Psyllid ID: psy2480

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MAALHGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFHLPSGSLT
ccccccccHHEEEEEEcccccccccccccHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccHHHHHHccccccHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEcccccccHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccEEEEcccccEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccc
cccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHcccccHHHHHHHHccEEEEEEEcccccccEccccccHHHHHcccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHcccccHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHcccHHHccccccccc
MAALHGRYATAYCLFtnigddlstplsmqtnekaiaLPVWTTLKSMGQTGIQDILTFNFSLVESVRQKlseypclrilshgpvsgmglkevtsqylpvQTILESVQScvvfqfvpkdagwyTFYTFISSLLcsdagwgpvpayydklnswlgftnigddlstplsmqtnekaiaLPVWTTLKSMGQTGIQDILTFNFSLVESIRQKlseypclrilshgpvsglglkevtsqylpVQTILESVQSCvvfqfvpkdagwgpvpayyDKLNSWLGqilqrdvpsvslnltetaafgtvlricpfecssggdyeSFLVCLDAQvysgsqglfhlpsgslt
MAALHGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSqglfhlpsgslt
MAALHGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFHLPSGSLT
****HGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFH*******
******RYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRIL************VTSQYLPVQTILESVQSCVVFQFVPKDA***********************AYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSH*******LKEVTSQYLPVQTILESVQSCVVF***************YDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFHLP*****
MAALHGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFHLPSGSLT
**ALHGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFHL******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAALHGRYATAYCLFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGDYESFLVCLDAQVYSGSQGLFHLPSGSLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
Q6P996 788 Pyridoxal-dependent decar yes N/A 0.442 0.189 0.253 3e-06
Q99K01 787 Pyridoxal-dependent decar no N/A 0.442 0.189 0.240 8e-05
Q6DF78 782 Pyridoxal-dependent decar N/A N/A 0.397 0.171 0.288 0.0002
Q6P474469 Putative pyridoxal-depend no N/A 0.403 0.289 0.263 0.0002
>sp|Q6P996|PDXD1_HUMAN Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens GN=PDXDC1 PE=1 SV=2 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 17/166 (10%)

Query: 165 SMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGL 224
           S +  +K  ALP+W +L+ +G  G  + +     L + +++ L +   ++IL        
Sbjct: 329 SNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVE------ 382

Query: 225 GLKEVTSQYLPVQTILESVQSCVVFQFVP----KDAGWGPVPAYYDKLNSWLGQILQRDV 280
              E++S  +  +   E   S  VF+ VP      +G G      D LN WLG+ L++ V
Sbjct: 383 --DELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLV 440

Query: 281 PSVSLNLTETAAFGTVLRICPFECSS-----GGDYESFLVCLDAQV 321
           P+  L + +  A GT LR  P   ++     G D +  + C+++++
Sbjct: 441 PASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKL 486

Homo sapiens (taxid: 9606)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q99K01|PDXD1_MOUSE Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Mus musculus GN=Pdxdc1 PE=1 SV=2 Back     alignment and function description
>sp|Q6DF78|PDXD1_XENLA Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Xenopus laevis GN=pdxdc1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P474|PDXD2_HUMAN Putative pyridoxal-dependent decarboxylase domain-containing protein 2 OS=Homo sapiens GN=PDXDC2P PE=5 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
345487629 802 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.183 0.401 5e-24
345487631 741 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.198 0.401 5e-24
345487627 817 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.179 0.401 5e-24
328788766 797 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.184 0.401 6e-24
340728508 800 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.183 0.388 7e-24
380027761 798 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.184 0.407 1e-23
383855170 798 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.184 0.394 3e-23
350424592 798 PREDICTED: pyridoxal-dependent decarboxy 0.436 0.184 0.388 4e-23
242017359 790 group II plp decarboxylase, putative [Pe 0.439 0.187 0.416 1e-21
91089397 790 PREDICTED: similar to CG1486 CG1486-PA [ 0.451 0.192 0.368 4e-21
>gi|345487629|ref|XP_001604406.2| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  118 bits (295), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 92/157 (58%), Gaps = 10/157 (6%)

Query: 175 LPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLG---LKEVTS 231
           LP+WT L+++G+ GI +     F +VE +  K+ ++ C+R+LS  P    G   + E+ S
Sbjct: 372 LPLWTALQALGRDGIVNRFKQCFLVVEELYSKIKKFNCIRLLSQEPGGETGAYTINELLS 431

Query: 232 QYLPVQTILESVQSCVVFQFVPKDAGWGP---VPAYYDKLNSWLGQILQRDVPSVSLNLT 288
             L    +LE V S +VFQFVP +A       VP YYDKLNSWLGQILQRD+ +V + L 
Sbjct: 432 NPLNGPQLLEVVASALVFQFVPPEADMQELQRVPPYYDKLNSWLGQILQRDIENVEIELC 491

Query: 289 ETAAFGTVLRICPFEC----SSGGDYESFLVCLDAQV 321
           E   +G  +RICP E      +  D ++ + CL+ Q+
Sbjct: 492 EIEQYGIAIRICPLESPECPPNSDDVDNVVACLEQQI 528

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345487631|ref|XP_003425731.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345487627|ref|XP_003425730.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328788766|ref|XP_393418.3| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340728508|ref|XP_003402564.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380027761|ref|XP_003697587.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|383855170|ref|XP_003703090.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350424592|ref|XP_003493847.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242017359|ref|XP_002429157.1| group II plp decarboxylase, putative [Pediculus humanus corporis] gi|212514030|gb|EEB16419.1| group II plp decarboxylase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91089397|ref|XP_974004.1| PREDICTED: similar to CG1486 CG1486-PA [Tribolium castaneum] gi|270011423|gb|EFA07871.1| hypothetical protein TcasGA2_TC005445 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
FB|FBgn0031174 852 CG1486 [Drosophila melanogaste 0.175 0.069 0.430 6.2e-12
UNIPROTKB|E7EMH5 697 PDXDC1 "Pyridoxal-dependent de 0.442 0.213 0.253 0.00024
UNIPROTKB|E7EPL4 760 PDXDC1 "Pyridoxal-dependent de 0.442 0.196 0.253 0.00027
UNIPROTKB|H3BNZ1 761 PDXDC1 "Pyridoxal-dependent de 0.442 0.195 0.253 0.00027
UNIPROTKB|J3KNK7 773 PDXDC1 "Pyridoxal-dependent de 0.442 0.192 0.253 0.00027
UNIPROTKB|Q6P996 788 PDXDC1 "Pyridoxal-dependent de 0.442 0.189 0.253 0.00028
UNIPROTKB|H3BND4 806 PDXDC1 "Pyridoxal-dependent de 0.442 0.184 0.253 0.00029
UNIPROTKB|Q86XE2498 PDXDC1 "Pyridoxal-dependent de 0.400 0.271 0.272 0.00053
FB|FBgn0031174 CG1486 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 130 (50.8 bits), Expect = 6.2e-12, Sum P(2) = 6.2e-12
 Identities = 28/65 (43%), Positives = 37/65 (56%)

Query:   263 AYYDKLNSWLGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGG------DYESFLVC 316
             +Y+D+LNSWLGQILQRD P+    + E    G+ +R CP E   G       + ESF   
Sbjct:   483 SYFDRLNSWLGQILQRDCPNFDFEVIEHPTHGSCIRYCPLELGLGEQPPSSENLESFAQS 542

Query:   317 LDAQV 321
             L+A V
Sbjct:   543 LEAHV 547
GO:0019752 "carboxylic acid metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
UNIPROTKB|E7EMH5 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPL4 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BNZ1 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNK7 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P996 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BND4 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86XE2 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
KOG0630|consensus 838 100.0
KOG0630|consensus 838 100.0
PLN02590539 probable tyrosine decarboxylase 99.83
PLN02880490 tyrosine decarboxylase 99.75
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.54
KOG0628|consensus511 99.45
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.17
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.01
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 98.9
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 98.71
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 98.41
PLN02263470 serine decarboxylase 98.17
PLN03032374 serine decarboxylase; Provisional 98.11
PRK02769380 histidine decarboxylase; Provisional 97.89
PLN02590539 probable tyrosine decarboxylase 97.67
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 97.67
KOG0629|consensus510 97.66
PLN02880490 tyrosine decarboxylase 97.33
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 97.18
PRK05367954 glycine dehydrogenase; Provisional 97.02
PRK13520371 L-tyrosine decarboxylase; Provisional 96.91
PRK04366481 glycine dehydrogenase subunit 2; Validated 96.56
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 96.22
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 96.11
PRK10874401 cysteine sulfinate desulfinase; Provisional 95.81
PLN03032374 serine decarboxylase; Provisional 95.67
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 95.44
PRK02769380 histidine decarboxylase; Provisional 95.29
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 95.22
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 95.16
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 95.04
PRK00451447 glycine dehydrogenase subunit 1; Validated 94.97
PLN02263470 serine decarboxylase 94.81
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 94.74
PRK03080378 phosphoserine aminotransferase; Provisional 94.56
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 94.43
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 94.25
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 94.09
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 94.05
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 93.7
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 93.6
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 92.94
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 92.43
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 92.15
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 91.83
PLN02409401 serine--glyoxylate aminotransaminase 91.37
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 91.31
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 90.96
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 90.94
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 90.37
TIGR01814406 kynureninase kynureninase. This model describes ky 90.3
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 90.18
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 90.18
PLN02721353 threonine aldolase 89.9
PLN02414993 glycine dehydrogenase (decarboxylating) 89.88
KOG1383|consensus491 88.33
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 87.21
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 86.53
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 86.42
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 85.77
PRK05367 954 glycine dehydrogenase; Provisional 85.48
PRK12566954 glycine dehydrogenase; Provisional 84.12
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 83.35
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 82.46
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 82.1
PLN02452365 phosphoserine transaminase 82.02
PRK13520371 L-tyrosine decarboxylase; Provisional 80.38
>KOG0630|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.5e-40  Score=326.83  Aligned_cols=277  Identities=18%  Similarity=0.222  Sum_probs=230.0

Q ss_pred             HHHHhhchhhHHHHHhcCchhHHHHHHHHHHHHHHHHHhhccCCceEEeecCCCCCCc--hhhhhhccCCccccccccce
Q psy2480          30 TNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESVRQKLSEYPCLRILSHGPVSGMG--LKEVTSQYLPVQTILESVQS  107 (337)
Q Consensus        30 ~~~kl~aLplW~alQ~Lg~~~I~~ri~~Af~ls~~l~~~L~~~~~I~ils~~~~~~~~--~~d~~~~~~~~~~lfe~~~p  107 (337)
                      ++|||+|||||+++||||+|+|++||++||++|+.|+|+++++++|+++||.|+.+..  +.|.+.+||+|+.||++++|
T Consensus       391 ~rekLdaLp~Wta~q~LggKaIadmienAFll~kilfe~aSa~~eiemig~dn~aelaarl~dn~~sPfdvqalfdaaaP  470 (838)
T KOG0630|consen  391 LREKLDALPLWTALQALGGKAIADMIENAFLLCKILFEGASACEEIEMIGHDNGAELAARLSDNIFSPFDVQALFDAAAP  470 (838)
T ss_pred             HHHhhccchHHHHHHHhcccHHHHHHHHHHHHHHHHHHHhhcCCceeEeccCCHHHHHHHHhhccCCcchHhhhhcccCC
Confidence            8999999999999999999999999999999999999999999999999998888654  99999999999999999999


Q ss_pred             eEEEEeccCCCCCCcc---cccc------ccccccCCCCCCCCcccccchhcccccccccccCCCCcc-ccccccCcchh
Q psy2480         108 CVVFQFVPKDAGWYTF---YTFI------SSLLCSDAGWGPVPAYYDKLNSWLGFTNIGDDLSTPLSM-QTNEKAIALPV  177 (337)
Q Consensus       108 vvvFqf~~~~~~~~~~---~~~~------~~~~~~~~~~~~~~~~~d~ln~WLG~~~~p~V~~~~ld~-q~srr~~AL~l  177 (337)
                      +|.++|+++..-...-   +.+.      .+...++.+...+.+|.|.||.|||+.++|.++.-+.|. +.....+.+.+
T Consensus       471 tVai~~~~~tsIk~a~q~hkaaaaaaddedA~aiaeke~~deaeY~D~LNaWL~d~Llpd~~~f~fdtIE~~gn~GiafR  550 (838)
T KOG0630|consen  471 TVAIFFDGSTSIKLAGQGHKAAAAAADDEDAEAIAEKEKIDEAEYFDRLNAWLGDGLLPDCLNFDFDTIEHGGNHGIAFR  550 (838)
T ss_pred             eEEEEecCceeeeccccccHHHHhhccccchhhcchhhhcchHHHHHHHHHHHhcccccCCCCCCceeeecCCccceeEE
Confidence            9999999976321111   1111      122334556667899999999999999999999777774 55559999999


Q ss_pred             hHHHHh-hCh---------------hhHHHHHHHHHHHHHHHHHHHhhCCCeEEeecCCCCCCcceeeeccccCcccccc
Q psy2480         178 WTTLKS-MGQ---------------TGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILE  241 (337)
Q Consensus       178 W~~Lq~-LG~---------------d~i~~~I~~t~~La~~~~e~L~~~p~LeiL~~~~waglg~v~~~~~~~~~~~~~~  241 (337)
                      ||+|.. +|.               ++++++++.|+.....|.++++-++.++++..++|+|.|+|              
T Consensus       551 fCPLEhgaae~pphidhlerFaqkLea~m~IleaTi~hKakF~eLkd~~~sL~LlPi~eWAGiGaV--------------  616 (838)
T KOG0630|consen  551 FCPLEHGAAEQPPHIDHLERFAQKLEAHMDILEATIKHKAKFIELKDCFDSLRLLPIPEWAGIGAV--------------  616 (838)
T ss_pred             ecccccccccCCCchHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhcccceEEeeccccccccce--------------
Confidence            999988 554               47789999999999999999999999999999999999999              


Q ss_pred             ccceeEEEEecC----CCCC---CCCCcchhhHHHHHHHHHHhhcCCCcceEEEEeeeCc-EEEEEecCCCC--------
Q psy2480         242 SVQSCVVFQFVP----KDAG---WGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFG-TVLRICPFECS--------  305 (337)
Q Consensus       242 ~~lsvVvFRy~P----~~~~---~e~~~~y~D~LNswLgqiL~~~~~~~~~~v~et~~~G-~~LRfcplnp~--------  305 (337)
                              +|.|    ++++   .+..+...+.||--|.+.|......  +.+.+-.-+| .|+||.++...        
T Consensus       617 --------~fiPsivkE~~~e~~nDiaKqeinhLNidLVeaLKStDaA--FS~Gd~Tr~Gl~CVkFGMlsd~kdleeLld  686 (838)
T KOG0630|consen  617 --------CFIPSIVKEGNEEDLNDIAKQEINHLNIDLVEALKSTDAA--FSLGDCTRDGLICVKFGMLSDEKDLEELLD  686 (838)
T ss_pred             --------EecccccccCCHhHhhHHHHHHHhhccHHHHHHHhhhhhh--cccCCccccceeEEEeccccchhhHHHHHH
Confidence                    5555    3332   1233566899999999999887773  5666666566 69999999885        


Q ss_pred             ----ChhHHHHHHHHHHHHHhhhhccccc
Q psy2480         306 ----SGGDYESFLVCLDAQVYSGSQGLFH  330 (337)
Q Consensus       306 ----T~edI~~~v~~L~~~~~il~~t~~~  330 (337)
                          ....|++--+.|+.+.++++++||-
T Consensus       687 lVaqkGKeieenqq~LDslaeiikkGIEA  715 (838)
T KOG0630|consen  687 LVAQKGKEIEENQQVLDSLAEIIKKGIEA  715 (838)
T ss_pred             HHHHhchhhhhHHHHHHHHHHHHHHHHHH
Confidence                2567788888899999999988873

>KOG0630|consensus Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.5 bits (99), Expect = 2e-04
 Identities = 51/297 (17%), Positives = 94/297 (31%), Gaps = 86/297 (28%)

Query: 48  QTGIQDILT---------FNFSLVE-SVRQKLSEYPCLRILSHGPVSGMGLKEVTSQYLP 97
           Q   +DIL+         F+   V+   +  LS+     I+          K+  S  L 
Sbjct: 15  QYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHII--------MSKDAVSGTLR 66

Query: 98  VQTILESVQSCVVFQFVPKDAGWYTFYTFISSLLCSDAGWGPVPAYYDKLNSWLGFTNIG 157
           +   L S Q  +V +FV               +L  +  +                    
Sbjct: 67  LFWTLLSKQEEMVQKFV-------------EEVLRINYKF-------------------- 93

Query: 158 DDLSTPLSMQTNEKAIALPVWTTLKSMGQTGIQDILTFNFS---LVESIRQKLSEY-PCL 213
             L +P+  +  + ++   ++   +       Q    +N S       +RQ L E  P  
Sbjct: 94  --LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAK 151

Query: 214 RILSHGPVSGLGLKEVTSQYLPVQTIL-ESVQSCVVFQ-FVPKDAGWGPVPAYYDKLNSW 271
            +L  G V G G K      + +   L   VQ  + F+ F      W  +    +   + 
Sbjct: 152 NVLIDG-VLGSG-KTW----VALDVCLSYKVQCKMDFKIF------WLNL-KNCNSPETV 198

Query: 272 LGQILQRDVPSVSLNLTETAAFGTVLRICPFECSSGGD----------YESFLVCLD 318
           L ++LQ+ +  +  N T  +   + +        S             YE+ L+ L 
Sbjct: 199 L-EMLQKLLYQIDPNWTSRSDHSSNI---KLRIHSIQAELRRLLKSKPYENCLLVLL 251

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.2
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.19
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.15
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.11
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.1
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.02
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 98.96
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 98.53
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 98.32
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 97.26
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 96.78
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 95.75
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 95.59
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 95.33
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 95.27
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 94.93
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 94.92
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 94.7
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 94.54
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 94.42
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 94.32
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 94.16
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 94.07
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 93.78
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 93.66
2yrr_A353 Aminotransferase, class V; structural genomics, NP 93.4
1iug_A352 Putative aspartate aminotransferase; wild type, py 93.34
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 93.27
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 93.21
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 93.21
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 92.84
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 92.42
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 92.32
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 92.08
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 92.06
3f0h_A376 Aminotransferase; RER070207000802, structural geno 92.04
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 92.03
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 91.57
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 91.34
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 91.3
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 91.27
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 90.85
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 90.85
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 90.54
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 89.73
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 89.55
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 89.34
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 89.21
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 88.23
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 87.7
3qm2_A386 Phosphoserine aminotransferase; structural genomic 87.67
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 87.49
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 87.28
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 86.96
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 86.95
2fnu_A375 Aminotransferase; protein-product complex, structu 86.79
3nra_A407 Aspartate aminotransferase; structural genomics, j 86.69
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 85.8
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 85.1
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 84.93
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 84.58
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 84.35
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 83.96
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 83.69
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 83.45
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 83.24
1svv_A359 Threonine aldolase; structural genomics, structura 82.91
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 82.73
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 82.64
1xi9_A406 Putative transaminase; alanine aminotransferase, s 82.51
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 82.14
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 81.55
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 80.83
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 80.5
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 80.18
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 80.17
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
Probab=99.20  E-value=7.1e-11  Score=117.34  Aligned_cols=123  Identities=14%  Similarity=0.114  Sum_probs=105.4

Q ss_pred             cccccccCcchhhHHHHhhChhhHHHHHHHHHHHHHHHHHHHhhCCCeEEeecCCCCCCcceeeeccccCccccccccce
Q psy2480         166 MQTNEKAIALPVWTTLKSMGQTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQS  245 (337)
Q Consensus       166 ~q~srr~~AL~lW~~Lq~LG~d~i~~~I~~t~~La~~~~e~L~~~p~LeiL~~~~waglg~v~~~~~~~~~~~~~~~~ls  245 (337)
                      ++.+||++++++|.+|+.+|.+++.+++++..++++++.+.|++.|+++++.                       +...+
T Consensus       348 ~~~sr~~~~l~l~~al~~~g~~g~~~~~~~~~~~a~~l~~~L~~~~g~~l~~-----------------------~~~~~  404 (475)
T 3k40_A          348 IPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAA-----------------------EINMG  404 (475)
T ss_dssp             -CCCGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTEEESS-----------------------CCBTT
T ss_pred             ccCCCcccHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEec-----------------------CCceE
Confidence            5678999999999999999999999999999999999999999999999997                       56789


Q ss_pred             eEEEEecCCCCCCCCCcchhhHHHHHHHHHHhhcCCCcceEEEEeeeCc-EEEEEecCCCC-ChhHHHHHHHHHHHHHhh
Q psy2480         246 CVVFQFVPKDAGWGPVPAYYDKLNSWLGQILQRDVPSVSLNLTETAAFG-TVLRICPFECS-SGGDYESFLVCLDAQVYS  323 (337)
Q Consensus       246 vVvFRy~P~~~~~e~~~~y~D~LNswLgqiL~~~~~~~~~~v~et~~~G-~~LRfcplnp~-T~edI~~~v~~L~~~~~i  323 (337)
                      +|+|++.+.           +..|..|.+.|.+.+.   +.+..+...| .++|||..++. |.+||+.+++.|++.++.
T Consensus       405 iv~f~~~~~-----------~~~~~~l~~~L~~~g~---~~~~~~~~~g~~~lR~~~~~~~tt~~di~~~~~~i~~~~~~  470 (475)
T 3k40_A          405 LVCFRLKGS-----------NERNEALLKRINGRGH---IHLVPAKIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAADE  470 (475)
T ss_dssp             EEEEEESSC-----------HHHHHHHHHHHHHHTS---CBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEeCCc-----------hHHHHHHHHHHHhCCc---EEEEeeEECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHH
Confidence            999999642           3346666677776655   6677888766 69999999998 799999999999998876


Q ss_pred             hh
Q psy2480         324 GS  325 (337)
Q Consensus       324 l~  325 (337)
                      +.
T Consensus       471 ~~  472 (475)
T 3k40_A          471 ME  472 (475)
T ss_dssp             HH
T ss_pred             Hh
Confidence            54
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.72
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 98.89
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 97.31
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 96.02
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 95.76
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 95.75
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 95.7
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 95.49
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 95.14
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 95.04
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 93.52
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 92.56
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 92.05
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 91.94
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 90.66
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 87.99
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 85.81
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 85.74
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 85.16
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 82.78
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 82.51
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.72  E-value=2e-17  Score=163.95  Aligned_cols=152  Identities=14%  Similarity=0.159  Sum_probs=131.3

Q ss_pred             CCCCCcccccchhccccccccccc-CC------------------------------CCccccccccCcchhhHHHHhhC
Q psy2480         137 WGPVPAYYDKLNSWLGFTNIGDDL-ST------------------------------PLSMQTNEKAIALPVWTTLKSMG  185 (337)
Q Consensus       137 ~~~~~~~~d~ln~WLG~~~~p~V~-~~------------------------------~ld~q~srr~~AL~lW~~Lq~LG  185 (337)
                      +.+.++++-++-.||+.|.-..+. +|                              ..+++.+||+++|++|++++.+|
T Consensus       291 i~~aDSit~d~HK~l~~P~~~g~~l~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sr~~~al~lw~~l~~~G  370 (476)
T d1js3a_         291 VEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSHQGSGLITDYRHWQLPLGRRFRSLKMWFVFRMYG  370 (476)
T ss_dssp             GGGCSEEEECHHHHSSCCSSCEEEEESCHHHHHGGGC------------CCSCCCGGGSSSCSCCCCTHHHHHHHHHHHH
T ss_pred             CcccceeeecCccccccCCcceeecccchHHHHHHHhcChhhhccccccccccccccccccccchhhHHHHHHHHHHHHh
Confidence            456689999999999999433322 11                              23477899999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHhhCCCeEEeecCCCCCCcceeeeccccCccccccccceeEEEEecCCCCCCCCCcchh
Q psy2480         186 QTGIQDILTFNFSLVESIRQKLSEYPCLRILSHGPVSGLGLKEVTSQYLPVQTILESVQSCVVFQFVPKDAGWGPVPAYY  265 (337)
Q Consensus       186 ~d~i~~~I~~t~~La~~~~e~L~~~p~LeiL~~~~waglg~v~~~~~~~~~~~~~~~~lsvVvFRy~P~~~~~e~~~~y~  265 (337)
                      .+++.+++++.++++++|.+.|++.|+++++.                       ++.+++|||||.|.           
T Consensus       371 ~~g~~~~i~~~~~lA~~l~~~l~~~~~fel~~-----------------------~p~l~iV~Fr~~~~-----------  416 (476)
T d1js3a_         371 VKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCA-----------------------EVTLGLVCFRLKGS-----------  416 (476)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHCTTEEECS-----------------------CCCSSEEEEEESSC-----------
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHhcCCCeEEEC-----------------------CCceEEEEEEccCC-----------
Confidence            99999999999999999999999999999998                       68899999999653           


Q ss_pred             hHHHHHHHHHHhhcCCCcceEEEEeeeCc-EEEEEecCCCC-ChhHHHHHHHHHHHHHhhhh
Q psy2480         266 DKLNSWLGQILQRDVPSVSLNLTETAAFG-TVLRICPFECS-SGGDYESFLVCLDAQVYSGS  325 (337)
Q Consensus       266 D~LNswLgqiL~~~~~~~~~~v~et~~~G-~~LRfcplnp~-T~edI~~~v~~L~~~~~il~  325 (337)
                      |.+|..|.+.|.+++.   ++++.|.++| ++||+|..||. |.+||+.+++.|++.++.|.
T Consensus       417 d~~n~~l~~~l~~~G~---~~~s~t~~~g~~~lR~~i~n~~Tt~~did~~~~~i~~~a~~ll  475 (476)
T d1js3a_         417 DGLNEALLERINSARK---IHLVPCRLRGQFVLRFAICSRKVESGHVRLAWEHIRGLAAELL  475 (476)
T ss_dssp             HHHHHHHHHHHHHHTS---CBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHhcCC---EEEeeeeECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            6789888888888776   8899999977 69999999998 68999999999999998875
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure