| PREDICTED: c-Jun-amino-terminal kinase-interacting protein 4 isoform 2 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query325
UNIPROTKB|F1MZ691177 SPAG9 "Uncharacterized protein 0.421 0.116 0.714 2.5e-86
UNIPROTKB|Q9UPT61336 MAPK8IP3 "C-Jun-amino-terminal 0.421 0.102 0.728 1e-84
UNIPROTKB|F1PK771326 SPAG9 "Uncharacterized protein 0.421 0.103 0.714 1.1e-84
UNIPROTKB|D4AD981337 Mapk8ip3 "Mitogen-activated pr 0.421 0.102 0.721 1.2e-83
UNIPROTKB|D4A8Q81345 Mapk8ip3 "Protein Mapk8ip3" [R 0.421 0.101 0.721 1.3e-83
UNIPROTKB|E1BN821328 MAPK8IP3 "Uncharacterized prot 0.421 0.103 0.721 1.8e-83
MGI|MGI:13535981337 Mapk8ip3 "mitogen-activated pr 0.421 0.102 0.721 3.2e-83
MGI|MGI:19180841321 Spag9 "sperm associated antige 0.421 0.103 0.714 3.5e-75
UNIPROTKB|O602711321 SPAG9 "C-Jun-amino-terminal ki 0.421 0.103 0.714 9.2e-75
ZFIN|ZDB-GENE-070820-71289 spag9a "sperm associated antig 0.421 0.106 0.671 8.9e-73
UNIPROTKB|F1MZ69 SPAG9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 2.5e-86, Sum P(3) = 2.5e-86
 Identities = 100/140 (71%), Positives = 119/140 (85%)

Query:    13 KILDTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVY 72
             K+ D+ L  VHV+G V+ ALADG++AIF RG DGQWDLS YH + LG PHHS+R +  V+
Sbjct:   841 KLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVH 900

Query:    73 NKVWCGYKNKIHVVDPKSLK---SFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNA 129
             +KVWCGY+NKI+VV PK++K   SFDAHPR+ESQVRQ+ W GDGVWVSIRLDSTLR+Y+A
Sbjct:   901 DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHA 960

Query:   130 HTYQHLQDVDIEPYVSKMLG 149
             HTYQHLQDVDIEPYVSKMLG
Sbjct:   961 HTYQHLQDVDIEPYVSKMLG 980
GO:0090074 "negative regulation of protein homodimerization activity" evidence=IEA
GO:0051260 "protein homooligomerization" evidence=IEA
GO:0051146 "striated muscle cell differentiation" evidence=IEA
GO:0048273 "mitogen-activated protein kinase p38 binding" evidence=IEA
GO:0045666 "positive regulation of neuron differentiation" evidence=IEA
GO:0042147 "retrograde transport, endosome to Golgi" evidence=IEA
GO:0030335 "positive regulation of cell migration" evidence=IEA
GO:0019894 "kinesin binding" evidence=IEA
GO:0008432 "JUN kinase binding" evidence=IEA
GO:0007257 "activation of JUN kinase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|Q9UPT6 MAPK8IP3 "C-Jun-amino-terminal kinase-interacting protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK77 SPAG9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4AD98 Mapk8ip3 "Mitogen-activated protein kinase 8 interacting protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A8Q8 Mapk8ip3 "Protein Mapk8ip3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BN82 MAPK8IP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1353598 Mapk8ip3 "mitogen-activated protein kinase 8 interacting protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1918084 Spag9 "sperm associated antigen 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O60271 SPAG9 "C-Jun-amino-terminal kinase-interacting protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070820-7 spag9a "sperm associated antigen 9a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58A65JIP4_MOUSENo assigned EC number0.50880.79690.1960yesN/A
O60271JIP4_HUMANNo assigned EC number0.51910.79380.1953yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 325
KOG3522|consensus925 100.0
KOG3522|consensus925 99.39
KOG2077|consensus832 98.09
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.59
KOG0301|consensus 745 97.57
KOG1036|consensus323 97.49
KOG0646|consensus476 97.39
KOG1539|consensus 910 97.34
PTZ00421493 coronin; Provisional 97.18
KOG0306|consensus888 97.17
KOG2110|consensus391 97.02
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.01
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.98
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.85
PLN00181793 protein SPA1-RELATED; Provisional 96.77
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.72
KOG2111|consensus346 96.53
KOG0274|consensus537 96.52
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.46
KOG0274|consensus537 96.43
KOG0291|consensus 893 96.39
KOG0276|consensus 794 96.33
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.32
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.29
KOG1036|consensus323 96.27
KOG0305|consensus484 96.27
KOG0281|consensus499 96.24
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.16
KOG0294|consensus362 95.98
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.95
KOG0316|consensus307 95.9
PTZ00420 568 coronin; Provisional 95.89
KOG0646|consensus476 95.53
KOG0266|consensus456 95.53
KOG2055|consensus514 95.49
KOG0649|consensus325 95.47
KOG0284|consensus464 95.32
KOG0291|consensus 893 95.14
KOG1274|consensus 933 95.1
KOG0266|consensus456 94.99
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.99
PRK11028330 6-phosphogluconolactonase; Provisional 94.93
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.85
KOG0271|consensus480 94.8
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.66
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.42
KOG0306|consensus 888 94.37
KOG0276|consensus 794 94.35
KOG0310|consensus487 94.31
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 94.31
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 94.27
COG1520370 FOG: WD40-like repeat [Function unknown] 94.25
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.23
PLN00181793 protein SPA1-RELATED; Provisional 94.22
KOG2096|consensus420 94.05
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 93.98
KOG1446|consensus311 93.9
PTZ00420 568 coronin; Provisional 93.88
KOG3881|consensus412 93.87
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 93.6
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.57
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 93.4
KOG3881|consensus412 93.08
KOG0308|consensus 735 93.05
KOG0286|consensus343 92.96
KOG0315|consensus311 92.9
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.89
KOG2048|consensus691 92.85
KOG0278|consensus334 92.83
KOG0295|consensus406 92.58
KOG0281|consensus499 92.53
KOG2695|consensus425 92.42
KOG0294|consensus362 92.04
KOG0318|consensus603 92.02
KOG2106|consensus626 91.94
KOG0263|consensus707 91.72
KOG0277|consensus311 91.62
KOG0643|consensus327 91.56
KOG1274|consensus 933 91.46
KOG4499|consensus310 91.44
PRK11028330 6-phosphogluconolactonase; Provisional 91.29
PTZ00421493 coronin; Provisional 91.28
KOG0647|consensus347 91.16
KOG2444|consensus238 91.13
KOG0318|consensus 603 91.08
KOG0271|consensus480 90.96
KOG2048|consensus 691 90.86
COG3292 671 Predicted periplasmic ligand-binding sensor domain 90.55
KOG0285|consensus460 90.48
KOG0295|consensus406 90.43
KOG0279|consensus315 90.23
KOG0275|consensus508 90.18
KOG0289|consensus506 90.13
KOG2106|consensus626 89.98
KOG0319|consensus 775 89.68
KOG1408|consensus 1080 89.67
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.62
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 89.56
KOG2111|consensus346 89.4
KOG1188|consensus376 89.26
KOG0283|consensus712 89.22
KOG0313|consensus423 88.81
KOG0310|consensus487 88.65
KOG0273|consensus524 88.65
KOG0289|consensus506 88.62
KOG2110|consensus391 88.55
KOG0282|consensus503 87.82
KOG2096|consensus420 87.48
KOG0305|consensus484 87.09
PF09910339 DUF2139: Uncharacterized protein conserved in arch 86.95
COG3292 671 Predicted periplasmic ligand-binding sensor domain 86.84
KOG0296|consensus399 86.74
KOG0285|consensus460 86.58
KOG1539|consensus 910 86.38
KOG1645|consensus463 86.37
KOG1273|consensus405 86.17
KOG0973|consensus 942 85.98
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 85.45
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 85.04
KOG0645|consensus312 85.02
KOG0268|consensus433 84.94
KOG0284|consensus464 84.89
KOG1445|consensus1012 84.19
KOG4649|consensus354 84.15
KOG4547|consensus 541 83.8
KOG0265|consensus338 83.73
KOG1273|consensus 405 83.45
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 83.06
KOG2445|consensus361 82.72
KOG0639|consensus705 82.55
KOG4378|consensus 673 82.01
KOG0299|consensus479 81.39
KOG1034|consensus385 81.06
KOG0273|consensus524 81.01
KOG0278|consensus334 80.62
KOG2321|consensus 703 80.22
KOG0319|consensus775 80.12
>KOG3522|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-38  Score=330.30  Aligned_cols=284  Identities=26%  Similarity=0.415  Sum_probs=208.4

Q ss_pred             CceeeeEEeCCeEEEEecCCcEEEEEcCCCCCCCCCCCeEEEcCCCCCceeeeeeeCCEEEEEECCeEEEEcCCCC---c
Q psy2153          16 DTALPPVHVQGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYNKVWCGYKNKIHVVDPKSL---K   92 (325)
Q Consensus        16 dsVl~I~~~~~~VfVgLANGtLaVF~R~~~g~WD~~~~~~I~LG~~~~PV~cml~v~~~LW~g~gnkI~VIn~~Tl---k   92 (325)
                      .+|.++.+..+.+++||-||++++|.|..+|.||.++++.+.+|.  .||+.++..+|.+|++++++|+||+..|+   +
T Consensus       582 ~~v~~l~~ss~Slgagl~dgt~a~y~rap~gSwd~ep~~~~~~g~--lPvrsla~~ed~~was~gG~V~vi~~tt~~~~~  659 (925)
T KOG3522|consen  582 ESVKLLLFSSGSLGAGLIDGTLAVYGRAPSGSWDGEPNISIPTGS--LPVRSLAFQEDFVWASEGGCVHVIPSTTFIRSW  659 (925)
T ss_pred             hhhhhhhccccccccCccCCccccccCCCCCCCCCCCccccccCC--ccccchhhhhceeeeecCCceEEEechhccccc
Confidence            589999999999999999999999999999999999889999998  99999999999999999999999999999   7


Q ss_pred             eeEecCCCCCceeEEEEeCCeEEEEEeCCCeEEEEecCccceeeeeecchhhhhhcccc------cccccceeecccc-c
Q psy2153          93 SFDAHPRRESQVRQMTWAGDGVWVSIRLDSTLRMYNAHTYQHLQDVDIEPYVSKMLGMY------TFCSCVTIRTLLA-E  165 (325)
Q Consensus        93 sf~~~~~~~~~V~~Ma~~G~GVWiS~~~ss~IrL~ha~T~e~LqdIdIa~~v~~~l~~~------~~~~~~~~~~~~~-~  165 (325)
                      +.++|.+....|+||++.|.|||+||.++.++|+||++|++|+|||||++.|+.+++..      ...-|.++-.|+- +
T Consensus       660 ~leahqee~~~Vthm~~~~~gVwvafasG~~~rlfhtetl~hlqd~niaT~vt~~lP~~kllsv~~rl~c~gl~~V~~~~  739 (925)
T KOG3522|consen  660 DLEAHQEEAHSVTHMLYLDNGVWVAFASGDEERLFHTETLWHLQDSNIATSVTVDLPFGKLLSVPGRLWCQGLLMVLTSL  739 (925)
T ss_pred             hhHHHHhhcceEEEEEeeCCceEEEEcCCCEEEEecccccCCccccccCcceeecCCCcccccCCCcccccceeEEeccc
Confidence            88999999999999999999999999999999999999999999999999998888763      3444654432221 1


Q ss_pred             cccccCccccCCCcccc----ccccccccceeeeecc----------------CCCC-C--------CCcceeEEEEEEe
Q psy2153         166 TIISPFGWYANNPADIL----ESFTVCQSHLLCIASV----------------PGTG-K--------LGFSFVRITALLI  216 (325)
Q Consensus       166 ~~~~~~~~~~~~p~~~~----~~f~~~~~~~~ci~~v----------------p~~~-~--------~~~~~~riTsLl~  216 (325)
                      +.--.++....+.-+.+    .++...+.-++=|+++                |+.. +        -...|+|+|||+.
T Consensus       740 ~l~v~~~v~~~q~~k~~~~~~vS~~~~~~~vk~~~~~~~~H~~~~~~~~e~~~~~p~~~~~~~~Dai~~~~~~~~~s~~~  819 (925)
T KOG3522|consen  740 TLLVALPVPRLQDSKVTGRMMVSYHAVWSPVKFSAHATALHEKTKDKSREVLAPPPVPQMLDQKDAIIKAACLRSTSLLD  819 (925)
T ss_pred             eeEEEeeeeeccCCceeeeeeeecccccccchhhhhhhhhccchHhhhhhccCCCCCchhhhccchhhhchhhhhccccC
Confidence            11111111222211111    1111112222222221                2221 0        0125899999999


Q ss_pred             eCCeeeEeCCCCccccceeeeecCCccccCCCccccccccccceeeccccCCceeEEEeecCCCCCCCCCCCCCCCCccc
Q psy2153         217 SSSRLWIGTASGKAPSGVRVFSEPATSVITPGTFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGLSAATSVPQDCPVIE  296 (325)
Q Consensus       217 ~~~~LWiGTs~G~~~~~~~~~~~p~~~~~t~~~~~p~~~~~~~~~s~hgH~g~V~Fl~~v~~~~~~~~~~~~~~~~~~~~  296 (325)
                      |+.++|+|||+|++      .+.|..+  |              .+-+||+|||||++.+......-+....|-.-.+..
T Consensus       820 ~~~~iW~G~S~G~~------~~~~~~~--t--------------~~g~~~~~H~~~~~~~~~~~~~~~~~~~p~s~rS~~  877 (925)
T KOG3522|consen  820 CDALIWLGTSAGVM------LTKPDLS--T--------------GSGSGHTGHVRFLLEVRSEGTIYDLLKDPVSLRSKA  877 (925)
T ss_pred             chhheeecccccee------eeccCCC--C--------------CCCCccccceeeeEeeecCceehhcCCCcccccchh
Confidence            99999999999994      3334211  1              235999999999999998732211111111111333


Q ss_pred             CCCCCCCCCcEEEEEcCCcccccccCC
Q psy2153         297 NVSGTEKPPSMLVMSGGEGYIDFRIAR  323 (325)
Q Consensus       297 ~~~~~~~~~~~lv~SgGeGy~dfr~~~  323 (325)
                      ++.+....+++|||||||||||||.++
T Consensus       878 ~r~~k~~~~~~Lvi~GG~G~~~~~~s~  904 (925)
T KOG3522|consen  878 HRAKKAKASSALVISGGDGYEDFRKSG  904 (925)
T ss_pred             hccccccCCceEEEeCCcchHHHHhcC
Confidence            334456788999999999999999764

>KOG3522|consensus Back     alignment and domain information
>KOG2077|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query325
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.75
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.43
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.43
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.39
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.31
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.29
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.27
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.26
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.25
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.23
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.22
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.22
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.19
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.15
3jrp_A379 Fusion protein of protein transport protein SEC13 98.13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.12
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.1
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.09
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.07
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.06
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.06
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.02
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.02
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.01
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.0
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.99
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.98
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.98
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.96
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.93
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.92
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.91
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.9
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.88
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.86
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.86
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.86
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.86
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.86
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.84
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.81
3jrp_A379 Fusion protein of protein transport protein SEC13 97.8
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.8
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.8
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.79
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.78
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.78
3ott_A 758 Two-component system sensor histidine kinase; beta 97.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.78
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.77
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.76
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.74
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.73
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.73
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.71
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.69
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.68
3jro_A 753 Fusion protein of protein transport protein SEC13 97.68
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.65
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.65
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.63
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.6
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.6
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.58
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.57
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.57
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.56
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.54
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.53
3ott_A 758 Two-component system sensor histidine kinase; beta 97.52
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.51
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.51
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.5
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.49
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.49
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.47
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.46
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.46
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.46
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.44
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.44
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.44
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.42
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.42
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.41
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.4
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.4
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.4
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.4
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.37
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.35
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.34
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.34
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.33
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.33
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.33
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.32
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.31
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.31
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.31
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.3
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.27
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 97.26
3jro_A 753 Fusion protein of protein transport protein SEC13 97.26
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.25
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.23
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.23
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.22
2pm7_B297 Protein transport protein SEC13, protein transport 97.22
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.2
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.2
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.13
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.12
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.12
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.99
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.9
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.85
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.84
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.81
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.72
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.69
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.68
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 96.66
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.66
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.66
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.64
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.62
2pm7_B297 Protein transport protein SEC13, protein transport 96.59
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.57
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.55
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.55
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.54
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.51
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.5
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.48
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.48
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.47
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 96.46
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.44
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.3
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.28
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.27
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.23
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.21
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.19
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.06
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 96.01
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.99
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.94
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.92
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.76
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.73
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.63
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 95.57
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.56
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 95.54
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 95.51
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.46
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 95.42
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 95.39
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.37
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.33
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.31
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.3
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.98
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.92
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 94.9
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.89
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.86
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 94.73
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.7
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.35
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.23
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.23
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 93.94
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 93.88
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 93.83
2qe8_A343 Uncharacterized protein; structural genomics, join 93.8
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 93.7
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 93.52
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.49
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 93.41
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 93.3
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 93.26
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.18
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.09
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 92.96
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.79
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.43
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 92.38
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.38
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.26
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 92.23
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 91.72
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 91.38
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.28
2fp8_A322 Strictosidine synthase; six bladed beta propeller 90.79
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 90.62
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 90.33
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 89.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 89.93
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 89.83
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 89.79
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 89.79
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.39
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.27
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 89.11
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 89.09
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 88.89
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 88.72
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 88.61
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 88.54
2ece_A462 462AA long hypothetical selenium-binding protein; 88.3
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 88.16
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.95
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 87.51
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 86.86
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 86.12
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 85.66
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 83.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 83.18
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 82.61
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 82.58
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 81.89
2fp8_A322 Strictosidine synthase; six bladed beta propeller 81.55
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=98.75  E-value=2.6e-06  Score=79.71  Aligned_cols=125  Identities=15%  Similarity=0.192  Sum_probs=90.2

Q ss_pred             eeCCCceeeeEEe-CCeEEEEecCCcEEEEEcCCCCCCCCCCCeEEEcCCCCCceeeeeeeC--CEEEEEECCe-EEEEc
Q psy2153          12 NKILDTALPPVHV-QGRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVY--NKVWCGYKNK-IHVVD   87 (325)
Q Consensus        12 IkL~dsVl~I~~~-~~~VfVgLANGtLaVF~R~~~g~WD~~~~~~I~LG~~~~PV~cml~v~--~~LW~g~gnk-I~VIn   87 (325)
                      +.-.+.|.++.+. ++++++|-.||+|.||+-..+..  +...+....|. ..+|+|+....  ..|-.|+.+. |.+.|
T Consensus        79 ~~~~~~v~~~~~s~d~~l~~~s~dg~v~lWd~~~~~~--~~~~~~~~~~H-~~~V~~v~~spdg~~l~sgs~d~~i~iwd  155 (344)
T 4gqb_B           79 VQTEAGVADLTWVGERGILVASDSGAVELWELDENET--LIVSKFCKYEH-DDIVSTVSVLSSGTQAVSGSKDICIKVWD  155 (344)
T ss_dssp             EEESSCEEEEEEETTTEEEEEETTSEEEEEEECTTSS--CEEEEEEEECC-SSCEEEEEECTTSSEEEEEETTSCEEEEE
T ss_pred             eccCCCEEEEEEeCCCeEEEEECCCEEEEEeccCCCc--eeEeeccccCC-CCCEEEEEECCCCCEEEEEeCCCeEEEEE
Confidence            3345789999986 57899999999999998544321  11111122243 47899998774  4677777754 99999


Q ss_pred             CCCC---ceeEecCCCCCceeEEEEeCC--eEEEEEeCCCeEEEEecCccceeeeeecch
Q psy2153          88 PKSL---KSFDAHPRRESQVRQMTWAGD--GVWVSIRLDSTLRMYNAHTYQHLQDVDIEP  142 (325)
Q Consensus        88 ~~Tl---ksf~~~~~~~~~V~~Ma~~G~--GVWiS~~~ss~IrL~ha~T~e~LqdIdIa~  142 (325)
                      .++.   +.|..|.   ..|++++.+..  .+.++...+.+|++||..+.+.+..+....
T Consensus       156 ~~~~~~~~~~~~h~---~~V~~~~~~~~~~~~l~s~s~D~~v~iwd~~~~~~~~~~~~~~  212 (344)
T 4gqb_B          156 LAQQVVLSSYRAHA---AQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSA  212 (344)
T ss_dssp             TTTTEEEEEECCCS---SCEEEEEECSSCTTEEEEEETTSCEEEEETTSSSCEEECC---
T ss_pred             CCCCcEEEEEcCcC---CceEEEEecCCCCCceeeeccccccccccccccceeeeeecce
Confidence            9988   4555555   78999998744  589999999999999999999988876543
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query325
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.07
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.99
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.9
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.83
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.79
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.72
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.67
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.64
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.54
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.47
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.47
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.45
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.37
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.3
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.18
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.18
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.17
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.08
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.06
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.99
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.98
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.92
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.89
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.8
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.76
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.68
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 95.78
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.74
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.47
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.47
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.33
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.32
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 94.99
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 94.83
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 94.78
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 94.56
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.98
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.6
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.53
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.21
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.09
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 92.38
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 91.39
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 89.25
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 89.17
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 89.07
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 86.35
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 85.38
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 85.2
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.94
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 82.52
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=98.07  E-value=0.0005  Score=60.25  Aligned_cols=116  Identities=9%  Similarity=0.041  Sum_probs=79.1

Q ss_pred             CCceeeeEEeC--CeEEEEecCCcEEEEEcCCCCCCCCCCCeEEEcCCCCCceeeeeeeCC--EEEEEECCe---EEEEc
Q psy2153          15 LDTALPPVHVQ--GRVVCALADGSVAIFRRGPDGQWDLSKYHTVTLGLPHHSVRSLAAVYN--KVWCGYKNK---IHVVD   87 (325)
Q Consensus        15 ~dsVl~I~~~~--~~VfVgLANGtLaVF~R~~~g~WD~~~~~~I~LG~~~~PV~cml~v~~--~LW~g~gnk---I~VIn   87 (325)
                      ++.|+|+.+..  +++..|-.||+|.||+......     .....+.....||.+|..-.+  .+-+++.++   +.|.+
T Consensus        58 ~~~v~~~~~sp~g~~latg~~dg~i~iwd~~~~~~-----~~~~~~~~~~~~v~~v~~s~d~~~l~~~~~~~~~~~~v~~  132 (311)
T d1nr0a1          58 SHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTH-----ILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFL  132 (311)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSEEEEEESSSTTC-----CEEEEEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEE
T ss_pred             CCCEEEEEEeCCCCeEeccccCceEeeeeeecccc-----ccccccccccCccccccccccccccccccccccccccccc
Confidence            57999999863  4677788999999998654321     112223222479999987753  344454332   66777


Q ss_pred             CCCC---ceeEecCCCCCceeEEEEeC--CeEEEEEeCCCeEEEEecCccceeeee
Q psy2153          88 PKSL---KSFDAHPRRESQVRQMTWAG--DGVWVSIRLDSTLRMYNAHTYQHLQDV  138 (325)
Q Consensus        88 ~~Tl---ksf~~~~~~~~~V~~Ma~~G--~GVWiS~~~ss~IrL~ha~T~e~LqdI  138 (325)
                      .++.   +.+..|.   ..|++++...  ..+.++...+.+|++||..+.+.+..+
T Consensus       133 ~~~~~~~~~l~~h~---~~v~~v~~~~~~~~~l~sgs~d~~i~i~d~~~~~~~~~~  185 (311)
T d1nr0a1         133 FDTGTSNGNLTGQA---RAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPFKFKSTF  185 (311)
T ss_dssp             TTTCCBCBCCCCCS---SCEEEEEECSSSSCEEEEEETTSCEEEEETTTBEEEEEE
T ss_pred             cccccccccccccc---cccccccccccceeeeccccccccccccccccccccccc
Confidence            6665   4555554   6799998864  446778889999999999988766543
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure