Psyllid ID: psy229


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MHGIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYFP
cccEEEEEcccccccccccccccccccHHHcccccHHHHHHccccHHHHHHHccccHHHHHHHHHccHHHHHcccccccHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccc
ccEEEEEEcccccccccccccccccEEEcccccccHHHHHccccccccccccccccHHHHHHHHHccHHHHcccccccEEEHccccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccHccccccc
mhgivlwrspawtdKFELINEHISNLItwqdtrcdhayltslprpdshlraytGYGINTLLWymqhepqtvLQYTHAATIQVAKGDKELVLSILAAGAAlelkdgdgntplhiaaqnNSVSVTQALLGfgaevnvsqipyfp
mhgivlwrspawtDKFELINEHISNLITWQDTRCDHAYLtslprpdshlRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAevnvsqipyfp
MHGIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYFP
**GIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQI****
MHGIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYFP
MHGIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYFP
MHGIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYFP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGIVLWRSPAWTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
Q9D5J6 476 Sedoheptulokinase OS=Mus yes N/A 0.570 0.170 0.402 4e-15
Q9UHJ6 478 Sedoheptulokinase OS=Homo yes N/A 0.549 0.163 0.397 2e-13
Q9J516 434 Putative ankyrin repeat p N/A N/A 0.352 0.115 0.4 3e-05
Q6AFL2 254 Putative ankyrin-containi yes N/A 0.359 0.200 0.509 6e-05
Q8VBX0 278 Ankyrin repeat and SOCS b no N/A 0.394 0.201 0.406 0.0002
Q8WXK3 278 Ankyrin repeat and SOCS b no N/A 0.394 0.201 0.406 0.0002
Q9J5I7 437 Putative ankyrin repeat p N/A N/A 0.387 0.125 0.363 0.0003
Q6B858345 Fibronectin type 3 and an no N/A 0.450 0.185 0.343 0.0004
A6QPE7 395 Ankyrin repeat domain-con no N/A 0.366 0.131 0.433 0.0004
Q54KA7 986 Ankyrin repeat, PH and SE no N/A 0.612 0.088 0.303 0.0005
>sp|Q9D5J6|SHPK_MOUSE Sedoheptulokinase OS=Mus musculus GN=Shpk PE=1 SV=1 Back     alignment and function desciption
 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (60%), Gaps = 6/87 (6%)

Query: 1   MHGIVLWRS---PAWTD---KFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTG 54
           MHGI+ W++     W +    F      +S+L+TWQD RC+ ++L SLP+PDSHL   TG
Sbjct: 91  MHGILFWKAGQGCEWMEGGPAFVFEPRAVSHLVTWQDGRCNSSFLASLPKPDSHLSVATG 150

Query: 55  YGINTLLWYMQHEPQTVLQYTHAATIQ 81
           +G  T+ W +++ P+ +  Y  A TIQ
Sbjct: 151 FGCATIFWLLKNSPEFLKSYDAAGTIQ 177





Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q9UHJ6|SHPK_HUMAN Sedoheptulokinase OS=Homo sapiens GN=SHPK PE=1 SV=3 Back     alignment and function description
>sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=4 SV=1 Back     alignment and function description
>sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=4 SV=2 Back     alignment and function description
>sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 Back     alignment and function description
>sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 Back     alignment and function description
>sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=4 SV=1 Back     alignment and function description
>sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 Back     alignment and function description
>sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
357606354 453 hypothetical protein KGM_15257 [Danaus p 0.570 0.178 0.460 6e-19
321463457 465 hypothetical protein DAPPUDRAFT_307292 [ 0.570 0.174 0.5 1e-17
326667948 455 PREDICTED: sedoheptulokinase [Danio reri 0.570 0.178 0.471 1e-16
348537405 427 PREDICTED: sedoheptulokinase-like [Oreoc 0.570 0.189 0.452 1e-16
432899959 459 PREDICTED: sedoheptulokinase-like [Oryzi 0.570 0.176 0.476 3e-16
47223733 471 unnamed protein product [Tetraodon nigro 0.570 0.171 0.464 2e-15
242003940 473 conserved hypothetical protein [Pediculu 0.570 0.171 0.421 6e-15
270013843 478 hypothetical protein TcasGA2_TC012506 [T 0.570 0.169 0.377 9e-15
189241031 471 PREDICTED: similar to carbohydrate kinas 0.570 0.171 0.377 9e-15
193627213 460 PREDICTED: sedoheptulokinase-like [Acyrt 0.626 0.193 0.4 1e-14
>gi|357606354|gb|EHJ65035.1| hypothetical protein KGM_15257 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (69%), Gaps = 8/89 (8%)

Query: 1   MHGIVLWRSPAWTD--------KFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAY 52
           MHG+VLW++ AW          ++E   E++S L TWQDTRC   +L +LP+PDSHL+ Y
Sbjct: 76  MHGVVLWKNGAWEKVEKEGAFIRYEGNRENMSALYTWQDTRCKPEFLETLPKPDSHLQCY 135

Query: 53  TGYGINTLLWYMQHEPQTVLQYTHAATIQ 81
           +GYG  TLLW ++H+P+ +  +T++AT+Q
Sbjct: 136 SGYGCATLLWMLKHKPEKLKNFTYSATVQ 164




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321463457|gb|EFX74473.1| hypothetical protein DAPPUDRAFT_307292 [Daphnia pulex] Back     alignment and taxonomy information
>gi|326667948|ref|XP_001341627.3| PREDICTED: sedoheptulokinase [Danio rerio] Back     alignment and taxonomy information
>gi|348537405|ref|XP_003456185.1| PREDICTED: sedoheptulokinase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|432899959|ref|XP_004076657.1| PREDICTED: sedoheptulokinase-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|47223733|emb|CAF98503.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|242003940|ref|XP_002422916.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505809|gb|EEB10178.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270013843|gb|EFA10291.1| hypothetical protein TcasGA2_TC012506 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189241031|ref|XP_971652.2| PREDICTED: similar to carbohydrate kinase-like [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193627213|ref|XP_001952623.1| PREDICTED: sedoheptulokinase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
ZFIN|ZDB-GENE-060526-357 454 shpk "sedoheptulokinase" [Dani 0.570 0.178 0.471 9.8e-19
MGI|MGI:1921887 476 Shpk "sedoheptulokinase" [Mus 0.570 0.170 0.402 5.9e-14
UNIPROTKB|E1BXJ6 470 SHPK "Uncharacterized protein" 0.549 0.165 0.431 1.2e-13
RGD|1308004 472 Shpk "sedoheptulokinase" [Ratt 0.570 0.171 0.402 1.6e-13
UNIPROTKB|Q1JPE3 478 CARKL "Uncharacterized protein 0.549 0.163 0.397 5.6e-13
UNIPROTKB|Q9UHJ6 478 SHPK "Sedoheptulokinase" [Homo 0.563 0.167 0.395 1.5e-12
UNIPROTKB|J9P2G8 527 SHPK "Uncharacterized protein" 0.563 0.151 0.360 4.9e-12
UNIPROTKB|F1RLI9 481 SHPK "Uncharacterized protein" 0.549 0.162 0.373 5e-11
UNIPROTKB|E2R8H6 482 SHPK "Uncharacterized protein" 0.563 0.165 0.348 1.1e-10
UNIPROTKB|Q746T3141 GSU3435 "Ankyrin repeat protei 0.436 0.439 0.380 7e-06
ZFIN|ZDB-GENE-060526-357 shpk "sedoheptulokinase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 9.8e-19, Sum P(2) = 9.8e-19
 Identities = 41/87 (47%), Positives = 57/87 (65%)

Query:     1 MHGIVLWRSPA---WTDKFELIN---EHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTG 54
             MHGIVLW+S +   W  K  +     + +S LITWQD RCD  +L++LP+PDSHL   TG
Sbjct:    90 MHGIVLWKSNSGCEWQSKDGITRFSPKDVSQLITWQDGRCDFDFLSALPKPDSHLSVATG 149

Query:    55 YGINTLLWYMQHEPQTVLQYTHAATIQ 81
             +G  T+ WYM+H P+ +  ++ A TIQ
Sbjct:   150 FGCATVFWYMKHRPEFLSGFSDAGTIQ 176


GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
MGI|MGI:1921887 Shpk "sedoheptulokinase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXJ6 SHPK "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1308004 Shpk "sedoheptulokinase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPE3 CARKL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UHJ6 SHPK "Sedoheptulokinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2G8 SHPK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLI9 SHPK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8H6 SHPK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q746T3 GSU3435 "Ankyrin repeat protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
cd07777 448 cd07777, FGGY_SHK_like, sedoheptulokinase-like pro 5e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 7e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-05
smart0024830 smart00248, ANK, ankyrin repeats 4e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 9e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-04
cd00366 435 cd00366, FGGY, FGGY family of carbohydrate kinases 3e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.003
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.003
>gnl|CDD|212661 cd07777, FGGY_SHK_like, sedoheptulokinase-like proteins; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
 Score =  103 bits (259), Expect = 5e-27
 Identities = 39/98 (39%), Positives = 55/98 (56%), Gaps = 9/98 (9%)

Query: 1   MHGIVLWRSPA---WTDKFELINEHISNLITWQDTRCDHAYLTSLPRPDSHLRAYTGYGI 57
           MHGIVLW+        D   + N  +SNL TWQD RC   +L SLP+P SHL  +TG+G 
Sbjct: 80  MHGIVLWKQDQSCEDGDLISITNTPVSNLYTWQDGRCSEDFLKSLPKPQSHLPIHTGFGC 139

Query: 58  NTLLWYMQHEPQTVLQYTHAATIQVAKGDKELVLSILA 95
            TL W  ++ P+ +  + H  TIQ      + V+++L 
Sbjct: 140 ATLFWLQKNGPEFLESFDHCGTIQ------DFVVAMLC 171


This subfamily is predominantly composed of uncharacterized bacterial and eukaryotic proteins with similarity to human sedoheptulokinase (SHK, also known as D-altro-heptulose or heptulokinase, EC 2.7.1.14) encoded by the carbohydrate kinase-like (CARKL/SHPK) gene. SHK catalyzes the ATP-dependent phosphorylation of sedoheptulose to produce sedoheptulose 7-phosphate and ADP. The presence of Mg2+ or Mn2+ might be required for catalytic activity. Members of this subfamily belong to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Length = 448

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|212658 cd00366, FGGY, FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
KOG4412|consensus226 99.69
KOG4412|consensus226 99.68
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.68
PHA02791284 ankyrin-like protein; Provisional 99.59
PHA02791 284 ankyrin-like protein; Provisional 99.56
KOG0509|consensus 600 99.52
KOG0502|consensus296 99.51
KOG0512|consensus228 99.51
KOG4214|consensus117 99.5
KOG0195|consensus 448 99.5
PHA02741169 hypothetical protein; Provisional 99.5
KOG0508|consensus 615 99.5
PHA02875 413 ankyrin repeat protein; Provisional 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
PHA02859209 ankyrin repeat protein; Provisional 99.47
KOG0509|consensus 600 99.46
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.46
PHA02743166 Viral ankyrin protein; Provisional 99.46
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
KOG0508|consensus 615 99.42
PHA02884 300 ankyrin repeat protein; Provisional 99.41
KOG0514|consensus452 99.41
PHA02878 477 ankyrin repeat protein; Provisional 99.41
PHA02859209 ankyrin repeat protein; Provisional 99.41
PHA03095 471 ankyrin-like protein; Provisional 99.4
KOG4177|consensus 1143 99.39
PHA02874 434 ankyrin repeat protein; Provisional 99.39
PHA03100 480 ankyrin repeat protein; Provisional 99.38
PHA02875 413 ankyrin repeat protein; Provisional 99.38
PHA03095 471 ankyrin-like protein; Provisional 99.37
PHA02878 477 ankyrin repeat protein; Provisional 99.37
PHA02874 434 ankyrin repeat protein; Provisional 99.37
PHA02736154 Viral ankyrin protein; Provisional 99.36
PHA02795 437 ankyrin-like protein; Provisional 99.36
PHA02743166 Viral ankyrin protein; Provisional 99.36
PHA02736154 Viral ankyrin protein; Provisional 99.35
PHA03100 480 ankyrin repeat protein; Provisional 99.32
PHA02795 437 ankyrin-like protein; Provisional 99.32
KOG0515|consensus 752 99.31
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.31
PHA02798 489 ankyrin-like protein; Provisional 99.31
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.3
PHA02946 446 ankyin-like protein; Provisional 99.28
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.28
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.28
PHA02876 682 ankyrin repeat protein; Provisional 99.28
KOG0510|consensus 929 99.27
PHA02946 446 ankyin-like protein; Provisional 99.26
PHA02876 682 ankyrin repeat protein; Provisional 99.25
PHA02989 494 ankyrin repeat protein; Provisional 99.25
PHA02917 661 ankyrin-like protein; Provisional 99.23
PF1360630 Ank_3: Ankyrin repeat 99.23
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.22
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.2
KOG0502|consensus296 99.18
PHA02741169 hypothetical protein; Provisional 99.17
PHA02989 494 ankyrin repeat protein; Provisional 99.16
KOG0512|consensus228 99.15
PHA02917 661 ankyrin-like protein; Provisional 99.15
PHA02884 300 ankyrin repeat protein; Provisional 99.14
KOG4177|consensus 1143 99.12
PHA02798 489 ankyrin-like protein; Provisional 99.11
PHA02730 672 ankyrin-like protein; Provisional 99.09
PHA02730 672 ankyrin-like protein; Provisional 99.06
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.06
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.05
KOG0195|consensus 448 99.04
KOG0505|consensus 527 99.03
PHA02792 631 ankyrin-like protein; Provisional 99.03
KOG0505|consensus 527 99.02
KOG0783|consensus 1267 99.01
TIGR00870 743 trp transient-receptor-potential calcium channel p 98.98
KOG1710|consensus 396 98.96
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.93
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.93
KOG4214|consensus117 98.93
KOG0510|consensus 929 98.9
PHA02792 631 ankyrin-like protein; Provisional 98.9
KOG3676|consensus 782 98.89
KOG0507|consensus 854 98.89
KOG0515|consensus 752 98.78
KOG3676|consensus 782 98.72
TIGR00870 743 trp transient-receptor-potential calcium channel p 98.65
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.63
KOG0506|consensus622 98.62
KOG0511|consensus 516 98.61
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.58
KOG0514|consensus452 98.56
KOG0705|consensus749 98.51
KOG0507|consensus 854 98.37
KOG0818|consensus 669 98.36
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.32
KOG4369|consensus 2131 98.1
KOG0522|consensus 560 98.05
KOG0506|consensus622 98.03
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 97.93
KOG0818|consensus 669 97.93
PF1360630 Ank_3: Ankyrin repeat 97.89
KOG0522|consensus 560 97.86
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.82
KOG0521|consensus785 97.71
KOG1710|consensus 396 97.69
KOG4369|consensus 2131 97.69
KOG0782|consensus1004 97.64
KOG3609|consensus 822 97.45
KOG2505|consensus 591 97.44
KOG0520|consensus 975 97.06
KOG0782|consensus1004 96.9
KOG2384|consensus 223 96.85
KOG0705|consensus749 96.84
KOG0521|consensus785 96.51
KOG0783|consensus 1267 95.09
KOG2505|consensus591 94.99
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.59
KOG0511|consensus 516 91.12
KOG3609|consensus 822 88.36
>KOG4412|consensus Back     alignment and domain information
Probab=99.69  E-value=7.2e-17  Score=100.45  Aligned_cols=96  Identities=24%  Similarity=0.307  Sum_probs=55.3

Q ss_pred             CccccccccCChHHHHHHHHh----CChhhhccCccc-hhHhhcCCHHHHHHHHHcCCCCCCCCCCCChHHHHHHHcCCH
Q psy229           46 DSHLRAYTGYGINTLLWYMQH----EPQTVLQYTHAA-TIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSV  120 (142)
Q Consensus        46 ~~~l~~~~~~~~~~l~~~~~~----~~~~~~~~~~~~-~~a~~~~~~~~~~~Ll~~~~~~~~~~~~g~tpL~~a~~~~~~  120 (142)
                      -+|+|.++..|...+...+..    +++.....+.+. |+|+.+|..++..+|+..|+.++.+|..|.||||-|+.-|.+
T Consensus        73 WtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGkl  152 (226)
T KOG4412|consen   73 WTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKL  152 (226)
T ss_pred             CchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccch
Confidence            344454444444443333332    233333334444 566666666666666666666666666666666666666666


Q ss_pred             HHHHHHHhCCCCcccccCCCC
Q psy229          121 SVTQALLGFGAEVNVSQIPYF  141 (142)
Q Consensus       121 ~~~~~Ll~~ga~~~~~~~~g~  141 (142)
                      +++++|+..|+.+|.+|++||
T Consensus       153 kvie~Li~~~a~~n~qDk~G~  173 (226)
T KOG4412|consen  153 KVIEYLISQGAPLNTQDKYGF  173 (226)
T ss_pred             hhHHHHHhcCCCCCcccccCc
Confidence            666666666666666666665



>KOG4412|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-05
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-05
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 3e-04
3hra_A 201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 3e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-04
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-04
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 33/53 (62%) Query: 85 GDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQ 137 G KE+V +++ GA + KD DG TPLH AA+N V + L+ GA+VN S Sbjct: 81 GHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSD 133
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-09
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 8e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-11
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-05
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-05
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-10
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-07
3hra_A 201 Ankyrin repeat family protein; structural protein; 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-07
3hra_A 201 Ankyrin repeat family protein; structural protein; 2e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-08
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-06
1ihb_A 162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-10
1bi7_B 156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 1e-06
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 2e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-10
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-07
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-07
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 4e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-09
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 5e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 5e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-11
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-10
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-08
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-07
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 6e-11
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-05
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-04
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-11
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-09
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A 172 DNA-binding protein rfxank; structural genomics co 3e-10
3v30_A 172 DNA-binding protein rfxank; structural genomics co 7e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-11
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-11
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-09
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-05
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-04
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 8e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-09
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-08
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 5e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-08
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-08
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-10
2y1l_E 169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-10
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 9e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-09
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 1e-04
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-09
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-07
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-07
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-10
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-07
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-04
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-10
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-09
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-08
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-06
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-10
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-07
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-06
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-08
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-07
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-06
3twr_A 165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-08
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 1e-07
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-08
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-09
1awc_B 153 Protein (GA binding protein beta 1); complex (tran 2e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-06
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 8e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-07
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-05
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-04
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-09
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-09
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-06
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
2pnn_A 273 Transient receptor potential cation channel subfa 2e-09
2pnn_A273 Transient receptor potential cation channel subfa 4e-06
2pnn_A 273 Transient receptor potential cation channel subfa 2e-04
2pnn_A273 Transient receptor potential cation channel subfa 4e-04
2pnn_A273 Transient receptor potential cation channel subfa 6e-04
2etb_A256 Transient receptor potential cation channel subfam 2e-09
2etb_A 256 Transient receptor potential cation channel subfam 1e-07
2etb_A256 Transient receptor potential cation channel subfam 1e-05
2etb_A256 Transient receptor potential cation channel subfam 6e-05
2etb_A 256 Transient receptor potential cation channel subfam 6e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-05
3t8k_A 186 Uncharacterized protein; structural genomics, PSI- 1e-04
2rfa_A232 Transient receptor potential cation channel subfa 2e-08
2rfa_A 232 Transient receptor potential cation channel subfa 2e-08
2rfa_A 232 Transient receptor potential cation channel subfa 3e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 3e-06
3jxi_A 260 Vanilloid receptor-related osmotically activated p 3e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 2e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-04
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
 Score = 58.6 bits (143), Expect = 6e-12
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 76  HAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNV 135
                    G   + L +L  GA+  ++D  G +P+H AA+   +   + L+  GA+VNV
Sbjct: 41  QVM----MFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNV 96


>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Length = 504 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.8
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.72
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.71
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.7
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.69
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.69
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.68
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.67
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.67
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.66
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.66
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.66
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.65
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.65
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.65
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.63
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.63
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.63
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.62
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.62
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.62
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.62
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.62
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.62
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.61
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.61
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.61
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.61
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.59
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.59
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.59
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.59
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.59
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.58
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.58
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.57
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.57
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.57
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.57
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.57
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.56
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.56
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.55
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.55
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.55
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.55
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.55
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.54
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.54
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.54
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.54
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.54
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.54
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.54
2rfa_A232 Transient receptor potential cation channel subfa 99.54
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.53
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.53
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.52
3hra_A201 Ankyrin repeat family protein; structural protein; 99.52
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.52
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.52
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.52
2etb_A256 Transient receptor potential cation channel subfam 99.52
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.51
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.51
2etb_A256 Transient receptor potential cation channel subfam 99.51
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.51
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.51
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.51
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.5
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.5
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.5
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.5
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.5
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.5
2rfa_A232 Transient receptor potential cation channel subfa 99.49
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.49
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.49
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.49
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.49
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.49
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.48
2pnn_A273 Transient receptor potential cation channel subfa 99.48
2pnn_A273 Transient receptor potential cation channel subfa 99.48
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.48
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.46
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.46
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.46
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.46
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.45
3hra_A201 Ankyrin repeat family protein; structural protein; 99.45
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.44
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.44
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.43
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.43
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.43
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.43
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.42
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.41
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.41
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.4
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.4
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.38
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.38
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.38
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.38
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.37
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.31
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 99.3
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.27
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.23
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.16
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.13
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.80  E-value=2e-19  Score=113.35  Aligned_cols=111  Identities=25%  Similarity=0.303  Sum_probs=81.6

Q ss_pred             cccCChHHHhhCCCCCccccccccCChHHHHHHHHh--------------CChhhhccCccc-hhHhhcCCHHHHHHHHH
Q psy229           31 DTRCDHAYLTSLPRPDSHLRAYTGYGINTLLWYMQH--------------EPQTVLQYTHAA-TIQVAKGDKELVLSILA   95 (142)
Q Consensus        31 ~~~~~~~~~~~l~~~~~~l~~~~~~~~~~l~~~~~~--------------~~~~~~~~~~~~-~~a~~~~~~~~~~~Ll~   95 (142)
                      ...+..+.++.+.+.+..++..+..|.+++++++..              +++..+..+.++ ++|+..|+.+++++|++
T Consensus        12 a~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~   91 (169)
T 4gpm_A           12 AENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLIS   91 (169)
T ss_dssp             HHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             HHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHH
Confidence            345556666666666666665555555555544442              344444555565 67888889999999998


Q ss_pred             cCCCCCCCCCCCChHHHHHHHcCCHHHHHHHHhCCCCcccccCCCC
Q psy229           96 AGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNVSQIPYF  141 (142)
Q Consensus        96 ~~~~~~~~~~~g~tpL~~a~~~~~~~~~~~Ll~~ga~~~~~~~~g~  141 (142)
                      .|++++.+|..|+||||+|+..|+.+++++|+++|++++.+|..|.
T Consensus        92 ~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~  137 (169)
T 4gpm_A           92 KGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGR  137 (169)
T ss_dssp             TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSC
T ss_pred             CcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCC
Confidence            8988888888899999999999999999999999999888888774



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-04
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-09
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-08
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-04
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-05
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-05
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1awcb_ 153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.0 bits (131), Expect = 2e-10
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 76  HAATIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSVTQALLGFGAEVNV 135
           H A      G   +V ++L  GA+  + +    TPLH+AA+     V + LL   A+VN 
Sbjct: 5   HVA---SFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.75
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.66
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.58
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.54
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.53
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.53
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.51
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.5
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.49
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.49
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.47
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.47
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.45
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.42
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.4
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.4
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.39
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.37
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.37
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.37
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.31
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.3
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.27
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.26
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.25
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.23
d1ixva_ 229 26S proteasome non-ATPase regulatory subunit 10, g 99.16
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.15
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.14
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.07
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.02
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.83
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.75  E-value=9e-19  Score=102.73  Aligned_cols=95  Identities=20%  Similarity=0.122  Sum_probs=79.4

Q ss_pred             ccccccccCChHHHHHHHHh---CChhhhccCccc-hhHhhcCCHHHHHHHHHcCCCCCCCCCCCChHHHHHHHcCCHHH
Q psy229           47 SHLRAYTGYGINTLLWYMQH---EPQTVLQYTHAA-TIQVAKGDKELVLSILAAGAALELKDGDGNTPLHIAAQNNSVSV  122 (142)
Q Consensus        47 ~~l~~~~~~~~~~l~~~~~~---~~~~~~~~~~~~-~~a~~~~~~~~~~~Ll~~~~~~~~~~~~g~tpL~~a~~~~~~~~  122 (142)
                      +|+..+...|...+...+..   +++..+..+.++ |+|+..++.+++++|+..|++++.+|..|.||||+|+..|+.++
T Consensus         4 tpL~~A~~~g~~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din~~d~~g~tpLh~A~~~~~~~~   83 (118)
T d1myoa_           4 KEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSC   83 (118)
T ss_dssp             HHHHHHHHTTCHHHHHHHHTTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTTCCSSSCSCHHHHHHTTTCCHH
T ss_pred             hHHHHHHHCCCHHHHHHHHHhhhccccccccccccccccccccccccccccccccceeeecccccccchhhhhhcCchhh
Confidence            45666777777765544444   455555556665 68889999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCCcccccCCCC
Q psy229          123 TQALLGFGAEVNVSQIPYF  141 (142)
Q Consensus       123 ~~~Ll~~ga~~~~~~~~g~  141 (142)
                      +++|+++|++++.+|..|.
T Consensus        84 v~~Ll~~Gad~~~~d~~G~  102 (118)
T d1myoa_          84 VKLLLSKGADKTVKGPDGL  102 (118)
T ss_dssp             HHHHHTTCCCSSSSSSSTC
T ss_pred             hhhhhcccccceeeCCCCC
Confidence            9999999999999999885



>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure