Psyllid ID: psy2410

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MIFKTWISFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI
ccHHHHHHHHHcccEEEccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEcccccccccccccccccEEEEEEEEEcccccccHHHHccccccHHHHHHHHHHHHHHHHHccccccEEEEcccHHHcccHHHHHHHHHcccccccccEEEccccccccccccccEEEEcccccccccccccc
ccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHEcccccccHHHEccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEHHHHHHHHHHHccccccccEEEEccccccHHHccHHHEEEEcccccccccccccc
MIFKTWISFLLFSIItsispgpgnilTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASinkkdstyicetirlpfniASYSLLIHIIAHEtglkvgdfiwtggdchLYLNHLDQARKQLlrnpgslpnltilckpkssldynfedfqinsynpqksiyapiai
MIFKTWISFLLFSIItsispgpgNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQinsynpqksiyapiai
MIFKTWisfllfsiitsisPGPGNILTINHALRYGWRKTLSLIIGQEIALVliilaisegaelllssssilifikifgiiWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI
*IFKTWISFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYN***********
*IFKTW*SFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI
MIFKTWISFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI
MIFKTWISFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAP***
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFKTWISFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLLSSSSILIFIKIFGIIWLMYTSFQMWCASINKKDSTYICETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
A7MR31264 Thymidylate synthase OS=C yes N/A 0.459 0.344 0.604 6e-28
Q0K889264 Thymidylate synthase OS=C yes N/A 0.459 0.344 0.571 1e-27
B7LNI2264 Thymidylate synthase OS=E yes N/A 0.459 0.344 0.604 1e-27
Q2SA17264 Thymidylate synthase OS=H yes N/A 0.459 0.344 0.604 1e-27
A8GIH7264 Thymidylate synthase OS=S yes N/A 0.459 0.344 0.582 2e-27
A4WE03264 Thymidylate synthase OS=E yes N/A 0.459 0.344 0.582 3e-27
Q3YY33264 Thymidylate synthase OS=S yes N/A 0.459 0.344 0.593 4e-27
Q32C94264 Thymidylate synthase OS=S yes N/A 0.459 0.344 0.593 4e-27
Q1R7I6264 Thymidylate synthase OS=E yes N/A 0.459 0.344 0.593 4e-27
B7N759264 Thymidylate synthase OS=E yes N/A 0.459 0.344 0.593 4e-27
>sp|A7MR31|TYSY_CROS8 Thymidylate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=thyA PE=3 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (74%)

Query: 108 LPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTIL 167
           LPFNIASY+LL+H++A +  L+ GDF+WTGGD HLY NHL+QAR QL R P  LP L I 
Sbjct: 174 LPFNIASYALLVHMMAQQCDLEPGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLVIK 233

Query: 168 CKPKSSLDYNFEDFQINSYNPQKSIYAPIAI 198
            KP+S  DY FEDF+I  Y+P  +I AP+AI
Sbjct: 234 RKPESLFDYRFEDFEIEGYDPHPAIKAPVAI 264
Provides the sole de novo source of dTMP for DNA biosynthesis.
Cronobacter sakazakii (strain ATCC BAA-894) (taxid: 290339)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 5
>sp|Q0K889|TYSY_CUPNH Thymidylate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=thyA PE=3 SV=2 Back     alignment and function description
>sp|B7LNI2|TYSY_ESCF3 Thymidylate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|Q2SA17|TYSY_HAHCH Thymidylate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|A8GIH7|TYSY_SERP5 Thymidylate synthase OS=Serratia proteamaculans (strain 568) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|A4WE03|TYSY_ENT38 Thymidylate synthase OS=Enterobacter sp. (strain 638) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|Q3YY33|TYSY_SHISS Thymidylate synthase OS=Shigella sonnei (strain Ss046) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|Q32C94|TYSY_SHIDS Thymidylate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|Q1R7I6|TYSY_ECOUT Thymidylate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=thyA PE=3 SV=1 Back     alignment and function description
>sp|B7N759|TYSY_ECOLU Thymidylate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thyA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
399017507264 thymidylate synthase [Herbaspirillum sp. 0.459 0.344 0.615 9e-29
390435256264 thymidylate synthase [Pantoea agglomeran 0.459 0.344 0.615 4e-27
372275124264 thymidylate synthase [Pantoea sp. SL1_M5 0.459 0.344 0.615 5e-27
398800555264 thymidylate synthase [Pantoea sp. GM01] 0.459 0.344 0.615 5e-27
188534879264 thymidylate synthase [Erwinia tasmaniens 0.459 0.344 0.615 5e-27
319944036264 thymidylate synthase [Lautropia mirabili 0.459 0.344 0.615 6e-27
407792081264 thymidylate synthase [Gallaecimonas xiam 0.459 0.344 0.626 6e-27
395234566264 thymidylate synthase [Enterobacter sp. A 0.459 0.344 0.604 9e-27
398795694264 thymidylate synthase [Pantoea sp. YR343] 0.459 0.344 0.604 1e-26
317049336264 thymidylate synthase [Pantoea sp. At-9b] 0.459 0.344 0.615 1e-26
>gi|399017507|ref|ZP_10719698.1| thymidylate synthase [Herbaspirillum sp. CF444] gi|398103105|gb|EJL93278.1| thymidylate synthase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 56/91 (61%), Positives = 69/91 (75%)

Query: 108 LPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTIL 167
           +PFNIASY+LL H++A +TGL VGDF+WTGGDCHLY NH++Q R+QL R PG LP L I 
Sbjct: 174 VPFNIASYALLTHMVAQQTGLDVGDFVWTGGDCHLYSNHMEQVREQLARTPGPLPKLQIK 233

Query: 168 CKPKSSLDYNFEDFQINSYNPQKSIYAPIAI 198
            KP+S  DY FEDF+I  Y  Q  I AP+A+
Sbjct: 234 RKPESIFDYKFEDFEITDYEAQAHIKAPVAV 264

Source: Herbaspirillum sp. CF444

Species: Herbaspirillum sp. CF444

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|390435256|ref|ZP_10223794.1| thymidylate synthase [Pantoea agglomerans IG1] Back     alignment and taxonomy information
>gi|372275124|ref|ZP_09511160.1| thymidylate synthase [Pantoea sp. SL1_M5] Back     alignment and taxonomy information
>gi|398800555|ref|ZP_10559824.1| thymidylate synthase [Pantoea sp. GM01] gi|398095125|gb|EJL85473.1| thymidylate synthase [Pantoea sp. GM01] Back     alignment and taxonomy information
>gi|188534879|ref|YP_001908676.1| thymidylate synthase [Erwinia tasmaniensis Et1/99] gi|188029921|emb|CAO97805.1| Thymidylate synthase [Erwinia tasmaniensis Et1/99] Back     alignment and taxonomy information
>gi|319944036|ref|ZP_08018316.1| thymidylate synthase [Lautropia mirabilis ATCC 51599] gi|319742797|gb|EFV95204.1| thymidylate synthase [Lautropia mirabilis ATCC 51599] Back     alignment and taxonomy information
>gi|407792081|ref|ZP_11139154.1| thymidylate synthase [Gallaecimonas xiamenensis 3-C-1] gi|407198246|gb|EKE68285.1| thymidylate synthase [Gallaecimonas xiamenensis 3-C-1] Back     alignment and taxonomy information
>gi|395234566|ref|ZP_10412790.1| thymidylate synthase [Enterobacter sp. Ag1] gi|394731012|gb|EJF30839.1| thymidylate synthase [Enterobacter sp. Ag1] Back     alignment and taxonomy information
>gi|398795694|ref|ZP_10555506.1| thymidylate synthase [Pantoea sp. YR343] gi|398205455|gb|EJM92237.1| thymidylate synthase [Pantoea sp. YR343] Back     alignment and taxonomy information
>gi|317049336|ref|YP_004116984.1| thymidylate synthase [Pantoea sp. At-9b] gi|316950953|gb|ADU70428.1| thymidylate synthase [Pantoea sp. At-9b] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
UNIPROTKB|P0A884264 thyA "thymidylate synthase" [E 0.484 0.363 0.567 1.5e-26
TIGR_CMR|CBU_1547264 CBU_1547 "thymidylate synthase 0.459 0.344 0.560 2.6e-24
TIGR_CMR|SO_1335264 SO_1335 "thymidylate synthase" 0.484 0.363 0.515 3.3e-24
TIGR_CMR|BA_2236318 BA_2236 "thymidylate synthase" 0.459 0.286 0.527 2.1e-22
UNIPROTKB|P67044263 thyA "Thymidylate synthase" [M 0.454 0.342 0.505 3.4e-22
UNIPROTKB|F1N8Y2312 TYMS "Thymidylate synthase" [G 0.459 0.291 0.538 1e-20
FB|FBgn0024920321 Ts "Ts" [Drosophila melanogast 0.459 0.283 0.516 1.3e-20
UNIPROTKB|P04818313 TYMS "Thymidylate synthase" [H 0.459 0.290 0.527 2.7e-20
UNIPROTKB|Q8WYK3279 TS "Thymidylate synthetase, is 0.459 0.326 0.527 2.7e-20
UNIPROTKB|Q8WYK4230 TS "Thymidylate synthase" [Hom 0.459 0.395 0.527 2.7e-20
UNIPROTKB|P0A884 thyA "thymidylate synthase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 1.5e-26, P = 1.5e-26
 Identities = 55/97 (56%), Positives = 69/97 (71%)

Query:   103 CET-IRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSL 161
             C+  + LPFNIASY+LL+H++A +  L+VGDF+WTGGD HLY NH+DQ   QL R P  L
Sbjct:   168 CDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPL 227

Query:   162 PNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI 198
             P L I  KP+S  DY FEDF+I  Y+P   I AP+AI
Sbjct:   228 PKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI 264
GO:0006231 "dTMP biosynthetic process" evidence=IEA
GO:0006235 "dTTP biosynthetic process" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0009165 "nucleotide biosynthetic process" evidence=IEA
GO:0006417 "regulation of translation" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0004799 "thymidylate synthase activity" evidence=IEA;IDA
GO:0005737 "cytoplasm" evidence=IEA
TIGR_CMR|CBU_1547 CBU_1547 "thymidylate synthase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1335 SO_1335 "thymidylate synthase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2236 BA_2236 "thymidylate synthase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P67044 thyA "Thymidylate synthase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8Y2 TYMS "Thymidylate synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0024920 Ts "Ts" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P04818 TYMS "Thymidylate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WYK3 TS "Thymidylate synthetase, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WYK4 TS "Thymidylate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8ZHV1TYSY_YERPE2, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
Q1R7I6TYSY_ECOUT2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A4TLC5TYSY_YERPP2, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
C0PXI9TYSY_SALPC2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
A6TDG3TYSY_KLEP72, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
B7LF04TYSY_ECO552, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
C4ZZX9TYSY_ECOBW2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q1CAR9TYSY_YERPA2, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
P48464TYSY_SHIFL2, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
C4K7G3TYSY_HAMD52, ., 1, ., 1, ., 4, 50.62630.45950.3446yesN/A
Q32C94TYSY_SHIDS2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A7FFE0TYSY_YERP32, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A7ZQT3TYSY_ECO242, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
B7LNI2TYSY_ESCF32, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
B7NVX2TYSY_ECO7I2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q8Y0U6TYSY_RALSO2, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
B7LY83TYSY_ECO8A2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A8GIH7TYSY_SERP52, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
A8AP42TYSY_CITK82, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
Q2NRH3TYSY_SODGM2, ., 1, ., 1, ., 4, 50.56040.45950.3446yesN/A
Q0T137TYSY_SHIF82, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
Q6D8I6TYSY_ERWCT2, ., 1, ., 1, ., 4, 50.56040.45950.3446yesN/A
Q667F9TYSY_YERPS2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q0K889TYSY_CUPNH2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
B7N759TYSY_ECOLU2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q8ZMA9TYSY_SALTY2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
Q31XG0TYSY_SHIBS2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A7MR31TYSY_CROS82, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
A8A3W0TYSY_ECOHS2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
C6DAE9TYSY_PECCP2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
A1AF39TYSY_ECOK12, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A1JPC9TYSY_YERE82, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A0KG32TYSY_AERHH2, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
Q2SA17TYSY_HAHCH2, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
Q57KB6TYSY_SALCH2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
A9N2L7TYSY_SALPB2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
Q0TE05TYSY_ECOL52, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q5PEN6TYSY_SALPA2, ., 1, ., 1, ., 4, 50.57140.45950.3446yesN/A
P0A885TYSY_ECOL62, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
B7MLH3TYSY_ECO452, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
A4WE03TYSY_ENT382, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A
B7UHP4TYSY_ECO272, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
B1IU17TYSY_ECOLC2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q1CFB5TYSY_YERPN2, ., 1, ., 1, ., 4, 50.60430.45950.3446yesN/A
B7MZC6TYSY_ECO812, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q3YY33TYSY_SHISS2, ., 1, ., 1, ., 4, 50.59340.45950.3446yesN/A
Q7N8U4TYSY_PHOLL2, ., 1, ., 1, ., 4, 50.58240.45950.3446yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!
4th Layer2.1.1.45LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
PRK01827264 PRK01827, thyA, thymidylate synthase; Reviewed 3e-42
TIGR03284295 TIGR03284, thym_sym, thymidylate synthase 2e-38
COG0207268 COG0207, ThyA, Thymidylate synthase [Nucleotide tr 4e-35
pfam00303262 pfam00303, Thymidylat_synt, Thymidylate synthase 2e-34
PTZ00164514 PTZ00164, PTZ00164, bifunctional dihydrofolate red 6e-22
cd00351215 cd00351, TS_Pyrimidine_HMase, Thymidylate synthase 3e-18
COG1280208 COG1280, RhtB, Putative threonine efflux protein [ 2e-14
PRK10520205 PRK10520, rhtB, homoserine/homoserine lactone effl 8e-11
PRK13821323 PRK13821, thyA, thymidylate synthase; Provisional 3e-08
pfam01810191 pfam01810, LysE, LysE type translocator 4e-08
PRK10323195 PRK10323, PRK10323, cysteine/O-acetylserine export 2e-04
>gnl|CDD|234984 PRK01827, thyA, thymidylate synthase; Reviewed Back     alignment and domain information 
 Score =  142 bits (361), Expect = 3e-42
 Identities = 51/91 (56%), Positives = 67/91 (73%)

Query: 108 LPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTIL 167
           +PFNIASY+LL H+IA +TGLKVG+F+ T GD H+Y NHL+QAR+QL R P  LP L I 
Sbjct: 174 VPFNIASYALLTHMIAQQTGLKVGEFVHTIGDAHIYSNHLEQAREQLSREPRPLPKLVIN 233

Query: 168 CKPKSSLDYNFEDFQINSYNPQKSIYAPIAI 198
              KS  D+ FEDF++  Y+P  +I AP+A+
Sbjct: 234 PDIKSIFDFEFEDFELEGYDPHPAIKAPVAV 264

Length = 264
>gnl|CDD|213790 TIGR03284, thym_sym, thymidylate synthase Back     alignment and domain information
>gnl|CDD|223285 COG0207, ThyA, Thymidylate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|215846 pfam00303, Thymidylat_synt, Thymidylate synthase Back     alignment and domain information
>gnl|CDD|240299 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|238211 cd00351, TS_Pyrimidine_HMase, Thymidylate synthase and pyrimidine hydroxymethylase: Thymidylate synthase (TS) and deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs that catalyze analogous alkylation of C5 of pyrimidine nucleotides Back     alignment and domain information
>gnl|CDD|224199 COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182514 PRK10520, rhtB, homoserine/homoserine lactone efflux protein; Provisional Back     alignment and domain information
>gnl|CDD|184347 PRK13821, thyA, thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|216716 pfam01810, LysE, LysE type translocator Back     alignment and domain information
>gnl|CDD|182377 PRK10323, PRK10323, cysteine/O-acetylserine exporter; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
COG1280208 RhtB Putative threonine efflux protein [Amino acid 99.97
PRK10520205 rhtB homoserine/homoserine lactone efflux protein; 99.96
PRK10323195 cysteine/O-acetylserine exporter; Provisional 99.96
PRK10958212 leucine export protein LeuE; Provisional 99.96
PRK10229206 threonine efflux system; Provisional 99.93
PRK09304207 arginine exporter protein; Provisional 99.92
TIGR00948177 2a75 L-lysine exporter. 99.91
TIGR00949185 2A76 The Resistance to Homoserine/Threonine (RhtB) 99.91
PF01810191 LysE: LysE type translocator; InterPro: IPR001123 99.89
KOG0673|consensus293 99.79
TIGR03284296 thym_sym thymidylate synthase. Members of this pro 99.77
PRK01827264 thyA thymidylate synthase; Reviewed 99.76
COG0207268 ThyA Thymidylate synthase [Nucleotide transport an 99.75
PRK13821323 thyA thymidylate synthase; Provisional 99.74
PTZ00164514 bifunctional dihydrofolate reductase-thymidylate s 99.69
COG1279202 Lysine efflux permease [General function predictio 99.56
PF00303269 Thymidylat_synt: Thymidylate synthase; InterPro: I 99.51
PF11139214 DUF2910: Protein of unknown function (DUF2910); In 97.5
TIGR03717176 R_switched_YjbE integral membrane protein, YjbE fa 96.78
PRK10995221 inner membrane protein; Provisional 95.81
TIGR03716215 R_switched_YkoY integral membrane protein, YkoY fa 94.91
PF03741183 TerC: Integral membrane protein TerC family; Inter 94.08
TIGR03718302 R_switched_Alx integral membrane protein, TerC fam 93.16
PF02417169 Chromate_transp: Chromate transporter; InterPro: I 91.81
TIGR00427201 membrane protein, MarC family. MarC is a protein t 85.83
TIGR00937 368 2A51 chromate transporter, chromate ion transporte 82.45
COG1280208 RhtB Putative threonine efflux protein [Amino acid 81.53
TIGR00937368 2A51 chromate transporter, chromate ion transporte 80.42
>COG1280 RhtB Putative threonine efflux protein [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=1.2e-30  Score=213.78  Aligned_cols=164  Identities=20%  Similarity=0.327  Sum_probs=138.8

Q ss_pred             CCHHHHHHHHHHHHHhhccCchHHHHHHHHHHhhChHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-hhHHHHHHHHHHHH
Q psy2410           1 MIFKTWISFLLFSIITSISPGPGNILTINHALRYGWRKTLSLIIGQEIALVLIILAISEGAELLL-SSSSILIFIKIFGI   79 (198)
Q Consensus         1 M~~~~~~~~~~~~~~~~~~PGP~~~~v~~~~~~~G~r~~~~~~~G~~~g~~~~~~~~~~Gl~~l~-~~~~~~~~l~~~G~   79 (198)
                      |+++.+++|+.++++..++|||++++++++++++|+|+|+.+++|+.+|+.+|++++++|++.++ .+|.+++++|++|+
T Consensus         1 m~~~~~l~~~~~~~~~~~~PGP~~~~v~~~~~~~G~~~g~~~~~G~~~G~~v~~~l~~~Gl~all~~~~~~f~~lk~~Ga   80 (208)
T COG1280           1 MMLTNLLAFLLAALVLAATPGPDNLLVLARSLSRGRRAGLATALGIALGDLVHMLLAALGLAALLATSPALFTVLKLAGA   80 (208)
T ss_pred             CCHHHHHHHHHHHHHHhcCCCccHHHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Confidence            88999999999999999999999999999999999999999999999999999999999999988 79999999999999


Q ss_pred             HHHHHHHHHHHhhccCc---C-----Cc----chhhhhhccchhHHHHHHHHHHHhhhcCchHH----HH--------HH
Q psy2410          80 IWLMYTSFQMWCASINK---K-----DS----TYICETIRLPFNIASYSLLIHIIAHETGLKVG----DF--------IW  135 (198)
Q Consensus        80 ~yL~ylg~~~~r~~~~~---~-----~~----~~~~~~l~n~~Npk~~~~~~~~~~~~~~~~~~----~~--------v~  135 (198)
                      +||+|+|+|++|++.+.   +     +.    .|+++++.|..|||.++|+.+++||+.+...+    ++        +.
T Consensus        81 aYL~ylg~~~~ra~~~~~~~~~~~~~~~~~~~~f~~G~~~~l~NPK~~lf~la~~pqfv~~~~~~~~~~~~~l~~~~~~~  160 (208)
T COG1280          81 AYLLYLGWKALRAGGAALAEEAAGAPSSSRRKAFRRGLLVNLLNPKAILFFLAFLPQFVDPGAGLVLLQALILGLVFILV  160 (208)
T ss_pred             HHHHHHHHHHHhcccccccccccccccchhHHHHHHHHHHHhhCcHHHHHHHHHHhhhcCCCCchHHHHHHHHHHHHHHH
Confidence            99999999999986431   1     11    38999999999999888887777777543331    11        12


Q ss_pred             HHHHHHHHHHHHHHHHHHHhcCCCCCCeee
Q psy2410         136 TGGDCHLYLNHLDQARKQLLRNPGSLPNLT  165 (198)
Q Consensus       136 ~~~~~~vya~~~~~lr~~L~r~p~~~~~l~  165 (198)
                      .+.+...|....++.++++++ |+..++++
T Consensus       161 ~~~~~~~~~~~~~~~~~~l~~-~~~~~~~~  189 (208)
T COG1280         161 GFVVLALYALLAARLRRLLRR-PRASRIIN  189 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHhC-hHHHHHHH
Confidence            444556778888888998876 88776655

>PRK10520 rhtB homoserine/homoserine lactone efflux protein; Provisional Back     alignment and domain information
>PRK10323 cysteine/O-acetylserine exporter; Provisional Back     alignment and domain information
>PRK10958 leucine export protein LeuE; Provisional Back     alignment and domain information
>PRK10229 threonine efflux system; Provisional Back     alignment and domain information
>PRK09304 arginine exporter protein; Provisional Back     alignment and domain information
>TIGR00948 2a75 L-lysine exporter Back     alignment and domain information
>TIGR00949 2A76 The Resistance to Homoserine/Threonine (RhtB) Family protein Back     alignment and domain information
>PF01810 LysE: LysE type translocator; InterPro: IPR001123 Lysine exporter protein is involved in the efflux of excess L-lysine as a control for intracellular levels of L-lysine Back     alignment and domain information
>KOG0673|consensus Back     alignment and domain information
>TIGR03284 thym_sym thymidylate synthase Back     alignment and domain information
>PRK01827 thyA thymidylate synthase; Reviewed Back     alignment and domain information
>COG0207 ThyA Thymidylate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13821 thyA thymidylate synthase; Provisional Back     alignment and domain information
>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>COG1279 Lysine efflux permease [General function prediction only] Back     alignment and domain information
>PF00303 Thymidylat_synt: Thymidylate synthase; InterPro: IPR000398 Thymidylate synthase (2 Back     alignment and domain information
>PF11139 DUF2910: Protein of unknown function (DUF2910); InterPro: IPR021315 Some members in this bacterial family annotate the proteins as cytochrome C biogenesis proteins however this cannot be confirmed Back     alignment and domain information
>TIGR03717 R_switched_YjbE integral membrane protein, YjbE family Back     alignment and domain information
>PRK10995 inner membrane protein; Provisional Back     alignment and domain information
>TIGR03716 R_switched_YkoY integral membrane protein, YkoY family Back     alignment and domain information
>PF03741 TerC: Integral membrane protein TerC family; InterPro: IPR005496 A family containining a number of integral membrane proteins is named after TerC protein Back     alignment and domain information
>TIGR03718 R_switched_Alx integral membrane protein, TerC family Back     alignment and domain information
>PF02417 Chromate_transp: Chromate transporter; InterPro: IPR003370 This entry represents chromate transporters (CHR) [, ] Back     alignment and domain information
>TIGR00427 membrane protein, MarC family Back     alignment and domain information
>TIGR00937 2A51 chromate transporter, chromate ion transporter (CHR) family Back     alignment and domain information
>COG1280 RhtB Putative threonine efflux protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00937 2A51 chromate transporter, chromate ion transporter (CHR) family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1nce_A264 Crystal Structure Of A Ternary Complex Of E. Coli T 3e-28
1evf_A264 Crystal Structure Analysis Of Cys167 Mutant Of Esch 3e-28
1ev5_A264 Crystal Structure Analysis Of Ala167 Mutant Of Esch 4e-28
1ev8_A264 Crystal Structure Analysis Of Cys167 Mutant Of Esch 4e-28
1evg_A264 Crystal Structure Analysis Of Cys167 Mutant Of Esch 5e-28
3bgx_A264 E. Coli Thymidylate Synthase C146s Mutant Complexed 6e-28
1f4d_A264 Crystal Structure Of E. Coli Thymidylate Synthase C 6e-28
2vet_A264 Crystal Structure Of The Thymidylate Synthase K48q 6e-28
1tlc_A265 Thymidylate Synthase Complexed With Dgmp And Folate 6e-28
2bbq_A264 Structural Basis For Recognition Of Polyglutamyl Fo 6e-28
1aiq_A264 Crystal Structure Of Thymidylate Synthase R126e Mut 6e-28
1ffl_A264 Crystal Structure Of The Apo-Thymidylate Synthase R 7e-28
1jg0_A264 Crystal Structure Of Escherichia Coli Thymidylate S 7e-28
2vf0_A264 Crystal Structure Of The Thymidylate Synthase K48q 7e-28
1kce_A264 E. Coli Thymidylate Synthase Mutant E58q In Complex 7e-28
1kzj_A264 Crystal Structure Of Ects W80g/dump/cb3717 Complex 7e-28
1zpr_A264 E. Coli Thymidylate Synthase Mutant E58q In Complex 7e-28
2ftn_A264 E. Coli Thymidylate Synthase Y94f Mutant Length = 2 7e-28
1dna_A264 D221(169)n Mutant Does Not Promote Opening Of The C 7e-28
1f4g_A264 Crystal Structure Of E. Coli Thymidylate Synthase C 1e-27
2g8m_B264 Escherichia Coli Thymidylate Synthase Y209w In Comp 2e-27
2tsc_A264 Structure, Multiple Site Binding, And Segmental Acc 3e-27
1qqq_A264 Crystal Structure Analysis Of Ser254 Mutant Of Esch 3e-27
1bq1_A264 E. Coli Thymidylate Synthase Mutant N177a In Comple 4e-27
3bfi_A264 E. Coli Thymidylate Synthase Y209m Mutant Complexed 5e-27
4f2v_A272 Crystal Structure Of De Novo Designed Serine Hydrol 6e-24
3qj7_A264 Crystal Structure Of The Mycobacterium Tuberculosis 3e-23
3uwl_B315 Crystal Structure Of Enteroccocus Faecalis Thymidyl 6e-23
3uwl_A315 Crystal Structure Of Enteroccocus Faecalis Thymidyl 6e-23
1vzb_A316 L. Casei Thymidylate Synthase Mutant E60q Binary Co 2e-21
1bpj_A316 Thymidylate Synthase R178t, R179t Double Mutant Len 2e-21
1vza_A316 Thymidylate Synthase E60d Mutant Binary Complex Wit 2e-21
1lca_A316 Lactobacillus Casei Thymidylate Synthase Ternary Co 2e-21
1bo7_A316 Thymidylate Synthase R179t Mutant Length = 316 2e-21
1bo8_A316 Thymidylate Synthase R178t Mutant Length = 316 2e-21
1bp0_A316 Thymidylate Synthase R23i Mutant Length = 316 2e-21
1tsx_A316 Thymidylate Synthase R179e Mutant Length = 316 2e-21
1tsv_A316 Thymidylate Synthase R179a Mutant Length = 316 2e-21
1tsy_A316 Thymidylate Synthase R179k Mutant Length = 316 2e-21
1bp6_A316 Thymidylate Synthase R23i, R179t Double Mutant Leng 2e-21
1hw3_A313 Structure Of Human Thymidylate Synthase Suggests Ad 2e-21
3n5g_A325 Crystal Structure Of Histidine-Tagged Human Thymidy 2e-21
3egy_X313 Crystal Structure Of Human Thymidyalte Synthase A19 2e-21
3n5e_A325 Crystal Structure Of Human Thymidylate Synthase Bou 2e-21
3ebu_A313 Replacement Of Val3 In Human Thymidylate Synthase A 3e-21
1hw4_A355 Structure Of Thymidylate Synthase Suggests Advantag 3e-21
4e28_A325 Structure Of Human Thymidylate Synthase In Inactive 3e-21
3n5e_B325 Crystal Structure Of Human Thymidylate Synthase Bou 3e-21
3ehi_X313 Crystal Structure Of Human Thymidyalte Synthase M19 3e-21
2rd8_B313 Human Thymidylate Synthase Stabilized In Active Con 3e-21
3eaw_X313 Replacement Of Val3 In Human Thymidylate Synthase A 3e-21
2rd8_A313 Human Thymidylate Synthase Stabilized In Active Con 3e-21
3gh2_X313 Replacement Of Val3 In Human Thymidylate Synthase A 3e-21
1ju6_A313 Human Thymidylate Synthase Complex With Dump And Ly 4e-21
1hzw_A290 Crystal Structure Of Human Thymidylate Synthase Len 4e-21
3ef9_A313 Replacement Of Val3 In Human Thymidylate Synthase A 4e-21
3gg5_A313 Replacement Of Val3 In Human Thymidylate Synthase A 4e-21
3edw_X313 Replacement Of Val3 In Human Thymidylate Synthase A 4e-21
1hvy_A288 Human Thymidylate Synthase Complexed With Dump And 4e-21
3ed7_A295 Replacement Of Val3 In Human Thymidylate Synthase A 4e-21
4gyh_A318 Structure Of Human Thymidylate Synthase At High Sal 4e-21
1tda_A315 Structures Of Thymidylate Synthase With A C-Termina 5e-21
2g86_A316 L. Casei Thymidylate Synthase Y261f In Complex With 5e-21
1njc_A316 Thymidylate Synthase, Mutation, N229d With 2'-Deoxy 5e-21
3ihi_A307 Crystal Structure Of Mouse Thymidylate Synthase Len 5e-21
1rts_A307 Thymidylate Synthase From Rat In Ternary Complex Wi 5e-21
1jmi_A316 Contributions Of Orientation And Hydrogen Bonding T 7e-21
2g8d_A316 Lactobacillus Casei Thymidylate Synthase Y261w-dump 8e-21
1jmg_A316 Contributions Of Orientation And Hydrogen Bonding T 9e-21
1jmf_A316 Contributions Of Orientation And Hydrogen Bonding T 1e-20
2g8a_A316 Lactobacillus Casei Y261m In Complex With Substrate 1e-20
2g89_A316 L. Casei Thymidylate Synthase Y261a In Complex With 2e-20
1nja_A316 Thymidylate Synthase, Mutation, N229c With 2'-deoxy 2e-20
1jmh_A316 Contributions Of Orientation And Hydrogen Bonding T 2e-20
3ix6_A360 Crystal Structure Of Thymidylate Synthase Thya From 6e-20
4dq1_A321 Thymidylate Synthase From Staphylococcus Aureus. Le 2e-18
3kgb_A294 Crystal Structure Of Thymidylate Synthase 12 FROM E 4e-16
1ci7_A297 Ternary Complex Of Thymidylate Synthase From Pneumo 2e-15
2h2q_A521 Crystal Structure Of Trypanosoma Cruzi Dihydrofolat 1e-12
3inv_A521 Trypanosoma Cruzi Dihydrofolate Reductase-Thymidyla 2e-12
1tis_A286 Crystal Structure Of Thymidylate Synthase From T4 P 3e-12
3dl6_A521 Crystal Structure Of The A287fS290G ACTIVE SITE MUT 2e-11
3dl5_A521 Crystal Structure Of The A287f Active Site Mutant O 2e-11
1qzf_A521 Crystal Structure Of Dhfr-Ts From Cryptosporidium H 2e-11
3hj3_A521 Crystal Structure Of The Chts-Dhfr F207a Non-Active 2e-11
2oip_A519 Crystal Structure Of The S290g Active Site Mutant O 2e-11
1bko_A278 Thermostable Thymidylate Synthase A From Bacillus S 5e-11
1b02_A279 Crystal Structure Of Thymidylate Synthase A From Ba 5e-11
3um5_A608 Double Mutant (A16v+s108t) Plasmodium Falciparum Di 2e-10
3qgt_A608 Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed 2e-10
3jsu_A608 Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium 2e-10
1j3i_C328 Wild-Type Plasmodium Falciparum Dihydrofolate Reduc 2e-10
3i3r_A511 X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE 3e-10
3nrr_A515 Co-Crystal Structure Of Dihydrofolate Reductase-Thy 4e-10
2aaz_B317 Cryptococcus Neoformans Thymidylate Synthase Comple 5e-10
3v8h_A327 Crystal Structure Of Thymidylate Synthase From Burk 6e-06
>pdb|1NCE|A Chain A, Crystal Structure Of A Ternary Complex Of E. Coli Thymidylate Synthase D169c With Dump And The Antifolate Cb3717 Length = 264 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (70%)
Query: 103 CETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLP 162
           C  + LPFNIASY+LL+H++A +  L+VGDF+WTGGD HLY NH+DQ   QL R P  LP
Sbjct: 169 CVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLP 228
Query: 163 NLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIAI 198
            L I  KP+S  DY FEDF+I  Y+P   I AP+AI
Sbjct: 229 KLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI 264
>pdb|1EVF|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia Coli Length = 264 Back     alignment and structure
>pdb|1EV5|A Chain A, Crystal Structure Analysis Of Ala167 Mutant Of Escherichia Coli Length = 264 Back     alignment and structure
>pdb|1EV8|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia Coli Length = 264 Back     alignment and structure
>pdb|1EVG|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia Coli With Unmodified Catalytic Cysteine Length = 264 Back     alignment and structure
>pdb|3BGX|A Chain A, E. Coli Thymidylate Synthase C146s Mutant Complexed With Dtmp And Mtf Length = 264 Back     alignment and structure
>pdb|1F4D|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase C146s, L143c Covalently Modified At C143 With N-[tosyl-D-Prolinyl]amino- Ethanethiol Length = 264 Back     alignment and structure
>pdb|2VET|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q Complexed With Dump Length = 264 Back     alignment and structure
>pdb|1TLC|A Chain A, Thymidylate Synthase Complexed With Dgmp And Folate Analog 1843u89 Length = 265 Back     alignment and structure
>pdb|2BBQ|A Chain A, Structural Basis For Recognition Of Polyglutamyl Folates By Thymidylate Synthase Length = 264 Back     alignment and structure
>pdb|1AIQ|A Chain A, Crystal Structure Of Thymidylate Synthase R126e Mutant Length = 264 Back     alignment and structure
>pdb|1FFL|A Chain A, Crystal Structure Of The Apo-Thymidylate Synthase R166q Mutant Length = 264 Back     alignment and structure
>pdb|1JG0|A Chain A, Crystal Structure Of Escherichia Coli Thymidylate Synthase Complexed With 2'-Deoxyuridine-5'-Monophosphate And N,O-Didansyl-L-Tyrosine Length = 264 Back     alignment and structure
>pdb|2VF0|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q Complexed With 5no2dump And Bw1843u89 Length = 264 Back     alignment and structure
>pdb|1KCE|A Chain A, E. Coli Thymidylate Synthase Mutant E58q In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264 Back     alignment and structure
>pdb|1KZJ|A Chain A, Crystal Structure Of Ects W80g/dump/cb3717 Complex Length = 264 Back     alignment and structure
>pdb|1ZPR|A Chain A, E. Coli Thymidylate Synthase Mutant E58q In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264 Back     alignment and structure
>pdb|2FTN|A Chain A, E. Coli Thymidylate Synthase Y94f Mutant Length = 264 Back     alignment and structure
>pdb|1DNA|A Chain A, D221(169)n Mutant Does Not Promote Opening Of The Cofactor Imidazolidine Ring Length = 264 Back     alignment and structure
>pdb|1F4G|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase Complexed With Sp- 876 Length = 264 Back     alignment and structure
>pdb|2TSC|A Chain A, Structure, Multiple Site Binding, And Segmental Accomodation In Thymidylate Synthase On Binding DUMP AND An Anti-Folate Length = 264 Back     alignment and structure
>pdb|1QQQ|A Chain A, Crystal Structure Analysis Of Ser254 Mutant Of Escherichia Coli Thymidylate Synthase Length = 264 Back     alignment and structure
>pdb|1BQ1|A Chain A, E. Coli Thymidylate Synthase Mutant N177a In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264 Back     alignment and structure
>pdb|3BFI|A Chain A, E. Coli Thymidylate Synthase Y209m Mutant Complexed With 5-nitro-dump Length = 264 Back     alignment and structure
>pdb|4F2V|A Chain A, Crystal Structure Of De Novo Designed Serine Hydrolase, Northeast Structural Genomics Consortium (Nesg) Target Or165 Length = 272 Back     alignment and structure
>pdb|3QJ7|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Thymidylate Synthase (Thya) Bound To Dump Length = 264 Back     alignment and structure
>pdb|3UWL|B Chain B, Crystal Structure Of Enteroccocus Faecalis Thymidylate Synthase (efts) In Complex With 5-formyl Tetrahydrofolate Length = 315 Back     alignment and structure
>pdb|3UWL|A Chain A, Crystal Structure Of Enteroccocus Faecalis Thymidylate Synthase (efts) In Complex With 5-formyl Tetrahydrofolate Length = 315 Back     alignment and structure
>pdb|1VZB|A Chain A, L. Casei Thymidylate Synthase Mutant E60q Binary Complex With Dump Length = 316 Back     alignment and structure
>pdb|1BPJ|A Chain A, Thymidylate Synthase R178t, R179t Double Mutant Length = 316 Back     alignment and structure
>pdb|1VZA|A Chain A, Thymidylate Synthase E60d Mutant Binary Complex With 2'- Deoxyuridine 5'-Monophosphate (Dump) Length = 316 Back     alignment and structure
>pdb|1LCA|A Chain A, Lactobacillus Casei Thymidylate Synthase Ternary Complex With Dump And Cb3717 Length = 316 Back     alignment and structure
>pdb|1BO7|A Chain A, Thymidylate Synthase R179t Mutant Length = 316 Back     alignment and structure
>pdb|1BO8|A Chain A, Thymidylate Synthase R178t Mutant Length = 316 Back     alignment and structure
>pdb|1BP0|A Chain A, Thymidylate Synthase R23i Mutant Length = 316 Back     alignment and structure
>pdb|1TSX|A Chain A, Thymidylate Synthase R179e Mutant Length = 316 Back     alignment and structure
>pdb|1TSV|A Chain A, Thymidylate Synthase R179a Mutant Length = 316 Back     alignment and structure
>pdb|1TSY|A Chain A, Thymidylate Synthase R179k Mutant Length = 316 Back     alignment and structure
>pdb|1BP6|A Chain A, Thymidylate Synthase R23i, R179t Double Mutant Length = 316 Back     alignment and structure
>pdb|1HW3|A Chain A, Structure Of Human Thymidylate Synthase Suggests Advantages Of Chemotherapy With Noncompetitive Inhibitors Length = 313 Back     alignment and structure
>pdb|3N5G|A Chain A, Crystal Structure Of Histidine-Tagged Human Thymidylate Synthase Length = 325 Back     alignment and structure
>pdb|3EGY|X Chain X, Crystal Structure Of Human Thymidyalte Synthase A191k With Loop 181- 197 Stabilized In The Inactive Conformation Length = 313 Back     alignment and structure
>pdb|3N5E|A Chain A, Crystal Structure Of Human Thymidylate Synthase Bound To A Peptide Inhibitor Length = 325 Back     alignment and structure
>pdb|3EBU|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>pdb|1HW4|A Chain A, Structure Of Thymidylate Synthase Suggests Advantages Of Chemotherapy With Noncompetitive Inhibitors Length = 355 Back     alignment and structure
>pdb|4E28|A Chain A, Structure Of Human Thymidylate Synthase In Inactive Conformation With A Novel Non-Peptidic Inhibitor Length = 325 Back     alignment and structure
>pdb|3N5E|B Chain B, Crystal Structure Of Human Thymidylate Synthase Bound To A Peptide Inhibitor Length = 325 Back     alignment and structure
>pdb|3EHI|X Chain X, Crystal Structure Of Human Thymidyalte Synthase M190k With Loop 181- 197 Stabilized In The Inactive Conformation Length = 313 Back     alignment and structure
>pdb|2RD8|B Chain B, Human Thymidylate Synthase Stabilized In Active Conformation By R163k Mutation: Asymmetry And Reactivity Of Cys195 Length = 313 Back     alignment and structure
>pdb|3EAW|X Chain X, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>pdb|2RD8|A Chain A, Human Thymidylate Synthase Stabilized In Active Conformation By R163k Mutation: Asymmetry And Reactivity Of Cys195 Length = 313 Back     alignment and structure
>pdb|3GH2|X Chain X, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>pdb|1JU6|A Chain A, Human Thymidylate Synthase Complex With Dump And Ly231514, A Pyrrolo(2,3-D)pyrimidine-Based Antifolate Length = 313 Back     alignment and structure
>pdb|1HZW|A Chain A, Crystal Structure Of Human Thymidylate Synthase Length = 290 Back     alignment and structure
>pdb|3EF9|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>pdb|3GG5|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>pdb|3EDW|X Chain X, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>pdb|1HVY|A Chain A, Human Thymidylate Synthase Complexed With Dump And Raltitrexed, An Antifolate Drug, Is In The Closed Conformation Length = 288 Back     alignment and structure
>pdb|3ED7|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 295 Back     alignment and structure
>pdb|4GYH|A Chain A, Structure Of Human Thymidylate Synthase At High Salt Conditions Length = 318 Back     alignment and structure
>pdb|1TDA|A Chain A, Structures Of Thymidylate Synthase With A C-Terminal Deletion: Role Of The C-Terminus In Alignment Of DUMP AND CH2H4FOLATE Length = 315 Back     alignment and structure
>pdb|2G86|A Chain A, L. Casei Thymidylate Synthase Y261f In Complex With Substrate, Dump Length = 316 Back     alignment and structure
>pdb|1NJC|A Chain A, Thymidylate Synthase, Mutation, N229d With 2'-Deoxycytidine 5'- Monophosphate (Dcmp) Length = 316 Back     alignment and structure
>pdb|3IHI|A Chain A, Crystal Structure Of Mouse Thymidylate Synthase Length = 307 Back     alignment and structure
>pdb|1RTS|A Chain A, Thymidylate Synthase From Rat In Ternary Complex With Dump And Tomudex Length = 307 Back     alignment and structure
>pdb|1JMI|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn- 229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>pdb|2G8D|A Chain A, Lactobacillus Casei Thymidylate Synthase Y261w-dump Complex Length = 316 Back     alignment and structure
>pdb|1JMG|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn- 229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>pdb|1JMF|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn- 229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>pdb|2G8A|A Chain A, Lactobacillus Casei Y261m In Complex With Substrate, Dump Length = 316 Back     alignment and structure
>pdb|2G89|A Chain A, L. Casei Thymidylate Synthase Y261a In Complex With Substrate, Dump Length = 316 Back     alignment and structure
>pdb|1NJA|A Chain A, Thymidylate Synthase, Mutation, N229c With 2'-deoxycytidine 5'- Monophosphate (dcmp) Length = 316 Back     alignment and structure
>pdb|1JMH|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn- 229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>pdb|3IX6|A Chain A, Crystal Structure Of Thymidylate Synthase Thya From Brucella Melitensis Length = 360 Back     alignment and structure
>pdb|4DQ1|A Chain A, Thymidylate Synthase From Staphylococcus Aureus. Length = 321 Back     alignment and structure
>pdb|3KGB|A Chain A, Crystal Structure Of Thymidylate Synthase 12 FROM ENCEPHALITOZOON Cuniculi At 2.2 A Resolution Length = 294 Back     alignment and structure
>pdb|1CI7|A Chain A, Ternary Complex Of Thymidylate Synthase From Pneumocystis Carinii Length = 297 Back     alignment and structure
>pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase- Thymidylate Synthase Length = 521 Back     alignment and structure
>pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Complexed With Nadph, Dump And C-448 Antifolate Length = 521 Back     alignment and structure
>pdb|1TIS|A Chain A, Crystal Structure Of Thymidylate Synthase From T4 Phage Length = 286 Back     alignment and structure
>pdb|3DL6|A Chain A, Crystal Structure Of The A287fS290G ACTIVE SITE MUTANT OF Ts-Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|3DL5|A Chain A, Crystal Structure Of The A287f Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|1QZF|A Chain A, Crystal Structure Of Dhfr-Ts From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|3HJ3|A Chain A, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521 Back     alignment and structure
>pdb|2OIP|A Chain A, Crystal Structure Of The S290g Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 519 Back     alignment and structure
>pdb|1BKO|A Chain A, Thermostable Thymidylate Synthase A From Bacillus Subtilis Length = 278 Back     alignment and structure
>pdb|1B02|A Chain A, Crystal Structure Of Thymidylate Synthase A From Bacillus Subtilis Length = 279 Back     alignment and structure
>pdb|3UM5|A Chain A, Double Mutant (A16v+s108t) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts-T994) COMPLEXED WITH Pyrimethamine, Nadph, And Dump Length = 608 Back     alignment and structure
>pdb|3QGT|A Chain A, Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed With Nadph, Dump And Pyrimethamine Length = 608 Back     alignment and structure
>pdb|3JSU|A Chain A, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And Dump Length = 608 Back     alignment and structure
>pdb|1J3I|C Chain C, Wild-Type Plasmodium Falciparum Dihydrofolate Reductase- Thymidylate Synthase (Pfdhfr-Ts) Complexed With Wr99210, Nadph, And Dump Length = 328 Back     alignment and structure
>pdb|3I3R|A Chain A, X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE SYNTHASE FROM Babesia Bovis At 2.35a Resolution Length = 511 Back     alignment and structure
>pdb|3NRR|A Chain A, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515 Back     alignment and structure
>pdb|3V8H|A Chain A, Crystal Structure Of Thymidylate Synthase From Burkholderia Thailandensis Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2g8o_A264 TS, tsase, thymidylate synthase; methyltransferase 5e-47
3ed7_A295 Tsase, TS, thymidylate synthase; transferase, meth 2e-46
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 2e-46
1hw4_A355 TS, thymidylate synthase; methyltransferase, trans 4e-46
1f28_A297 Thymidylate synthase; beta-sheet, protein-inhibito 5e-46
1j3k_C328 Bifunctional dihydrofolate reductase-thymidylate s 8e-46
1bkp_A278 Thymidylate synthase A; methyltransferase, DTMP sy 2e-45
3ik0_A316 TS, tsase, thymidylate synthase; transferase, nucl 5e-45
3qj7_A264 TS, tsase, thymidylate synthase; thymidilate synth 6e-45
2aaz_A317 TS, tsase, thymidylate synthase; methyl transferas 3e-44
3kgb_A294 Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI 4e-44
4dq1_A321 TS, tsase, thymidylate synthase; structural genomi 1e-43
1tis_A286 Thymidylate synthase; transferase(methyltransferas 1e-43
3hj3_A521 Chain A, crystal structure of DHFR; TS, enzyme, cr 2e-43
3qg2_A608 Bifunctional dihydrofolate reductase-thymidylate; 3e-43
3irm_A521 Bifunctional dihydrofolate reductase-thymidylate; 6e-43
3nrr_A515 Dihydrofolate reductase-thymidylate synthase; stru 9e-43
3v8h_A327 TS, tsase, thymidylate synthase; ssgcid, structura 2e-40
1b5e_A246 Protein (deoxycytidylate hydroxymethylase); DNTP s 2e-25
>2g8o_A TS, tsase, thymidylate synthase; methyltransferase, DUMP, antifolate, high-resolution, ternar complex, beta sheet, alpha/beta protein; HET: CXM UMP CB3; 1.30A {Escherichia coli} SCOP: d.117.1.1 PDB: 1aob_A* 1f4c_A* 1f4e_A* 1f4f_A* 1jtq_A* 1jtu_A* 1jut_A* 1kce_A* 1kzi_A* 1tls_A* 1tsn_A* 1f4b_A* 2bbq_A* 2ftq_A* 2a9w_A* 2kce_A* 3b9h_A* 3bhl_A* 3bhr_A* 3tms_A ... Length = 264 Back     alignment and structure
 Score =  154 bits (391), Expect = 5e-47
 Identities = 54/91 (59%), Positives = 66/91 (72%)

Query: 108 LPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTIL 167
           LPFNIASY+LL+H++A +  L+VGDF+WTGGD HLY NH+DQ   QL R P  LP L I 
Sbjct: 174 LPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIK 233

Query: 168 CKPKSSLDYNFEDFQINSYNPQKSIYAPIAI 198
            KP+S  DY FEDF+I  Y+P   I AP+AI
Sbjct: 234 RKPESIFDYRFEDFEIEGYDPHPGIKAPVAI 264
>3ed7_A Tsase, TS, thymidylate synthase; transferase, methyltransferase, nucleotide biosynthesis; 1.56A {Homo sapiens} PDB: 3ebu_A* 1hvy_A* 1ypv_A* 1hw3_A* 2onb_A* 3eaw_X* 3gg5_A 3gh0_A 3ef9_A 3edw_X 3ejl_A* 3gh2_X* 2rd8_A* 2rda_A 3h9k_A* 3hb8_A* 3ob7_A* 1ju6_A* 1juj_A* 3egy_X* ... Length = 295 Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Length = 360 Back     alignment and structure
>1hw4_A TS, thymidylate synthase; methyltransferase, transferase; HET: CME; 2.06A {Homo sapiens} SCOP: d.117.1.1 PDB: 3n5e_A 3n5g_A* Length = 355 Back     alignment and structure
>1f28_A Thymidylate synthase; beta-sheet, protein-inhibitor complex, transferase; HET: UMP F89; 1.90A {Pneumocystis carinii} SCOP: d.117.1.1 PDB: 1ci7_A* Length = 297 Back     alignment and structure
>1j3k_C Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: d.117.1.1 PDB: 1j3i_C* 1j3j_C* 3dg8_C* 3dga_C* Length = 328 Back     alignment and structure
>1bkp_A Thymidylate synthase A; methyltransferase, DTMP synthase; 1.70A {Bacillus subtilis} SCOP: d.117.1.1 PDB: 1bko_A 1bsf_A 1bsp_A 1b02_A* Length = 278 Back     alignment and structure
>3ik0_A TS, tsase, thymidylate synthase; transferase, nucleotide synthase, methyltransferase, nucleot biosynthesis; HET: 7C1 UMP; 2.10A {Lactobacillus casei} PDB: 1lcb_A* 1lce_A* 1lca_A* 1thy_A* 1tsl_A* 1tsm_A* 2tdm_A* 3bnz_A* 3byx_A* 3bz0_A* 3c06_A* 3c0a_A* 1nje_A* 3ijz_A* 3ik1_A* 4tms_A 1tsy_A* 1tsz_A 1tdb_A* 1tda_A* ... Length = 316 Back     alignment and structure
>3qj7_A TS, tsase, thymidylate synthase; thymidilate synthase, structural genomics, TB structural GEN consortium, TBSGC, transferase; HET: UMP SPM; 2.50A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3kgb_A Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI, UW, decode, methyltransferase, nucleotide biosynt transferase, structural genomics; 2.20A {Encephalitozoon cuniculi} Length = 294 Back     alignment and structure
>4dq1_A TS, tsase, thymidylate synthase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: UMP; 2.71A {Staphylococcus aureus} Length = 321 Back     alignment and structure
>1tis_A Thymidylate synthase; transferase(methyltransferase); 2.70A {Enterobacteria phage T4} SCOP: d.117.1.1 Length = 286 Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Length = 521 Back     alignment and structure
>3qg2_A Bifunctional dihydrofolate reductase-thymidylate; pyrimethamine, antifolate resistance, oxidoreductase, transferase; HET: CP6 NDP UMP; 2.30A {Plasmodium falciparum} PDB: 3jsu_A* 3qgt_A* Length = 608 Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Length = 521 Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Length = 515 Back     alignment and structure
>3v8h_A TS, tsase, thymidylate synthase; ssgcid, structural genomics, seattle S genomics center for infectious disease, transferase; HET: CIT; 1.65A {Burkholderia thailandensis} Length = 327 Back     alignment and structure
>1b5e_A Protein (deoxycytidylate hydroxymethylase); DNTP synthesizing complex, transferase; HET: DCM; 1.60A {Enterobacteria phage T4} SCOP: d.117.1.1 PDB: 1b49_A* 1b5d_A* Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1f28_A297 Thymidylate synthase; beta-sheet, protein-inhibito 99.78
3ed7_A295 Tsase, TS, thymidylate synthase; transferase, meth 99.78
2g8o_A264 TS, tsase, thymidylate synthase; methyltransferase 99.77
1bkp_A278 Thymidylate synthase A; methyltransferase, DTMP sy 99.77
3uwl_A315 TS, tsase, thymidylate synthase; methyltransferase 99.77
1j3k_C328 Bifunctional dihydrofolate reductase-thymidylate s 99.77
1hw4_A355 TS, thymidylate synthase; methyltransferase, trans 99.76
3qj7_A264 TS, tsase, thymidylate synthase; thymidilate synth 99.76
2aaz_A317 TS, tsase, thymidylate synthase; methyl transferas 99.76
4dq1_A321 TS, tsase, thymidylate synthase; structural genomi 99.76
3kgb_A294 Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI 99.75
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 99.74
3v8h_A327 TS, tsase, thymidylate synthase; ssgcid, structura 99.73
3nrr_A515 Dihydrofolate reductase-thymidylate synthase; stru 99.72
3hj3_A521 Chain A, crystal structure of DHFR; TS, enzyme, cr 99.72
3irm_A521 Bifunctional dihydrofolate reductase-thymidylate; 99.72
3qg2_A608 Bifunctional dihydrofolate reductase-thymidylate; 99.71
1tis_A286 Thymidylate synthase; transferase(methyltransferas 99.68
1b5e_A246 Protein (deoxycytidylate hydroxymethylase); DNTP s 92.73
>1f28_A Thymidylate synthase; beta-sheet, protein-inhibitor complex, transferase; HET: UMP F89; 1.90A {Pneumocystis carinii} SCOP: d.117.1.1 PDB: 1ci7_A* Back     alignment and structure
Probab=99.78  E-value=3.5e-21  Score=163.26  Aligned_cols=95  Identities=39%  Similarity=0.743  Sum_probs=92.2

Q ss_pred             hhhccchhHHHHHHHHHHHhhhcCchHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCeeeecCCCCCCCCCcccCeEE
Q psy2410         104 ETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQI  183 (198)
Q Consensus       104 ~~l~n~~Npk~~~~~~~~~~~~~~~~~~~~v~~~~~~~vya~~~~~lr~~L~r~p~~~~~l~i~~~~~~~~d~~~~~~~~  183 (198)
                      .+++.|.|+..++++..++++.++..++.++|+++++|+|..+.++++++|+|+|+..|++.|||++|||+||++|||+|
T Consensus       203 ~~lG~pfNiasyalL~~miA~~~gl~~G~~~h~~gdaHIY~nh~e~v~~qL~R~p~~~P~l~i~~~~~~i~d~~~~Df~l  282 (297)
T 1f28_A          203 MGLGVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDHIEALQQQLTRSPRPFPTLSLNRSITDIEDFTLDDFNI  282 (297)
T ss_dssp             TTTHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEEEEEEEEHHHHHHHHTGGGSCCCCCCEEEECSCCCSGGGCCGGGEEE
T ss_pred             HHhhhhhhHHHHHHHHHHHHHHhCCeeEEEEEEeeeeEeeHhHHHHHHHHHhcCCCCCCEeeeCCCCCchhhCChhHEEE
Confidence            67788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCCCCCCccccC
Q psy2410         184 NSYNPQKSIYAPIAI  198 (198)
Q Consensus       184 ~~y~~~~~i~~~~a~  198 (198)
                      +||+|||+||+||||
T Consensus       283 ~~Y~~hp~Ik~~~av  297 (297)
T 1f28_A          283 QNYHPYETIKMKMSI  297 (297)
T ss_dssp             ESCCCCCCCCCCCCC
T ss_pred             eCCCCCCCCcccccC
Confidence            999999999999997
>3ed7_A Tsase, TS, thymidylate synthase; transferase, methyltransferase, nucleotide biosynthesis; 1.56A {Homo sapiens} SCOP: d.117.1.1 PDB: 3ebu_A* 1hvy_A* 1ypv_A* 1hw3_A* 2onb_A* 3eaw_X* 3gg5_A 3gh0_A 3ef9_A 3edw_X 3ejl_A* 3gh2_X* 4gyh_A 4h1i_A 2rd8_A* 2rda_A 3h9k_A* 3hb8_A* 3ob7_A* 1ju6_A* ... Back     alignment and structure
>2g8o_A TS, tsase, thymidylate synthase; methyltransferase, DUMP, antifolate, high-resolution, ternar complex, beta sheet, alpha/beta protein; HET: CXM UMP CB3; 1.30A {Escherichia coli} SCOP: d.117.1.1 PDB: 1aob_A* 1f4c_A* 1f4e_A* 1f4f_A* 1jtq_A* 1jtu_A* 1jut_A* 1kce_A* 1kzi_A* 1tls_A* 1tsn_A* 1f4b_A* 2bbq_A* 2ftq_A* 2a9w_A* 2kce_A* 3b9h_A* 3bhl_A* 3bhr_A* 3tms_A ... Back     alignment and structure
>1bkp_A Thymidylate synthase A; methyltransferase, DTMP synthase; 1.70A {Bacillus subtilis} SCOP: d.117.1.1 PDB: 1bko_A 1bsf_A 1bsp_A 1b02_A* Back     alignment and structure
>3uwl_A TS, tsase, thymidylate synthase; methyltransferase, transferase; HET: CME FOZ; 2.07A {Enterococcus faecalis} PDB: 3ik0_A* 1lcb_A* 1lce_A* 1lca_A* 1thy_A* 1tsl_A* 1tsm_A* 2tdm_A* 3bnz_A* 3byx_A* 3bz0_A* 3c06_A* 3c0a_A* 1nje_A* 3ijz_A* 3ik1_A* 4tms_A 1tsy_A* 1tsz_A 2g86_A* ... Back     alignment and structure
>1j3k_C Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: d.117.1.1 PDB: 1j3i_C* 1j3j_C* 3dg8_C* 3dga_C* Back     alignment and structure
>1hw4_A TS, thymidylate synthase; methyltransferase, transferase; HET: CME; 2.06A {Homo sapiens} SCOP: d.117.1.1 PDB: 3n5e_A 3n5g_A* Back     alignment and structure
>3qj7_A TS, tsase, thymidylate synthase; thymidilate synthase, structural genomics, TB structural GEN consortium, TBSGC, transferase; HET: UMP SPM; 2.50A {Mycobacterium tuberculosis} SCOP: d.117.1.1 Back     alignment and structure
>4dq1_A TS, tsase, thymidylate synthase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: UMP; 2.71A {Staphylococcus aureus} Back     alignment and structure
>3kgb_A Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI, UW, decode, methyltransferase, nucleotide biosynt transferase, structural genomics; 2.20A {Encephalitozoon cuniculi} SCOP: d.117.1.1 Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>3v8h_A TS, tsase, thymidylate synthase; ssgcid, structural genomics, seattle S genomics center for infectious disease, transferase; HET: CIT; 1.65A {Burkholderia thailandensis} Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Back     alignment and structure
>3qg2_A Bifunctional dihydrofolate reductase-thymidylate; pyrimethamine, antifolate resistance, oxidoreductase, transferase; HET: CP6 NDP UMP; 2.30A {Plasmodium falciparum} PDB: 3jsu_A* 4dp3_A* 4dph_A* 3qgt_A* 3um8_A* 4dpd_A* 3um5_A* 3um6_A* Back     alignment and structure
>1tis_A Thymidylate synthase; transferase(methyltransferase); 2.70A {Enterobacteria phage T4} SCOP: d.117.1.1 Back     alignment and structure
>1b5e_A Protein (deoxycytidylate hydroxymethylase); DNTP synthesizing complex, transferase; HET: DCM; 1.60A {Enterobacteria phage T4} SCOP: d.117.1.1 PDB: 1b49_A* 1b5d_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1tswa_316 d.117.1.1 (A:) Thymidylate synthase {Lactobacillus 6e-29
d1j3kc_326 d.117.1.1 (C:) Bifunctional enzyme dihydrofolate r 2e-26
d1f28a_295 d.117.1.1 (A:) Thymidylate synthase {Pneumocystis 3e-26
d1hvya_288 d.117.1.1 (A:) Thymidylate synthase {Human (Homo s 3e-26
d2g8oa1264 d.117.1.1 (A:1-264) Thymidylate synthase {Escheric 9e-26
d1seja2289 d.117.1.1 (A:233-521) Bifunctional enzyme dihydrof 2e-25
d1bkpa_278 d.117.1.1 (A:) Thymidylate synthase {Bacillus subt 6e-23
d1tisa_286 d.117.1.1 (A:) Thymidylate synthase {Bacteriophage 5e-20
d1b5ea_241 d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophag 3e-13
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 0.002
>d1tswa_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]} Length = 316 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Thymidylate synthase
species: Lactobacillus casei [TaxId: 1582]

 Score =  107 bits (268), Expect = 6e-29
 Identities = 47/121 (38%), Positives = 71/121 (58%), Gaps = 3/121 (2%)

Query: 81  WLMYTSFQMWCASINKKDSTYICET---IRLPFNIASYSLLIHIIAHETGLKVGDFIWTG 137
              +T +Q +          Y       + +PFNIASY+LL H++AHE GL+VG+FI T 
Sbjct: 196 PPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTF 255

Query: 138 GDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQINSYNPQKSIYAPIA 197
           GD HLY+NHLDQ ++QL R P   P L +        D++ +D ++ +Y+P  +I AP+A
Sbjct: 256 GDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVA 315

Query: 198 I 198
           +
Sbjct: 316 V 316
>d1j3kc_ d.117.1.1 (C:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 326 Back     information, alignment and structure
>d1f28a_ d.117.1.1 (A:) Thymidylate synthase {Pneumocystis carinii [TaxId: 4754]} Length = 295 Back     information, alignment and structure
>d1hvya_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2g8oa1 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]} Length = 264 Back     information, alignment and structure
>d1seja2 d.117.1.1 (A:233-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]} Length = 289 Back     information, alignment and structure
>d1bkpa_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]} Length = 278 Back     information, alignment and structure
>d1tisa_ d.117.1.1 (A:) Thymidylate synthase {Bacteriophage T4 [TaxId: 10665]} Length = 286 Back     information, alignment and structure
>d1b5ea_ d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]} Length = 241 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1f28a_295 Thymidylate synthase {Pneumocystis carinii [TaxId: 99.74
d1seja2289 Bifunctional enzyme dihydrofolate reductase-thymid 99.71
d2g8oa1264 Thymidylate synthase {Escherichia coli [TaxId: 562 99.7
d1bkpa_278 Thymidylate synthase {Bacillus subtilis [TaxId: 14 99.69
d1hvya_288 Thymidylate synthase {Human (Homo sapiens) [TaxId: 99.69
d1tswa_316 Thymidylate synthase {Lactobacillus casei [TaxId: 99.69
d1j3kc_326 Bifunctional enzyme dihydrofolate reductase-thymid 99.67
d1tisa_286 Thymidylate synthase {Bacteriophage T4 [TaxId: 106 99.49
>d1f28a_ d.117.1.1 (A:) Thymidylate synthase {Pneumocystis carinii [TaxId: 4754]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Thymidylate synthase
species: Pneumocystis carinii [TaxId: 4754]

Probab=99.74  E-value=2.5e-20  Score=155.99  Aligned_cols=96  Identities=39%  Similarity=0.725  Sum_probs=92.8

Q ss_pred             hhhhccchhHHHHHHHHHHHhhhcCchHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCeeeecCCCCCCCCCcccCeE
Q psy2410         103 CETIRLPFNIASYSLLIHIIAHETGLKVGDFIWTGGDCHLYLNHLDQARKQLLRNPGSLPNLTILCKPKSSLDYNFEDFQ  182 (198)
Q Consensus       103 ~~~l~n~~Npk~~~~~~~~~~~~~~~~~~~~v~~~~~~~vya~~~~~lr~~L~r~p~~~~~l~i~~~~~~~~d~~~~~~~  182 (198)
                      +.+++.|.|+..|+++..++++.++..++.+++.++++|+|..+.++++++++|+|+..|+++|++++++|+||++|||+
T Consensus       200 D~~LG~pfNiasyalL~~~iA~~~gl~~g~~~~~~gd~HIY~nH~e~v~eqL~R~P~~~P~L~i~~~~~~i~d~~~~Df~  279 (295)
T d1f28a_         200 DMGLGVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDHIEALQQQLTRSPRPFPTLSLNRSITDIEDFTLDDFN  279 (295)
T ss_dssp             ETTTHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEEEEEEEEHHHHHHHHTGGGSCCCCCCEEEECSCCCSGGGCCGGGEE
T ss_pred             hhhhccchhHHHHHHHHHHHHHHhCcccceEEEEecceehHHhHHHHHHHHhcCCCCCCCEEEeCCCCCchhcCchhheE
Confidence            47788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCCCCCCCccccC
Q psy2410         183 INSYNPQKSIYAPIAI  198 (198)
Q Consensus       183 ~~~y~~~~~i~~~~a~  198 (198)
                      |+||+|||+||+||||
T Consensus       280 L~~Y~~hp~Ik~~mAV  295 (295)
T d1f28a_         280 IQNYHPYETIKMKMSI  295 (295)
T ss_dssp             EESCCCCCCCCCCCCC
T ss_pred             EECccCCCCccccccC
Confidence            9999999999999997
>d1seja2 d.117.1.1 (A:233-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]} Back     information, alignment and structure
>d2g8oa1 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bkpa_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hvya_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tswa_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j3kc_ d.117.1.1 (C:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tisa_ d.117.1.1 (A:) Thymidylate synthase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure