Psyllid ID: psy2484


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MEIGSSLNGHVDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRVPPSGYLAQPALPPNCYPLHQY
cccccccccccccHHHHHHHHHHHccEEEEccccHHHHHccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccc
ccccccccccccHHHHHHHHHHHccEEEEEccHHHHHHHHccccccHHHcccccccccccccccccccccEEEEccccHHHHHHcccccccccccccc
meigsslnghvdNVSLLQEICAKYNLWLhlrghnlsslalnshspsplqpghsvslplgtwlnlplslpspartqrvppsgylaqpalppncyplhqy
meigsslnghvDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRVPPSgylaqpalppncyplhqy
MEIGSSLNGHVDNVSLLQEICAKYNLWLHLRGhnlsslalnshspsplQPGHSVSLPLGTWLNLPLSLPSPARTQRVPPSGYLAQPALPPNCYPLHQY
*********HVDNVSLLQEICAKYNLWLHLRGHNLSSL*****************LPLGTWLNLP*********************************
**IGSSLNGHVDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRVPPSGYLAQPALPPNCYPL***
********GHVDNVSLLQEICAKYNLWLHLRGHNLSSLALN***********SVSLPLGTWLNLPLSLPSPARTQRVPPSGYLAQPALPPNCYPLHQY
*****SLNGHVDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRVPPSGYLAQPALPPNCYPL*Q*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIGSSLNGHVDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRVPPSGYLAQPALPPNCYPLHQY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
Q6DF78 782 Pyridoxal-dependent decar N/A N/A 0.581 0.072 0.474 4e-08
A7MBC2 787 Pyridoxal-dependent decar yes N/A 0.632 0.078 0.421 1e-07
Q99K01 787 Pyridoxal-dependent decar no N/A 0.632 0.078 0.421 1e-07
Q6P474 469 Putative pyridoxal-depend yes N/A 0.632 0.132 0.406 2e-07
Q6P996 788 Pyridoxal-dependent decar yes N/A 0.632 0.078 0.406 2e-07
Q66HY8 751 Pyridoxal-dependent decar yes N/A 0.581 0.075 0.423 7e-07
>sp|Q6DF78|PDXD1_XENLA Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Xenopus laevis GN=pdxdc1 PE=2 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 9   GHVDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPSPLQPGH--SVSLPLGTWLNLP 65
           GH D +  L+E+C +YN+WLH+ G NL++LAL   S S L      S++L LG WL LP
Sbjct: 250 GHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSVLAATKCDSMTLTLGPWLGLP 308





Xenopus laevis (taxid: 8355)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|A7MBC2|PDXD1_BOVIN Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Bos taurus GN=PDXDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q99K01|PDXD1_MOUSE Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Mus musculus GN=Pdxdc1 PE=1 SV=2 Back     alignment and function description
>sp|Q6P474|PDXD2_HUMAN Putative pyridoxal-dependent decarboxylase domain-containing protein 2 OS=Homo sapiens GN=PDXDC2P PE=5 SV=3 Back     alignment and function description
>sp|Q6P996|PDXD1_HUMAN Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens GN=PDXDC1 PE=1 SV=2 Back     alignment and function description
>sp|Q66HY8|PDXD1_DANRE Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Danio rerio GN=pdxdc1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
332022029 808 Pyridoxal-dependent decarboxylase domain 0.683 0.082 0.550 2e-13
340728508 800 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.083 0.565 3e-13
350424592 798 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.083 0.565 3e-13
383855170 798 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.083 0.550 3e-13
328788766 797 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.084 0.565 6e-13
380027761 798 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.083 0.565 6e-13
307201067 810 Pyridoxal-dependent decarboxylase domain 0.683 0.082 0.536 1e-12
307168915 823 Pyridoxal-dependent decarboxylase domain 0.683 0.081 0.443 1e-11
345487627 817 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.082 0.521 5e-11
345487629 802 PREDICTED: pyridoxal-dependent decarboxy 0.683 0.083 0.521 5e-11
>gi|332022029|gb|EGI62355.1| Pyridoxal-dependent decarboxylase domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (73%), Gaps = 2/69 (2%)

Query: 2   EIGSSLNGHVDNVSLLQEICAKYNLWLHLRGHNLSSLALNSHSPS-PLQPGHSVSLPLGT 60
           E GS L GH DN++ L+ IC KYN+WLHLRGH+L++LALN+ +   P +   S++LPLGT
Sbjct: 281 EAGSVLTGHCDNITRLRAICDKYNVWLHLRGHSLAALALNNSAKDLPSKIADSITLPLGT 340

Query: 61  WLNLPLSLP 69
           W  +P SLP
Sbjct: 341 WFGIP-SLP 348




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340728508|ref|XP_003402564.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424592|ref|XP_003493847.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383855170|ref|XP_003703090.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328788766|ref|XP_393418.3| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380027761|ref|XP_003697587.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|307201067|gb|EFN80999.1| Pyridoxal-dependent decarboxylase domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307168915|gb|EFN61815.1| Pyridoxal-dependent decarboxylase domain-containing protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345487627|ref|XP_003425730.1| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345487629|ref|XP_001604406.2| PREDICTED: pyridoxal-dependent decarboxylase domain-containing protein 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
FB|FBgn0031174 852 CG1486 [Drosophila melanogaste 0.683 0.078 0.382 4.5e-08
UNIPROTKB|E1C4Q3 794 PDXDC1 "Uncharacterized protei 0.724 0.089 0.310 3.1e-05
ZFIN|ZDB-GENE-040912-16 766 pdxdc1 "pyridoxal-dependent de 0.765 0.097 0.307 0.0001
UNIPROTKB|H3BNL6271 PDXDC1 "Pyridoxal-dependent de 0.632 0.228 0.281 0.00021
UNIPROTKB|F1LTX6383 Pdxdc1 "Protein Pdxdc1" [Rattu 0.673 0.172 0.289 0.00023
UNIPROTKB|Q6P474 469 PDXDC2P "Putative pyridoxal-de 0.673 0.140 0.275 0.00039
UNIPROTKB|Q86XE2 498 PDXDC1 "Pyridoxal-dependent de 0.673 0.132 0.275 0.00043
UNIPROTKB|A7MBC2 787 PDXDC1 "Pyridoxal-dependent de 0.673 0.083 0.289 0.00047
UNIPROTKB|F1M5Z2 709 Pdxdc1 "Protein Pdxdc1" [Rattu 0.673 0.093 0.289 0.00053
UNIPROTKB|F1M024 784 Pdxdc1 "Protein Pdxdc1" [Rattu 0.673 0.084 0.289 0.00059
FB|FBgn0031174 CG1486 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 131 (51.2 bits), Expect = 4.5e-08, Sum P(2) = 4.5e-08
 Identities = 26/68 (38%), Positives = 40/68 (58%)

Query:     2 EIGSSLNGHVDNVSLLQEICAKYNLWLHLRGXXXXXXXXXXXXXXXXQPGHSVSLPLGTW 61
             +IG+SL G+VDN+  L+++C  +N+WLH  G                +  HS++L LG+W
Sbjct:   272 DIGASLCGYVDNLLRLRDVCKAHNMWLHASGHGLAALVCAQNQGHVEEVLHSMALNLGSW 331

Query:    62 LNLPLSLP 69
             L +P SLP
Sbjct:   332 LGVP-SLP 338


GO:0019752 "carboxylic acid metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
UNIPROTKB|E1C4Q3 PDXDC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-16 pdxdc1 "pyridoxal-dependent decarboxylase domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H3BNL6 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTX6 Pdxdc1 "Protein Pdxdc1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P474 PDXDC2P "Putative pyridoxal-dependent decarboxylase domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86XE2 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBC2 PDXDC1 "Pyridoxal-dependent decarboxylase domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5Z2 Pdxdc1 "Protein Pdxdc1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M024 Pdxdc1 "Protein Pdxdc1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 5e-04
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
 Score = 37.0 bits (86), Expect = 5e-04
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 4   GSSLNGHVDNVSLLQEICAKYNLWLH 29
           G++ +G  D +  L +IC KY+LWLH
Sbjct: 203 GTTGSGAFDPLQELGDICNKYDLWLH 228


Length = 373

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
PLN02590 539 probable tyrosine decarboxylase 99.95
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.93
PLN02880 490 tyrosine decarboxylase 99.93
KOG0629|consensus 510 99.93
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 99.89
PLN02263 470 serine decarboxylase 99.88
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.88
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.87
PLN03032 374 serine decarboxylase; Provisional 99.78
KOG0628|consensus 511 99.78
PRK02769 380 histidine decarboxylase; Provisional 99.76
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 99.75
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.4
KOG0630|consensus 838 99.39
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.34
PRK13520 371 L-tyrosine decarboxylase; Provisional 99.06
PRK05367 954 glycine dehydrogenase; Provisional 99.05
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.03
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 98.91
PLN02651 364 cysteine desulfurase 98.83
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 98.8
PRK04366 481 glycine dehydrogenase subunit 2; Validated 98.79
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.78
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 98.76
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 98.71
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 98.7
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 98.61
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 98.49
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 98.48
PTZ00094 452 serine hydroxymethyltransferase; Provisional 98.43
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 98.39
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 98.38
PRK14012 404 cysteine desulfurase; Provisional 98.36
PRK02948 381 cysteine desulfurase; Provisional 98.35
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 98.3
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 98.25
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 98.24
TIGR01814 406 kynureninase kynureninase. This model describes ky 98.19
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 98.17
PLN02414 993 glycine dehydrogenase (decarboxylating) 98.16
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 98.16
PLN03226 475 serine hydroxymethyltransferase; Provisional 98.16
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 98.14
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 98.08
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 98.07
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 98.04
PRK10874 401 cysteine sulfinate desulfinase; Provisional 98.02
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 98.01
PLN02409 401 serine--glyoxylate aminotransaminase 97.98
PLN02721 353 threonine aldolase 97.98
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 97.98
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 97.97
KOG1549|consensus 428 97.93
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 97.89
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 97.87
PRK13034 416 serine hydroxymethyltransferase; Reviewed 97.86
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 97.86
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 97.83
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 97.82
cd00609 350 AAT_like Aspartate aminotransferase family. This f 97.81
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 97.74
KOG1383|consensus 491 97.72
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 97.71
PRK00451 447 glycine dehydrogenase subunit 1; Validated 97.67
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 97.66
PRK13237 460 tyrosine phenol-lyase; Provisional 97.64
PRK03080 378 phosphoserine aminotransferase; Provisional 97.61
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 97.59
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 97.55
PLN02271 586 serine hydroxymethyltransferase 97.52
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 97.51
PRK13580 493 serine hydroxymethyltransferase; Provisional 97.51
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 97.48
KOG1368|consensus 384 97.48
PRK12566 954 glycine dehydrogenase; Provisional 97.46
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 97.43
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 97.41
PLN02724 805 Molybdenum cofactor sulfurase 97.36
PRK07179 407 hypothetical protein; Provisional 97.3
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 97.2
PRK06767 386 methionine gamma-lyase; Provisional 97.18
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 97.13
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 97.09
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 97.05
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 97.03
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 97.0
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 97.0
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 96.93
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 96.89
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 96.88
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 96.86
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 96.85
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 96.81
PLN02509 464 cystathionine beta-lyase 96.74
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 96.74
PRK05939 397 hypothetical protein; Provisional 96.72
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 96.7
PRK07811 388 cystathionine gamma-synthase; Provisional 96.67
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 96.65
TIGR01366 361 serC_3 phosphoserine aminotransferase, putative. T 96.64
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 96.63
PRK04311 464 selenocysteine synthase; Provisional 96.6
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 96.58
PRK07671 377 cystathionine beta-lyase; Provisional 96.56
PRK08574 385 cystathionine gamma-synthase; Provisional 96.53
PRK05968 389 hypothetical protein; Provisional 96.52
PF00464 399 SHMT: Serine hydroxymethyltransferase; InterPro: I 96.46
PRK07050 394 cystathionine beta-lyase; Provisional 96.38
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 96.36
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 96.35
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 96.31
PLN02242 418 methionine gamma-lyase 96.31
PRK08776 405 cystathionine gamma-synthase; Provisional 96.25
PRK09064 407 5-aminolevulinate synthase; Validated 96.23
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 96.1
PRK08861 388 cystathionine gamma-synthase; Provisional 96.1
PRK13392 410 5-aminolevulinate synthase; Provisional 96.05
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 95.93
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 95.9
PRK07503 403 methionine gamma-lyase; Provisional 95.9
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 95.86
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 95.86
PRK09028 394 cystathionine beta-lyase; Provisional 95.83
PRK08249 398 cystathionine gamma-synthase; Provisional 95.81
PRK07582 366 cystathionine gamma-lyase; Validated 95.81
PRK08064 390 cystathionine beta-lyase; Provisional 95.78
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 95.71
PRK10534333 L-threonine aldolase; Provisional 95.64
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 95.44
PRK15029 755 arginine decarboxylase; Provisional 95.44
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 95.43
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 95.37
PRK07269 364 cystathionine gamma-synthase; Reviewed 95.23
PRK05367 954 glycine dehydrogenase; Provisional 95.15
PRK06460 376 hypothetical protein; Provisional 95.07
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 94.77
PLN02822 481 serine palmitoyltransferase 94.7
PRK06434 384 cystathionine gamma-lyase; Validated 94.63
PRK03244 398 argD acetylornithine aminotransferase; Provisional 94.6
PRK06234 400 methionine gamma-lyase; Provisional 94.57
PRK08114 395 cystathionine beta-lyase; Provisional 94.52
PRK13393 406 5-aminolevulinate synthase; Provisional 94.27
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 94.21
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 93.96
PRK06225 380 aspartate aminotransferase; Provisional 93.82
PLN02483 489 serine palmitoyltransferase 93.82
PRK08247 366 cystathionine gamma-synthase; Reviewed 93.75
PRK00950 361 histidinol-phosphate aminotransferase; Validated 93.73
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 93.7
PRK06108 382 aspartate aminotransferase; Provisional 93.63
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 93.6
PRK09082 386 methionine aminotransferase; Validated 93.5
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 93.46
PRK05764 393 aspartate aminotransferase; Provisional 93.41
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 93.29
PTZ00125 400 ornithine aminotransferase-like protein; Provision 93.16
PRK07777 387 aminotransferase; Validated 93.1
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 93.07
PLN02414 993 glycine dehydrogenase (decarboxylating) 92.94
PRK08045 386 cystathionine gamma-synthase; Provisional 92.92
PRK08361 391 aspartate aminotransferase; Provisional 92.53
cd00611 355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 92.36
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 92.22
TIGR01364 349 serC_1 phosphoserine aminotransferase. This model 92.03
PRK05355 360 3-phosphoserine/phosphohydroxythreonine aminotrans 91.99
PF0567090 DUF814: Domain of unknown function (DUF814); Inter 91.45
PRK05967 395 cystathionine beta-lyase; Provisional 91.07
PLN02656 409 tyrosine transaminase 90.72
KOG2467|consensus 477 90.63
PRK07550 386 hypothetical protein; Provisional 90.47
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 90.37
PRK07505 402 hypothetical protein; Provisional 90.33
PRK07568 397 aspartate aminotransferase; Provisional 89.87
PF03841 367 SelA: L-seryl-tRNA selenium transferase; InterPro: 89.54
PRK08363 398 alanine aminotransferase; Validated 89.52
PRK07682 378 hypothetical protein; Validated 89.4
PRK08912 387 hypothetical protein; Provisional 89.21
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 89.11
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 89.01
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 88.93
PRK07908 349 hypothetical protein; Provisional 88.78
PRK07309 391 aromatic amino acid aminotransferase; Validated 88.77
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 88.7
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 88.37
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 88.23
PRK07324 373 transaminase; Validated 87.96
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 87.62
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 87.24
PRK01278 389 argD acetylornithine transaminase protein; Provisi 86.92
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 86.78
PRK02936 377 argD acetylornithine aminotransferase; Provisional 86.64
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 85.96
PLN00175 413 aminotransferase family protein; Provisional 85.37
PLN02624 474 ornithine-delta-aminotransferase 84.88
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 84.35
PRK12414 384 putative aminotransferase; Provisional 84.32
PRK08056 356 threonine-phosphate decarboxylase; Provisional 84.2
PRK07337 388 aminotransferase; Validated 84.18
PRK04073 396 rocD ornithine--oxo-acid transaminase; Provisional 83.92
PRK05957 389 aspartate aminotransferase; Provisional 83.6
PLN02760 504 4-aminobutyrate:pyruvate transaminase 83.57
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 83.53
PRK15399 713 lysine decarboxylase LdcC; Provisional 83.44
PRK09148 405 aminotransferase; Validated 83.08
PRK02627 396 acetylornithine aminotransferase; Provisional 82.9
PTZ00433 412 tyrosine aminotransferase; Provisional 82.15
PRK07683 387 aminotransferase A; Validated 81.55
PRK13578 720 ornithine decarboxylase; Provisional 81.21
PRK15400 714 lysine decarboxylase CadA; Provisional 80.47
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 80.31
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
Probab=99.95  E-value=6.4e-29  Score=207.72  Aligned_cols=76  Identities=18%  Similarity=0.307  Sum_probs=66.3

Q ss_pred             CCCcccccccCCChHHHHHHHHHcCceEEeeccc-chhhhcCCC--CCCCCccCccccccCccccCCCCCCCeeEEecCC
Q psy2484           1 MEIGSSLNGHVDNVSLLQEICAKYNLWLHLRGHN-LSSLALNSH--SPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRV   77 (98)
Q Consensus         1 ~taGtt~~Ga~D~l~~i~~ic~~~~lWlHVDga~-~~al~~~~~--~~~gi~~ADS~t~d~HKwL~vP~~~~~~ll~r~~   77 (98)
                      .|+|||++|+||||.+|++||++||+||||||++ |+++++++.  ++.|+|+||||++|+||||++||.|+ ++++|++
T Consensus       293 aTaGTT~tGaiDpl~~Ia~i~~~~g~WlHVDaA~GG~al~~~~~r~~~~Gie~ADSit~D~HK~l~~p~~cg-~llvr~~  371 (539)
T PLN02590        293 ATVGTTSSAAVDPLVPLGNIAKKYGIWLHVDAAYAGNACICPEYRKFIDGIENADSFNMNAHKWLFANQTCS-PLWVKDR  371 (539)
T ss_pred             EEeCCCCCcccCCHHHHHHHHHHhCCeEEEecchhhhhhcChhhHHHhcCCccCCEEEECchhhcCcCcCEE-EEEecCH
Confidence            3899999999999999999999999999999984 556667766  48999999999999999999998775 5566654



>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>KOG0630|consensus Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PF05670 DUF814: Domain of unknown function (DUF814); InterPro: IPR008532 This domain occurs in proteins that have been annotated as Fibronectin/fibrinogen binding protein by similarity Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.81
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.79
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.79
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.75
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.74
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.73
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.73
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.55
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.49
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.4
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.25
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.06
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.04
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 98.79
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 98.78
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 98.7
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 98.56
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 98.54
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 98.52
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 98.5
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 98.48
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 98.43
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 98.43
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 98.43
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 98.42
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 98.41
1iug_A 352 Putative aspartate aminotransferase; wild type, py 98.4
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 98.39
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 98.39
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 98.38
2fnu_A 375 Aminotransferase; protein-product complex, structu 98.38
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 98.37
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 98.37
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 98.36
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 98.35
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 98.34
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 98.34
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 98.31
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 98.3
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 98.3
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 98.3
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 98.29
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 98.29
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 98.26
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 98.25
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 98.23
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 98.23
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 98.22
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 98.21
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 98.21
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 98.2
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 98.19
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 98.19
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 98.17
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 98.15
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 98.15
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 98.15
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 98.14
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 98.14
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 98.14
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 98.13
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 98.12
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 98.12
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 98.12
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 98.12
1svv_A 359 Threonine aldolase; structural genomics, structura 98.11
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 98.08
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.07
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 98.07
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 98.07
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 98.06
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 98.05
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.03
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 98.02
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.01
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 98.01
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 98.0
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 97.99
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 97.9
1o69_A 394 Aminotransferase; structural genomics, unknown fun 97.89
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 97.85
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 97.82
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 97.79
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 97.78
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 97.77
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 97.76
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 97.74
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 97.74
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 97.73
3pj0_A 359 LMO0305 protein; structural genomics, joint center 97.71
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 97.71
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 97.7
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 97.69
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 97.66
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 97.65
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 97.62
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 97.62
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 97.61
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 97.59
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 97.59
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 97.57
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 97.55
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 97.46
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 97.45
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 97.44
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 97.44
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 97.44
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 97.43
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 97.38
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 97.34
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 97.34
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 97.32
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 97.31
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 97.27
3nra_A 407 Aspartate aminotransferase; structural genomics, j 97.25
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 97.24
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 97.23
3e77_A 377 Phosphoserine aminotransferase; SERC, PLP, structu 97.23
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 97.22
3qm2_A 386 Phosphoserine aminotransferase; structural genomic 97.2
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 97.16
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 97.12
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 97.11
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 97.1
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 97.09
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 97.07
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 97.06
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 97.05
2c0r_A 362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 97.04
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 97.04
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 97.04
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 97.0
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 97.0
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 96.99
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 96.98
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 96.96
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 96.9
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 96.86
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 96.83
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 96.83
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 96.82
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 96.8
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 96.78
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 96.75
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 96.71
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 96.65
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 96.53
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 96.51
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 96.5
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 96.5
3hdo_A 360 Histidinol-phosphate aminotransferase; PSI-II, his 96.5
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 96.44
3m5u_A 361 Phosphoserine aminotransferase; alpha-beta half sa 96.41
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 96.35
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 96.35
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 96.33
3ele_A 398 Amino transferase; RER070207001803, structural gen 96.33
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 96.28
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 96.26
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 96.2
3ffh_A 363 Histidinol-phosphate aminotransferase; APC88260, l 96.19
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 96.17
1vp4_A 425 Aminotransferase, putative; structural genomics, j 96.17
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 96.16
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 96.14
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 96.12
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 96.12
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 95.96
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 95.92
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 95.91
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 95.9
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 95.8
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 95.66
3ly1_A 354 Putative histidinol-phosphate aminotransferase; st 95.65
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 95.5
3p1t_A 337 Putative histidinol-phosphate aminotransferase; PL 95.47
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 95.46
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 95.45
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 95.23
3get_A 365 Histidinol-phosphate aminotransferase; NP_281508.1 95.2
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 95.16
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 95.08
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 94.84
1z7d_A 433 Ornithine aminotransferase; structural genomics co 94.84
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 94.77
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 94.65
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 94.6
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 94.58
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 94.5
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 93.49
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 94.39
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 94.27
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 93.97
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 93.85
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 93.63
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 93.59
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 93.58
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 93.4
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 93.24
1fg7_A 356 Histidinol phosphate aminotransferase; HISC, histi 93.1
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 93.07
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 92.91
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 92.87
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 92.55
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 92.47
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 92.38
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 92.38
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 92.23
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 91.89
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 91.6
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 91.35
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 91.25
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 91.22
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 91.18
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 91.1
3rq1_A 418 Aminotransferase class I and II; structural genomi 91.01
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 90.54
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 90.3
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 89.45
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 88.77
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 88.72
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 88.56
3hmu_A 472 Aminotransferase, class III; structural genomics, 88.39
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 86.21
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 84.21
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 82.05
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.81  E-value=1.1e-20  Score=149.69  Aligned_cols=74  Identities=18%  Similarity=0.311  Sum_probs=63.1

Q ss_pred             CCcccccccCCChHHHHHHHHHcCceEEeecccch-hhhcCCC--CCCCCccCccccccCccccCCCCCCCeeEEecC
Q psy2484           2 EIGSSLNGHVDNVSLLQEICAKYNLWLHLRGHNLS-SLALNSH--SPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQR   76 (98)
Q Consensus         2 taGtt~~Ga~D~l~~i~~ic~~~~lWlHVDga~~~-al~~~~~--~~~gi~~ADS~t~d~HKwL~vP~~~~~~ll~r~   76 (98)
                      |+|+|.+|++|||++|+++|++||+|+|||++.++ ++..++.  ...|++++||+++|+||||++|++++. +++|+
T Consensus       248 ~~~~t~~G~id~l~~I~~la~~~~~~lhvDaA~g~~~~~~~~~~~~~~gi~~aDsi~~~~hK~l~~p~g~g~-l~~~~  324 (481)
T 4e1o_A          248 TLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTG-FWVKD  324 (481)
T ss_dssp             EBSCTTTCCBCCHHHHHHHHHHHTCEEEEECTTGGGGGGSGGGGGGGTTGGGCSEEEECHHHHSSCCSSCEE-EEESB
T ss_pred             ecCCCCCcCcCCHHHHHHHHHHcCCeEEeehhhHHHHHhChhhHHHhcCcccCCEEEEChHHhcCCCCceEE-EEEeC
Confidence            68999999999999999999999999999998554 4555555  467999999999999999999987764 45554



>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.93
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 99.81
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.48
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.37
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 98.89
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 98.69
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 98.63
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 98.56
d1m32a_ 361 2-aminoethylphosphonate transaminase {Salmonella t 98.41
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.31
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 98.26
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 98.19
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 97.99
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 97.96
d1vjoa_ 377 Alanine-glyoxylate aminotransferase {Cyanobacteria 97.67
d2bkwa1 382 Alanine-glyoxylate aminotransferase {Baker's yeast 97.64
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 97.57
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 97.47
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 97.26
d1iuga_ 348 Subgroup IV putative aspartate aminotransferase {T 97.08
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 97.02
d2ch1a1 388 3-hydroxykynurenine transaminase {Malaria mosquito 97.01
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 97.0
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 96.98
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 96.82
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 96.74
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 96.57
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 96.18
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 95.45
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 95.21
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 94.85
d2c0ra1 361 Phosphoserine aminotransferase, PSAT {Bacillus cir 94.0
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 93.7
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 92.88
d1w23a_ 360 Phosphoserine aminotransferase, PSAT {Bacillus alc 91.63
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 90.66
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 90.27
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 89.81
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 88.3
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 86.87
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 86.02
d1lc5a_ 355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 85.69
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 84.98
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 82.99
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.93  E-value=1.3e-27  Score=191.40  Aligned_cols=76  Identities=17%  Similarity=0.310  Sum_probs=65.2

Q ss_pred             CCCcccccccCCChHHHHHHHHHcCceEEeecccc-hhhhcCCC--CCCCCccCccccccCccccCCCCCCCeeEEecCC
Q psy2484           1 MEIGSSLNGHVDNVSLLQEICAKYNLWLHLRGHNL-SSLALNSH--SPSPLQPGHSVSLPLGTWLNLPLSLPSPARTQRV   77 (98)
Q Consensus         1 ~taGtt~~Ga~D~l~~i~~ic~~~~lWlHVDga~~-~al~~~~~--~~~gi~~ADS~t~d~HKwL~vP~~~~~~ll~r~~   77 (98)
                      .|+|||.+|++|||++|++||++||+||||||++| +++.+++.  +++|+++||||++|+||||++|+.|+ ++++|++
T Consensus       241 ataGtt~~G~iDpl~~I~~i~~~~~~wlHVDAA~Gg~~~~~~~~~~~~~gi~~aDSit~d~HK~l~~P~~~g-~~l~r~~  319 (476)
T d1js3a_         241 ATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCS-AMWVKRR  319 (476)
T ss_dssp             EEBSCTTTCCBCCHHHHHHHHHHTTCEEEEECTTGGGGGGSTTTGGGGTTGGGCSEEEECHHHHSSCCSSCE-EEEESCH
T ss_pred             ecCCCccceeeccHHHHHHHHHhcCcEEEEecccchhhhhhcchhhhhcCCcccceeeecCccccccCCcce-eecccch
Confidence            37999999999999999999999999999999855 45555555  48999999999999999999997665 6666653



>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure