Psyllid ID: psy2184

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSGGGTRSVSDTDDMQEEK
cccEEEEccccccccHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccHHHcHHccccccccccHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccc
ccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHcHHHHHHHcccHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccEEccccccccccc
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNeastnivdtkgssplhlaawTGNVDIVRVLLchgpsvpnvnlmtkdneTALHcaaqyghtpvvsqllehscdptirnsrhETALDLAAQYGRLETVDTLVRTHPGLIQAYNAraqstlfpasplhlasrnghslrrgpganvqdssgysalHHAALNGHKEIVELLLTNeastnivdtkgssplhlaawTGNVDIVRVLLchgpsvpnvnlmtkdneTALHcaaqyghtpvvsqllehscdptirnsrhETALDLAAQYGRLETVDTLVRTHPGLIQAYNAraqstlfpasplhlasrnGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHgadlriidskHNTVLDLlkqfpphavhdistiinPVMSYEFLvsgggtrsvsdtddmqeek
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKIlsqrakrsgpLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSgggtrsvsdtddmqeek
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSGGGTRSVSDTDDMQEEK
****QCVVFSVMGKDQDLLEAARNGNIQVVEKILSQR****GPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLF******************************ALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVS*****************
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSGGGTRSVSD********
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSG****************
****QCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMS**FLVSGGGTRSV**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELQCVVFSVMGKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSGGGTRSVSDTDDMQEEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query459 2.2.26 [Sep-21-2011]
P0C6S7 1260 Ankyrin repeat and steril yes N/A 0.516 0.188 0.569 8e-71
Q8BIZ1 1259 Ankyrin repeat and steril yes N/A 0.516 0.188 0.569 9e-71
Q7Z6G8 1248 Ankyrin repeat and steril yes N/A 0.516 0.189 0.569 9e-71
Q92625 1134 Ankyrin repeat and SAM do no N/A 0.544 0.220 0.509 1e-67
P59672 1150 Ankyrin repeat and SAM do no N/A 0.544 0.217 0.472 4e-65
A5PMU4 1280 Ankyrin repeat and steril yes N/A 0.525 0.188 0.520 4e-64
Q8VHK2 1430 Caskin-1 OS=Rattus norveg no N/A 0.477 0.153 0.444 4e-46
Q6P9K8 1431 Caskin-1 OS=Mus musculus no N/A 0.477 0.153 0.440 1e-45
Q8WXD9 1431 Caskin-1 OS=Homo sapiens no N/A 0.464 0.148 0.424 4e-45
Q8WXE0 1202 Caskin-2 OS=Homo sapiens no N/A 0.479 0.183 0.451 7e-45
>sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 Back     alignment and function desciption
 Score =  268 bits (684), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 139/244 (56%), Positives = 173/244 (70%), Gaps = 7/244 (2%)

Query: 188 SLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGN 247
           S+ RGP  N  DSSGY+ALHHAALNGHK+IV  LL  EASTN+ D KG  P+HLAAW G+
Sbjct: 45  SIWRGPNVNCTDSSGYTALHHAALNGHKDIVLKLLQFEASTNVADNKGYFPIHLAAWKGD 104

Query: 248 VDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETA 307
           V+IV++L+ HGPS   VN    +NETALHCAAQYGH+ VV+ LLE   DPTIRNS+ ET 
Sbjct: 105 VEIVKILIHHGPSHSRVNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETP 164

Query: 308 LDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAG 367
           LDLAA YGRL  V  ++  HP L+   N R        +PLHLA+RNGH++VV  LL+AG
Sbjct: 165 LDLAALYGRLRVVKMIISAHPNLMSC-NTRKH------TPLHLAARNGHKAVVQVLLEAG 217

Query: 368 LDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDI 427
           +DV+ +T  G+ALHEAAL GK++VV+ LLE G D  I DS   TVLD+LK+ P      I
Sbjct: 218 MDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQI 277

Query: 428 STII 431
           +T++
Sbjct: 278 ATLL 281
Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.
Rattus norvegicus (taxid: 10116)
>sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 Back     alignment and function description
>sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 Back     alignment and function description
>sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 Back     alignment and function description
>sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 Back     alignment and function description
>sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 Back     alignment and function description
>sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
242006161 845 hspc200, putative [Pediculus humanus cor 0.566 0.307 0.731 1e-107
307189167 808 Ankyrin repeat and sterile alpha motif d 0.546 0.310 0.707 1e-101
307211178 812 Ankyrin repeat and sterile alpha motif d 0.546 0.309 0.707 1e-101
345496365 797 PREDICTED: hypothetical protein LOC10011 0.527 0.303 0.718 1e-100
328785617 1480 PREDICTED: ankyrin repeat and SAM domain 0.546 0.169 0.707 1e-100
350414680 1476 PREDICTED: hypothetical protein LOC10074 0.546 0.170 0.707 1e-100
340715058 1476 PREDICTED: hypothetical protein LOC10064 0.546 0.170 0.707 1e-100
380020054 1479 PREDICTED: ankyrin repeat and SAM domain 0.546 0.169 0.707 1e-100
383859931 1477 PREDICTED: uncharacterized protein LOC10 0.546 0.169 0.703 2e-99
189236470 1299 PREDICTED: similar to CG4393 CG4393-PA [ 0.516 0.182 0.737 3e-94
>gi|242006161|ref|XP_002423923.1| hspc200, putative [Pediculus humanus corporis] gi|212507186|gb|EEB11185.1| hspc200, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/264 (73%), Positives = 224/264 (84%), Gaps = 4/264 (1%)

Query: 187 HSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTG 246
           +SLRRGPGANVQD+SGYSALHHAALNGH++IVELLLT+EASTNI+D KGSSPLHLAAW G
Sbjct: 3   YSLRRGPGANVQDTSGYSALHHAALNGHQDIVELLLTHEASTNILDAKGSSPLHLAAWAG 62

Query: 247 NVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHET 306
           NVDIVR+LLCHGPSVPNVNL TKD+ETALHCAAQYGHT +V+ LLEHSCDPTIRNSR ET
Sbjct: 63  NVDIVRLLLCHGPSVPNVNLTTKDHETALHCAAQYGHTEIVTLLLEHSCDPTIRNSREET 122

Query: 307 ALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQS-TLFPASPLHLASRNGHRSVVARLLQ 365
           ALDLAAQYGRLETV+ LVRTHP LIQ ++   +S  +FP +PLHLASRNGH+ VV  LL 
Sbjct: 123 ALDLAAQYGRLETVELLVRTHPELIQPFSRSYKSGCVFPHTPLHLASRNGHKLVVEILLS 182

Query: 366 AGLDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVH 425
           +G+DVN++T+ GTALHEAALCGKL+VV+TLL+ G DLR+ D+K NTVLDLL+QFP H   
Sbjct: 183 SGMDVNLKTSGGTALHEAALCGKLDVVRTLLDAGVDLRLKDAKQNTVLDLLRQFPKHVTQ 242

Query: 426 DISTIINP---VMSYEFLVSGGGT 446
           DI TII     V  ++   S GG+
Sbjct: 243 DILTIIKKHQNVQKFDDSDSEGGS 266

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307189167|gb|EFN73615.1| Ankyrin repeat and sterile alpha motif domain-containing protein 1B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307211178|gb|EFN87391.1| Ankyrin repeat and sterile alpha motif domain-containing protein 1B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345496365|ref|XP_001602889.2| PREDICTED: hypothetical protein LOC100119039 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328785617|ref|XP_392417.4| PREDICTED: ankyrin repeat and SAM domain-containing protein 1A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350414680|ref|XP_003490386.1| PREDICTED: hypothetical protein LOC100749056 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715058|ref|XP_003396037.1| PREDICTED: hypothetical protein LOC100649175 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380020054|ref|XP_003693913.1| PREDICTED: ankyrin repeat and SAM domain-containing protein 1A-like [Apis florea] Back     alignment and taxonomy information
>gi|383859931|ref|XP_003705445.1| PREDICTED: uncharacterized protein LOC100883294 [Megachile rotundata] Back     alignment and taxonomy information
>gi|189236470|ref|XP_974604.2| PREDICTED: similar to CG4393 CG4393-PA [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
RGD|1309183 1125 Anks1a "ankyrin repeat and ste 0.546 0.223 0.518 3.7e-70
UNIPROTKB|Q92625 1134 ANKS1A "Ankyrin repeat and SAM 0.527 0.213 0.534 6.6e-70
UNIPROTKB|F1MHL2 1138 ANKS1A "Uncharacterized protei 0.527 0.212 0.530 1.1e-69
UNIPROTKB|F1MPD8259 LOC516896 "Uncharacterized pro 0.516 0.915 0.569 4e-67
UNIPROTKB|Q7Z6G8 1248 ANKS1B "Ankyrin repeat and ste 0.581 0.213 0.530 8.7e-67
MGI|MGI:1924781 1259 Anks1b "ankyrin repeat and ste 0.583 0.212 0.522 1.1e-66
RGD|1565556 1260 Anks1b "ankyrin repeat and ste 0.583 0.212 0.526 1.2e-66
UNIPROTKB|F1NZ05 880 F1NZ05 "Uncharacterized protei 0.518 0.270 0.555 9.4e-66
ZFIN|ZDB-GENE-041210-349 1281 anks1b "ankyrin repeat and ste 0.525 0.188 0.520 3.4e-60
UNIPROTKB|E1C898 1155 ANKS1A "Uncharacterized protei 0.501 0.199 0.422 1.3e-47
RGD|1309183 Anks1a "ankyrin repeat and sterile alpha motif domain containing 1A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 656 (236.0 bits), Expect = 3.7e-70, Sum P(2) = 3.7e-70
 Identities = 138/266 (51%), Positives = 174/266 (65%)

Query:   188 SLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGN 247
             S+ RGP  N  DS+GY+ LHHAALNGH+++VE+LL N+A TN+ D+KG  PLHLAAW G+
Sbjct:    63 SMWRGPNVNCVDSTGYTPLHHAALNGHRDVVEVLLRNDALTNVADSKGCYPLHLAAWKGD 122

Query:   248 VDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETA 307
               IVR+L+  GPS   VN    DNETALHCAAQYGHT VV  LLE   DPT+RN++ ET 
Sbjct:   123 AQIVRLLIHQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKALLEELTDPTMRNNKFETP 182

Query:   308 LDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAG 367
             LDLAA YGRLE V  L+  HP L+   + R  +      PLHLA+RNGH++VV  LL AG
Sbjct:   183 LDLAALYGRLEVVKLLLSAHPNLLSC-STRKHT------PLHLAARNGHKAVVQVLLDAG 235

Query:   368 LDVNIRTASGTALHEAALCGKLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFPPHAVHDI 427
             +D N +T  G+ALHEAAL GK +VV+ LL  G D+ I D++  T LD ++  P      I
Sbjct:   236 MDSNYQTEMGSALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTALDTVRDLPSQKSQQI 295

Query:   428 STIINPVMSYEFLVSGGGTRSVSDTD 453
             + +I   M+        G RSV D D
Sbjct:   296 AALIEDHMT--------GRRSVKDVD 313
GO:0005634 "nucleus" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=IEA;ISO
GO:0006929 "substrate-dependent cell migration" evidence=IEA
GO:0016322 "neuron remodeling" evidence=IEA
GO:0043005 "neuron projection" evidence=IEA
GO:0046875 "ephrin receptor binding" evidence=IEA;ISO
GO:0048013 "ephrin receptor signaling pathway" evidence=IEA
GO:1901187 "regulation of ephrin receptor signaling pathway" evidence=ISO
GO:2000059 "negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=ISO
GO:0005730 "nucleolus" evidence=ISO
UNIPROTKB|Q92625 ANKS1A "Ankyrin repeat and SAM domain-containing protein 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHL2 ANKS1A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPD8 LOC516896 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z6G8 ANKS1B "Ankyrin repeat and sterile alpha motif domain-containing protein 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1924781 Anks1b "ankyrin repeat and sterile alpha motif domain containing 1B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565556 Anks1b "ankyrin repeat and sterile alpha motif domain containing 1B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ05 F1NZ05 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-349 anks1b "ankyrin repeat and sterile alpha motif domain containing 1B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C898 ANKS1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BIZ1ANS1B_MOUSENo assigned EC number0.56960.51630.1882yesN/A
Q7Z6G8ANS1B_HUMANNo assigned EC number0.56960.51630.1899yesN/A
P0C6S7ANS1B_RATNo assigned EC number0.56960.51630.1880yesN/A
A5PMU4ANS1B_DANRENo assigned EC number0.52010.52500.1882yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-37
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-28
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-23
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-21
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-20
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-19
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-17
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-16
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-14
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-13
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-12
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-12
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-12
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-11
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-10
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-07
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-05
PHA02791284 PHA02791, PHA02791, ankyrin-like protein; Provisio 3e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-05
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 6e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 4e-04
smart0024830 smart00248, ANK, ankyrin repeats 4e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 7e-04
smart0024830 smart00248, ANK, ankyrin repeats 8e-04
smart0024830 smart00248, ANK, ankyrin repeats 8e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.002
PHA02716 764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 0.002
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.002
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.003
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 0.003
PHA02917661 PHA02917, PHA02917, ankyrin-like protein; Provisio 0.003
PHA02917661 PHA02917, PHA02917, ankyrin-like protein; Provisio 0.003
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.004
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score =  131 bits (332), Expect = 5e-37
 Identities = 59/129 (45%), Positives = 76/129 (58%), Gaps = 3/129 (2%)

Query: 196 NVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLL 255
           N +D  G + LH AA NGH E+V+LLL N A  N  D  G +PLHLAA  G+++IV++LL
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 256 CHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYG 315
             G    +VN   KD  T LH AA+ G+  VV  LL+H  D   R+    T L LAA+ G
Sbjct: 61  EKG---ADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNG 117

Query: 316 RLETVDTLV 324
            LE V  L+
Sbjct: 118 HLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 459
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0508|consensus 615 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG4412|consensus226 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508|consensus 615 100.0
KOG0509|consensus 600 100.0
KOG0509|consensus 600 99.98
PHA02795437 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG0507|consensus 854 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
KOG4369|consensus 2131 99.95
KOG0502|consensus296 99.94
KOG0507|consensus 854 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
KOG4369|consensus 2131 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG0502|consensus296 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
KOG0505|consensus 527 99.91
KOG0505|consensus 527 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0514|consensus452 99.86
KOG0514|consensus452 99.86
KOG0512|consensus228 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.82
KOG0512|consensus228 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
KOG3676|consensus 782 99.77
KOG0195|consensus448 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
KOG3676|consensus 782 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
KOG0195|consensus 448 99.67
KOG4214|consensus117 99.66
KOG4214|consensus117 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
KOG1710|consensus396 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.44
KOG0515|consensus752 99.42
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.41
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.36
KOG0515|consensus752 99.3
KOG1710|consensus 396 99.27
KOG0783|consensus 1267 98.93
KOG0782|consensus1004 98.9
PF1360630 Ank_3: Ankyrin repeat 98.9
PF1360630 Ank_3: Ankyrin repeat 98.85
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
KOG0506|consensus622 98.79
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.76
KOG0818|consensus 669 98.74
KOG0506|consensus622 98.73
KOG0783|consensus 1267 98.69
KOG0818|consensus 669 98.65
KOG0782|consensus1004 98.65
KOG0705|consensus749 98.55
KOG0511|consensus516 98.54
KOG0511|consensus516 98.51
KOG0522|consensus 560 98.41
KOG3609|consensus 822 98.35
KOG3609|consensus 822 98.29
KOG0522|consensus 560 98.26
KOG2384|consensus223 98.23
KOG0705|consensus749 98.11
KOG0521|consensus785 98.04
KOG2384|consensus223 98.01
KOG0521|consensus785 97.99
KOG2505|consensus591 97.72
KOG0520|consensus975 97.6
KOG0520|consensus975 97.53
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.12
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.01
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.01
KOG2505|consensus591 96.87
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.79
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.55
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.19
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 94.16
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.69
PLN03218 1060 maturation of RBCL 1; Provisional 92.63
PLN03218 1060 maturation of RBCL 1; Provisional 88.83
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 82.46
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 81.15
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-51  Score=403.33  Aligned_cols=385  Identities=24%  Similarity=0.280  Sum_probs=323.7

Q ss_pred             cCCCHHHHHHHHcCCHHHHHHHHhhhhhh--------cCccH--------------------------------------
Q psy2184          12 MGKDQDLLEAARNGNIQVVEKILSQRAKR--------SGPLA--------------------------------------   45 (459)
Q Consensus        12 ~~~~~~l~~A~~~g~~~~v~~ll~~~~~~--------~~~~~--------------------------------------   45 (459)
                      ..+.+.||.|+..|+.++|++|+++.+..        .+|++                                      
T Consensus        39 ~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  118 (682)
T PHA02876         39 SIPFTAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHKLD  118 (682)
T ss_pred             cccchHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHHHH
Confidence            34678999999999999999999987641        11111                                      


Q ss_pred             HHHHHHHHh--CCCCCCcC----CCCCCchHHHHHhcCCHHHHHHHHhcCCCCCCCCCCCCCCccHHHHHHHcCCHHHHH
Q psy2184          46 REIVELLLT--NEASTNIV----DTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVS  119 (459)
Q Consensus        46 ~~~~~~l~~--~~~~~~~~----~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~~~t~L~~A~~~~~~~iv~  119 (459)
                      ..++..|.+  .|.+++..    .....++++.|+..|+.+++++|++.|+   +++.+|..|.||||+|+..|+.++++
T Consensus       119 ~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~Ga---dvn~~d~~G~TpLh~Aa~~G~~~iv~  195 (682)
T PHA02876        119 EACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGGA---DVNAKDIYCITPIHYAAERGNAKMVN  195 (682)
T ss_pred             HHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCCC---CCCCCCCCCCCHHHHHHHCCCHHHHH
Confidence            001111111  12222211    2234567888889999999999999999   78888999999999999999999999


Q ss_pred             HHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCchHHHHHhhccCCCCCCChHHHHHHcCCc------cccCC
Q psy2184         120 QLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHS------LRRGP  193 (459)
Q Consensus       120 ~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~  193 (459)
                      +|+++|++++..+..|.||||+|+..++.+++++|++.+.....           ...++..+...+..      +..+.
T Consensus       196 ~LL~~Gad~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~-----------~~~~L~~ai~~~~~~~~~~Ll~~g~  264 (682)
T PHA02876        196 LLLSYGADVNIIALDDLSVLECAVDSKNIDTIKAIIDNRSNINK-----------NDLSLLKAIRNEDLETSLLLYDAGF  264 (682)
T ss_pred             HHHHCCCCcCccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCC-----------CcHHHHHHHHcCCHHHHHHHHHCCC
Confidence            99999999999999999999999999999999999987654311           12344455544443      56788


Q ss_pred             CCccCCCCCccHHHHHHHcCCH-HHHHHHHhCCCCCcccCCCCCcHHHHHHHcC-CHHHHHHHHhCCCCCCCcccccCCC
Q psy2184         194 GANVQDSSGYSALHHAALNGHK-EIVELLLTNEASTNIVDTKGSSPLHLAAWTG-NVDIVRVLLCHGPSVPNVNLMTKDN  271 (459)
Q Consensus       194 ~~~~~~~~~~~~l~~a~~~~~~-~~~~~Ll~~~~~~~~~~~~~~t~L~~a~~~~-~~~~~~~Ll~~~~~~~~~~~~~~~g  271 (459)
                      +++..+..|.||||.|+..++. +++++|++.|++++..+..|.||||+|+..| ..++++.|+..|+   +++..+..|
T Consensus       265 ~vn~~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~d~~g~TpLh~Aa~~g~~~~~v~~Ll~~ga---din~~d~~g  341 (682)
T PHA02876        265 SVNSIDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKNGYDTENIRTLIMLGA---DVNAADRLY  341 (682)
T ss_pred             CCCCCCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHhCCCHHHHHHHHHcCC---CCCCcccCC
Confidence            8889999999999999999986 6999999999999999999999999999999 6999999999998   678889999


Q ss_pred             CCHhhHHHHc-CCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCchHHHhhhhcccCCCCCChhHH
Q psy2184         272 ETALHCAAQY-GHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHL  350 (459)
Q Consensus       272 ~t~L~~a~~~-~~~~~~~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~l~~  350 (459)
                      .||||+|+.. +..++++.|++.|++++.++..|.||||+|+..++.+++++|++.++....       ....|.||||+
T Consensus       342 ~TpLh~A~~~~~~~~iv~lLl~~gadin~~d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad~~~-------~~~~g~T~Lh~  414 (682)
T PHA02876        342 ITPLHQASTLDRNKDIVITLLELGANVNARDYCDKTPIHYAAVRNNVVIINTLLDYGADIEA-------LSQKIGTALHF  414 (682)
T ss_pred             CcHHHHHHHhCCcHHHHHHHHHcCCCCccCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCccc-------cCCCCCchHHH
Confidence            9999999986 478899999999999999999999999999999999999999999887632       23456799999


Q ss_pred             HHhcCc-HHHHHHHHHcCCCCCCCCCCC-CHHHHHHHcC-CHHHHHHHHHCCCCCcccccCCCCHHHHHhcCC
Q psy2184         351 ASRNGH-RSVVARLLQAGLDVNIRTASG-TALHEAALCG-KLEVVKTLLEHGADLRIIDSKHNTVLDLLKQFP  420 (459)
Q Consensus       351 A~~~~~-~~~~~~Ll~~g~~~~~~~~~~-t~L~~A~~~~-~~~i~~~Ll~~ga~~~~~~~~g~t~l~~a~~~~  420 (459)
                      |+..+. ..++++|+++|+++|.++..| ||||+|+..+ +.+++++|+++|++++.+|..|.||+++|.+..
T Consensus       415 A~~~~~~~~~vk~Ll~~gadin~~d~~G~TpLh~Aa~~~~~~~iv~lLl~~Gad~n~~d~~g~tpl~~a~~~~  487 (682)
T PHA02876        415 ALCGTNPYMSVKTLIDRGANVNSKNKDLSTPLHYACKKNCKLDVIEMLLDNGADVNAINIQNQYPLLIALEYH  487 (682)
T ss_pred             HHHcCCHHHHHHHHHhCCCCCCcCCCCCChHHHHHHHhCCcHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHhC
Confidence            987665 567999999999999999999 9999999976 689999999999999999999999999998754

>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 7e-41
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-20
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-23
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-12
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-22
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-17
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-17
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-22
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-16
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-21
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-15
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-20
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-15
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-20
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-15
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 9e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-20
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 6e-16
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-19
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-14
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-19
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-13
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-19
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-15
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-19
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-19
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-19
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-15
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 8e-19
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-15
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-13
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-18
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 5e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-18
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-12
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-12
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 9e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-18
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-13
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-18
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-17
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 9e-13
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-17
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-10
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-10
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-17
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-13
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-17
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-14
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-15
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-15
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-15
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-13
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-08
1uoh_A226 Human Gankyrin Length = 226 3e-14
1uoh_A226 Human Gankyrin Length = 226 1e-11
1uoh_A226 Human Gankyrin Length = 226 3e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-14
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-11
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-14
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-08
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-14
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 8e-14
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 9e-14
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-13
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 9e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-09
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-12
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 4e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-08
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 6e-12
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-11
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 7e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 7e-12
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 7e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 8e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-11
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 8e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-09
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-08
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-10
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-10
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-09
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-10
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-09
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-08
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 9e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-09
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-08
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-09
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-09
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-09
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-07
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-09
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-09
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-09
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-09
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 8e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-09
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 8e-08
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 5e-09
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-09
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 6e-09
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 9e-09
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-08
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-08
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 4e-07
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 4e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 2e-08
3ljn_A 364 Ankyrin Repeat Protein From Leishmania Major Length 2e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 7e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 8e-05
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-08
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 7e-07
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-08
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 8e-07
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-08
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 8e-07
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 4e-08
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 4e-08
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 4e-08
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 8e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 9e-08
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-07
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-07
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-07
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 4e-07
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 4e-06
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-06
1ycs_B239 P53-53bp2 Complex Length = 239 7e-06
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 7e-06
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 2e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 2e-05
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 2e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 8e-05
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 1e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 8e-04
3kea_A285 Structure Function Studies Of Vaccinia Virus Host-R 7e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (416), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 137/414 (33%), Positives = 210/414 (50%), Gaps = 28/414 (6%)
Query: 48  IVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALH 107
           IV+ LL   AS N+ + K  +PLH+AA  G+ ++ + LL    +   VN   KD++T LH
Sbjct: 29  IVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ---NKAKVNAKAKDDQTPLH 85
Query: 108 CAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNA 167
           CAA+ GHT +V  LLE++ +P +  +   T L +AA+ G +ETV         L++   +
Sbjct: 86  CAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETV-------LALLEKEAS 138
Query: 168 RAQSTLFPASPLHLASRNGHS------LRRGPGANVQDSSGYSALHHAALNGHKEIVELL 221
           +A  T    +PLH+A++ G        L R    N    +G + LH A  + + +IV+LL
Sbjct: 139 QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 198
Query: 222 LTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQY 281
           L    S +     G +PLH+AA    V++ R LL +G S    N  +    T LH AAQ 
Sbjct: 199 LPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS---ANAESVQGVTPLHLAAQE 255
Query: 282 GHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQST 341
           GH  +V+ LL    +  + N    T L L AQ G +   D L++ H  ++ A      +T
Sbjct: 256 GHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-HGVMVDA------TT 308
Query: 342 LFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASG-TALHEAALCGKLEVVKTLLEHGA 400
               +PLH+AS  G+  +V  LLQ   DVN +T  G + LH+AA  G  ++V  LL++GA
Sbjct: 309 RMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 368
Query: 401 DLRIIDSKHNTVLDLLKQFPPHAVHDISTIINPVMSYEFLVSGGGTRSVSDTDD 454
               + S   T L + K+    +V D+  ++    S+  LVS     S  +T D
Sbjct: 369 SPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSF-VLVSDKHRMSFPETVD 421
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3KEA|A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-95
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-94
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-83
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-63
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-61
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-91
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-66
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-61
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-73
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-71
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-33
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-72
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-56
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-50
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-33
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-71
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-65
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-60
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-56
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-43
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-70
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-53
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-37
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-63
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-51
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-31
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-65
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-65
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-51
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-64
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-63
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-56
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-64
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-60
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-59
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-56
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-63
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-55
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-52
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-62
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-57
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-55
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-36
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-61
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-55
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-47
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-30
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-61
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-56
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-51
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-47
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-57
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-57
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-52
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-47
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-37
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-23
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-57
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-46
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-45
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-23
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-51
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-48
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-52
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-48
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-48
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-50
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-48
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-42
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-34
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-28
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-48
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-45
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-42
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-38
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-46
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-44
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-32
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-47
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-45
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-40
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-28
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-20
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-46
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-46
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-42
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-39
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-27
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-45
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-43
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-32
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-44
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-43
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-45
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-45
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-32
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-12
2rfa_A232 Transient receptor potential cation channel subfa 1e-44
2rfa_A232 Transient receptor potential cation channel subfa 7e-42
2rfa_A232 Transient receptor potential cation channel subfa 3e-37
2rfa_A232 Transient receptor potential cation channel subfa 1e-32
2rfa_A232 Transient receptor potential cation channel subfa 8e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-43
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-41
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-40
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-22
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-42
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-41
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-39
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-34
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-42
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-41
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-34
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-24
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-41
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-39
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-37
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-31
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-25
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-41
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-40
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-36
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-28
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2etb_A256 Transient receptor potential cation channel subfam 6e-41
2etb_A256 Transient receptor potential cation channel subfam 2e-37
2etb_A256 Transient receptor potential cation channel subfam 7e-36
2etb_A256 Transient receptor potential cation channel subfam 1e-33
2etb_A256 Transient receptor potential cation channel subfam 4e-20
2etb_A256 Transient receptor potential cation channel subfam 7e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-40
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-33
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-33
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-19
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-30
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-29
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-28
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-38
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-36
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-34
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-34
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-34
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-28
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-37
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-34
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-33
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-32
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-09
2pnn_A273 Transient receptor potential cation channel subfa 2e-37
2pnn_A273 Transient receptor potential cation channel subfa 7e-37
2pnn_A273 Transient receptor potential cation channel subfa 8e-37
2pnn_A273 Transient receptor potential cation channel subfa 4e-35
2pnn_A273 Transient receptor potential cation channel subfa 2e-32
2pnn_A273 Transient receptor potential cation channel subfa 2e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-36
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-35
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-31
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-30
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-30
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-27
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-32
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-34
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-27
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-25
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-33
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-31
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-31
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-30
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-30
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-30
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-30
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-24
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-25
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-13
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-10
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  292 bits (751), Expect = 4e-95
 Identities = 121/420 (28%), Positives = 175/420 (41%), Gaps = 65/420 (15%)

Query: 18  LLEAARNGNIQVVEKILSQRAK-----RSG--PL-------AREIVELLLTNEASTNIVD 63
           L  AAR G+ +V + +L  +AK     +    PL          +V+LLL N A+ N+  
Sbjct: 51  LHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLAT 110

Query: 64  TKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLE 123
           T G +PLH+AA  G+V+ V  LL       +   MTK   T LH AA+YG   V   LLE
Sbjct: 111 TAGHTPLHIAAREGHVETVLALLEKEA---SQACMTKKGFTPLHVAAKYGKVRVAELLLE 167

Query: 124 HSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLAS 183
               P        T L +A  +  L+ V  L                             
Sbjct: 168 RDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL----------------------------- 198

Query: 184 RNGHSLRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAA 243
                L RG   +    +GY+ LH AA     E+   LL    S N    +G +PLHLAA
Sbjct: 199 -----LPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA 253

Query: 244 WTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSR 303
             G+ ++V +LL       N NL  K   T LH  AQ GH PV   L++H          
Sbjct: 254 QEGHAEMVALLLSKQA---NGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRM 310

Query: 304 HETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARL 363
             T L +A+ YG ++ V  L++    +    NA+   T    SPLH A++ GH  +V  L
Sbjct: 311 GYTPLHVASHYGNIKLVKFLLQHQADV----NAK---TKLGYSPLHQAAQQGHTDIVTLL 363

Query: 364 LQAGLDVNIRTASG-TALHEAALCGKLEVVKTL---LEHGADLRIIDSKHNTVLDLLKQF 419
           L+ G   N  ++ G T L  A   G + V   L    +  + + + D    +  + + + 
Sbjct: 364 LKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEI 423
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
1gp8_A40 Protein (scaffolding protein); coat protein-bindin 80.5
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.8e-61  Score=455.86  Aligned_cols=381  Identities=34%  Similarity=0.473  Sum_probs=322.4

Q ss_pred             CCCHHHHHHHHcCCHHHHHHHHhhhhhhcCccHHHHHHHHHhCCCCCCcCCCCCCchHHHHHhcCCHHHHHHHHhcCCCC
Q psy2184          13 GKDQDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSV   92 (459)
Q Consensus        13 ~~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~   92 (459)
                      .+.+.|+.|+..|++++|++|++.                   |++++..+..|.||||+|+..|+.+++++|++.|+  
T Consensus        13 ~g~t~L~~Aa~~g~~~~v~~Ll~~-------------------g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~--   71 (437)
T 1n11_A           13 SGLTPLHVASFMGHLPIVKNLLQR-------------------GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA--   71 (437)
T ss_dssp             --CCHHHHHHHHTCHHHHHHHHHT-------------------TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTC--
T ss_pred             CCCCHHHHHHHCCCHHHHHHHHHc-------------------CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCC--
Confidence            467899999999999999999987                   55666666777777777777777777777777776  


Q ss_pred             CCCCCCCCCCccHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCchHHHHHhhccCC
Q psy2184          93 PNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQST  172 (459)
Q Consensus        93 ~~~~~~~~~~~t~L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~  172 (459)
                       +++.++..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|++.+...       ....
T Consensus        72 -~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~-------~~~~  143 (437)
T 1n11_A           72 -KVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQ-------ACMT  143 (437)
T ss_dssp             -CSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCS-------CCCC
T ss_pred             -CCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCC-------cCCC
Confidence             56666677777777777777777777777777777777777777777777777777777777654332       1112


Q ss_pred             CCCCChHHHHHHcCCc------cccCCCCccCCCCCccHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCCcHHHHHHHcC
Q psy2184         173 LFPASPLHLASRNGHS------LRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTG  246 (459)
Q Consensus       173 ~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~L~~a~~~~  246 (459)
                      ....+++++++..++.      ++.+.+++..+..|.||||.|+..++.+++++|++.|.+++..+..|.||||+|+..|
T Consensus       144 ~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~  223 (437)
T 1n11_A          144 KKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQN  223 (437)
T ss_dssp             TTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTT
T ss_pred             CCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcC
Confidence            2345677777666654      5677788889999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHhCCCCCCCcccccCCCCCHhhHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhc
Q psy2184         247 NVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRT  326 (459)
Q Consensus       247 ~~~~~~~Ll~~~~~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~  326 (459)
                      +.+++++|++.+.   +++..+..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|++.
T Consensus       224 ~~~~~~~Ll~~g~---~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~  300 (437)
T 1n11_A          224 QVEVARSLLQYGG---SANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKH  300 (437)
T ss_dssp             CHHHHHHHHHTTC---CTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHcCC---CCCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC
Confidence            9999999999997   5677788999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCchHHHhhhhcccCCCCCChhHHHHhcCcHHHHHHHHHcCCCCCCCCCCC-CHHHHHHHcCCHHHHHHHHHCCCCCccc
Q psy2184         327 HPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASG-TALHEAALCGKLEVVKTLLEHGADLRII  405 (459)
Q Consensus       327 ~~~~~~~~~~~~~~~~~~~~~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~-t~L~~A~~~~~~~i~~~Ll~~ga~~~~~  405 (459)
                      +..+       ...+..|.||||+|+..|+.+++++|+++|+++|.++..| ||||+|+.+++.+++++|+++|++++.+
T Consensus       301 g~~~-------~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~  373 (437)
T 1n11_A          301 GVMV-------DATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEV  373 (437)
T ss_dssp             TCCT-------TCCCSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCC
T ss_pred             CccC-------CCCCCCCCCHHHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCC
Confidence            8765       2345678899999999999999999999999999999999 9999999999999999999999999999


Q ss_pred             ccCCCCHHHHHhcCCCCchhhhhhhhc
Q psy2184         406 DSKHNTVLDLLKQFPPHAVHDISTIIN  432 (459)
Q Consensus       406 ~~~g~t~l~~a~~~~~~~~~~~~~~~~  432 (459)
                      |.+|.||+++|.+.+...+.+++..+.
T Consensus       374 ~~~g~t~l~~A~~~g~~~~~~~l~~~~  400 (437)
T 1n11_A          374 SSDGTTPLAIAKRLGYISVTDVLKVVT  400 (437)
T ss_dssp             CSSSCCHHHHHHHTTCHHHHHHHHHHC
T ss_pred             CCCCCCHHHHHHHcCcHHHHHHHHhcc
Confidence            999999999999999877666665543
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1gp8_A Protein (scaffolding protein); coat protein-binding domain, helix- loop-helix motif, viral protein; NMR {Enterobacteria phage P22} SCOP: j.58.1.1 PDB: 2gp8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 459
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-62
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-45
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-44
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-38
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-33
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-36
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-27
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-24
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-33
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-32
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-31
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-32
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-28
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-25
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-23
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-21
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-28
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-26
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-25
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-26
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-26
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-25
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-23
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-20
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-23
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-21
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-06
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-21
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-19
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-19
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-16
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-19
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-18
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-18
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-13
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-12
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-11
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 6e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 8e-06
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 9e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  204 bits (519), Expect = 8e-62
 Identities = 101/384 (26%), Positives = 155/384 (40%), Gaps = 48/384 (12%)

Query: 69  PLHLAAWTGNVDIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDP 128
           PLH+A++ G++ IV+ LL  G    + N+     ET LH AA+ GHT V   LL++    
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGA---SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV 59

Query: 129 TIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHS 188
             +    +T L  AA+ G    V  L+  +            + L  A+           
Sbjct: 60  NAKAKDDQTPLHCAARIGHTNMVKLLLE-NNANPNLATTAGHTPLHIAAREGHVETVLAL 118

Query: 189 LRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNV 248
           L +          G++ LH AA  G   + ELLL  +A  N     G +PLH+A    N+
Sbjct: 119 LEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNL 178

Query: 249 DIVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETAL 308
           DIV++LL  G    + +    +  T LH AA+     V   LL++       + +  T L
Sbjct: 179 DIVKLLLPRG---GSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPL 235

Query: 309 DLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGL 368
            LAAQ G  E V  L+           +         +PLHL ++ GH  V   L++ G+
Sbjct: 236 HLAAQEGHAEMVALLLSKQANGNLGNKSG-------LTPLHLVAQEGHVPVADVLIKHGV 288

Query: 369 DVNIRTASG----------------------------------TALHEAALCGKLEVVKT 394
            V+  T  G                                  + LH+AA  G  ++V  
Sbjct: 289 MVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTL 348

Query: 395 LLEHGADLRIIDSKHNTVLDLLKQ 418
           LL++GA    + S   T L + K+
Sbjct: 349 LLKNGASPNEVSSDGTTPLAIAKR 372
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.1e-51  Score=378.89  Aligned_cols=377  Identities=34%  Similarity=0.479  Sum_probs=314.7

Q ss_pred             HHHHHHHHcCCHHHHHHHHhhhhhhcCccHHHHHHHHHhCCCCCCcCCCCCCchHHHHHhcCCHHHHHHHHhcCCCCCCC
Q psy2184          16 QDLLEAARNGNIQVVEKILSQRAKRSGPLAREIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVDIVRVLLCHGPSVPNV   95 (459)
Q Consensus        16 ~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~   95 (459)
                      +.||.||..|++++|++|++.                   |+++|..|..|.||||+||..|+.+++++|+++|+   ++
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~-------------------g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~ga---di   59 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQR-------------------GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA---KV   59 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHT-------------------TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTC---CS
T ss_pred             ChHHHHHHCcCHHHHHHHHHC-------------------CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcC---CC
Confidence            689999999999999999976                   78899999999999999999999999999999999   78


Q ss_pred             CCCCCCCccHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCchHHHHHhhccCCCCC
Q psy2184          96 NLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFP  175 (459)
Q Consensus        96 ~~~~~~~~t~L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  175 (459)
                      +..+..|.|||++|+..|+.+++++|+..+.++........+++..+...+...............       .......
T Consensus        60 ~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~  132 (408)
T d1n11a_          60 NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQ-------ACMTKKG  132 (408)
T ss_dssp             SCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCS-------CCCCTTS
T ss_pred             CCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccc-------ccccccc
Confidence            889999999999999999999999999887776554444444444444444433333332221110       0001112


Q ss_pred             CChHHHHHHcCCc------cccCCCCccCCCCCccHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCCcHHHHHHHcCCHH
Q psy2184         176 ASPLHLASRNGHS------LRRGPGANVQDSSGYSALHHAALNGHKEIVELLLTNEASTNIVDTKGSSPLHLAAWTGNVD  249 (459)
Q Consensus       176 ~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~L~~a~~~~~~~  249 (459)
                      ..++..+...++.      +..+.+++..+..|.+||+.|+..++.+++++|+.+|++++..+..+.||++.++.....+
T Consensus       133 ~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~  212 (408)
T d1n11a_         133 FTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVE  212 (408)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHH
T ss_pred             chHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhh
Confidence            2233333333221      3456667888889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCCCCCcccccCCCCCHhhHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCc
Q psy2184         250 IVRVLLCHGPSVPNVNLMTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPG  329 (459)
Q Consensus       250 ~~~~Ll~~~~~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~  329 (459)
                      ....++....   .....+..+.||+++|+..+..++++++.+.+...+..+..|.+|++.++..++.+++++|++.+..
T Consensus       213 ~~~~l~~~~~---~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~  289 (408)
T d1n11a_         213 VARSLLQYGG---SANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM  289 (408)
T ss_dssp             HHHHHHHTTC---CTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC
T ss_pred             hhhhhhhccc---cccccCCCCCCHHHHHHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCc
Confidence            9999998886   4555677899999999999999999999999999999999999999999999999999999998876


Q ss_pred             hHHHhhhhcccCCCCCChhHHHHhcCcHHHHHHHHHcCCCCCCCCCCC-CHHHHHHHcCCHHHHHHHHHCCCCCcccccC
Q psy2184         330 LIQAYNARAQSTLFPASPLHLASRNGHRSVVARLLQAGLDVNIRTASG-TALHEAALCGKLEVVKTLLEHGADLRIIDSK  408 (459)
Q Consensus       330 ~~~~~~~~~~~~~~~~~~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~-t~L~~A~~~~~~~i~~~Ll~~ga~~~~~~~~  408 (459)
                      ..       .....+.|||+.++..+..++++++++.|+++|.++..| ||||+|+++|+.++|++|+++|||++.+|.+
T Consensus       290 ~~-------~~~~~~~t~L~~~~~~~~~~~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~  362 (408)
T d1n11a_         290 VD-------ATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSD  362 (408)
T ss_dssp             TT-------CCCSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSS
T ss_pred             cc-------cccccccccchhhcccCcceeeeeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCC
Confidence            42       233456799999999999999999999999999999999 9999999999999999999999999999999


Q ss_pred             CCCHHHHHhcCCCCchhhhhhhh
Q psy2184         409 HNTVLDLLKQFPPHAVHDISTII  431 (459)
Q Consensus       409 g~t~l~~a~~~~~~~~~~~~~~~  431 (459)
                      |+||||+|++.+...+.+++.++
T Consensus       363 G~t~L~~A~~~~~~~iv~~L~~~  385 (408)
T d1n11a_         363 GTTPLAIAKRLGYISVTDVLKVV  385 (408)
T ss_dssp             SCCHHHHHHHTTCHHHHHHHHHH
T ss_pred             CCCHHHHHHHcCCHHHHHHHHHH
Confidence            99999999999887655555444
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure