Psyllid ID: psy2618


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MCDESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPAMTNERKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNSTLAQPSAPTTPQPNSTAPQFPYIYNQQMGYWYPQAAAYTATAAQLPQQFYQYGQLGYPQGYVGMVGRQVPGWQGIPGAQPTAQQMAVAQAQPSMMAAYAMQQFPTQ
ccccccccEEEEccccccccHHHHHHHHcccccccEEEEEccccccccEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccccccccEEEEccccccccHHHHHHHHcccccccccEEEEcccccccccEEEEEEccHHHHHHHHHHccccccccccEEEEcccccccccHHHHHHccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEcccHHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccc
cccccccEEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEccccccHHHHccccccEEEEEEcccccccHHHHHHHHHccccEEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHccccccccccccccccccEEEEEEcccccccHHHHHHHHcccccEEEEEEEcccccEEEEcccHHHHHHHHHHHcccEEcccEEEEEEccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccc
mcdesqpttlyvgnlDVSVTEELLCALFSqigpvkgckvirepgndpyAFLEFVHHTVAATALAAMNKRVFLEKEMKvnwasspgnqpkqdtsnhyhifvgdlspeieTQTLKEafapfgeisncrivrdpqtlkskgYAFVSFVKKAEAENAITAMngqwlgsrsirtnwstrkppamtnerkrqnshtktitfdevynqssptnctvycggfgkdlNEELVSkvfspfgtivdIRVFKEKGYAFVKFTTKETATHAIESIhntdinghTVKCFwgkesennstlaqpsapttpqpnstapqfpyiynqqmgywypqaaaYTATAAQLPQQFYqygqlgypqgyvgmvgrqvpgwqgipgaqpTAQQMAVAQAQPSMMAAYAMQQFPTQ
mcdesqpttlyvgnLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWASspgnqpkqdtsNHYHIFVGDLSPEIETQTLKEAfapfgeisncRIVRDPQTLKSKGYAFVSFVKKAEAENAItamngqwlgsrsirtnwstrkppamtnerkrqnshtktitfdevynqsspTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHaiesihntdinGHTVKCFWGKESENNSTLAQPSAPTTPQPNSTAPQFPYIYNQQMGYWYPQAAAYTATAAQLPQQFYQYGQLGYPQGYVGMVGRQVPGWQGIPGAQPTAQQMAVAQAQPSMMAAYAMQQFPTQ
MCDESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFvhhtvaatalaaMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPAMTNERKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNSTLAQPSAPTTPQPNSTAPQFPYIYNQQMGYWypqaaaytataaqlpqqfyqygqlgypqgyvgMVGRQVPGWQGIPGAQPTAQQMAVAQAQPSMMAAYAMQQFPTQ
********TLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNW**************HYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSI*************************ITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWG**************************FPYIYNQQMGYWYPQAAAYTATAAQLPQQFYQYGQLGYPQGYVGMVGRQVPGWQGI*******************************
****SQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKV*******************IFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTN******************************QSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCF**********************************QQMGYWYPQAAAY**********FY********************************************************
********TLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRK*************HTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKES*******************TAPQFPYIYNQQMGYWYPQAAAYTATAAQLPQQFYQYGQLGYPQGYVGMVGRQVPGWQGIPGA**************SMMAAYAMQQFPTQ
*****QPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWASSPGNQP*QDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKP****N*RKRQN*H*KTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNSTLAQPSAPTTPQPNSTAPQFPYIYNQQMGYWYPQAAAYTATAAQLPQQFYQYGQLGYPQGYVGMVGRQVPGWQGIPGAQP***Q**********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPAMTNERKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNSTLAQPSAPTTPQPNSTAPQFPYIYNQQMGYWYPQAAAYTATAAQLPQQFYQYGQLGYPQGYVGMVGRQVPGWQGIPGAQPTAQQMAVAQAQPSMMAAYAMQQFPTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
Q01085375 Nucleolysin TIAR OS=Homo yes N/A 0.707 0.736 0.615 3e-95
P70318392 Nucleolysin TIAR OS=Mus m yes N/A 0.935 0.931 0.495 1e-94
P31483386 Nucleolysin TIA-1 isoform no N/A 0.843 0.852 0.515 3e-91
P52912386 Nucleolysin TIA-1 OS=Mus no N/A 0.841 0.849 0.513 4e-90
Q9LEB4409 Polyadenylate-binding pro N/A N/A 0.692 0.660 0.303 1e-36
Q93W34415 Polyadenylate-binding pro no N/A 0.692 0.650 0.296 5e-36
Q9FPJ8387 Polyadenylate-binding pro no N/A 0.689 0.695 0.287 1e-34
Q9SAB3405 Polyadenylate-binding pro no N/A 0.689 0.664 0.312 5e-33
Q9LEB3428 Polyadenylate-binding pro N/A N/A 0.8 0.728 0.271 7e-33
F4I3B3445 Polyadenylate-binding pro no N/A 0.687 0.602 0.323 3e-32
>sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 Back     alignment and function desciption
 Score =  349 bits (895), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 211/281 (75%), Gaps = 5/281 (1%)

Query: 1   MCDESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIRE-PGNDPYAFLEFVHHTVA 59
           M D+ QP TLYVGNL   VTE L+  LFSQIGP K CK+I E   NDPY F+EF  H  A
Sbjct: 2   MEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDA 61

Query: 60  ATALAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPF 119
           A ALAAMN R  L KE+KVNWA++P +Q K+DTSNH+H+FVGDLSPEI T+ +K AFAPF
Sbjct: 62  AAALAAMNGRKILGKEVKVNWATTPSSQ-KKDTSNHFHVFVGDLSPEITTEDIKSAFAPF 120

Query: 120 GEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPAM 179
           G+IS+ R+V+D  T KSKGY FVSF  K +AENAI  M GQWLG R IRTNW+TRKPPA 
Sbjct: 121 GKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPA- 179

Query: 180 TNERKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVF 239
              +  Q ++TK + F++V NQSSP NCTVYCGG    L ++L+ + FSPFG I++IRVF
Sbjct: 180 --PKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVF 237

Query: 240 KEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKES 280
            EKGY+FV+F+T E+A HAI S++ T I GH VKC+WGKES
Sbjct: 238 PEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 278




RNA-binding protein. Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis.
Homo sapiens (taxid: 9606)
>sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=1 Back     alignment and function description
>sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 Back     alignment and function description
>sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 Back     alignment and function description
>sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 Back     alignment and function description
>sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 Back     alignment and function description
>sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 Back     alignment and function description
>sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 Back     alignment and function description
>sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
242021493403 nucleolysin TIA-1, putative [Pediculus h 0.964 0.933 0.637 1e-137
332376136371 unknown [Dendroctonus ponderosae] 0.807 0.849 0.740 1e-136
383863609392 PREDICTED: nucleolysin TIAR-like [Megach 0.815 0.811 0.749 1e-135
91086169364 PREDICTED: similar to TIA-1 homolog [Tri 0.764 0.818 0.771 1e-134
307178104393 Nucleolysin TIAR [Camponotus floridanus] 0.815 0.809 0.746 1e-134
332029721393 Nucleolysin TIAR [Acromyrmex echinatior] 0.815 0.809 0.746 1e-134
110756942392 PREDICTED: nucleolysin TIAR [Apis mellif 0.815 0.811 0.742 1e-134
193648018388 PREDICTED: nucleolysin TIAR-like [Acyrth 0.810 0.814 0.732 1e-133
357610697388 TIA-1-related RNA binding protein [Danau 0.846 0.850 0.711 1e-132
427789733406 Putative rox8 [Rhipicephalus pulchellus] 0.982 0.943 0.611 1e-131
>gi|242021493|ref|XP_002431179.1| nucleolysin TIA-1, putative [Pediculus humanus corporis] gi|212516428|gb|EEB18441.1| nucleolysin TIA-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  495 bits (1275), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 262/411 (63%), Positives = 301/411 (73%), Gaps = 35/411 (8%)

Query: 3   DESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATA 62
           +E+ P TLYVGNLDVSVTE+LLC LFSQIG VKGCK+IREP NDPYAF+EFV+H  A+TA
Sbjct: 5   EENYPKTLYVGNLDVSVTEDLLCTLFSQIGSVKGCKIIREPNNDPYAFVEFVNHQAASTA 64

Query: 63  LAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEI 122
           L AMNKR  LEKE+KVNWA+SPGNQPKQDTS+H+HIFVGDLSPEIE  TL+EAFAPFGEI
Sbjct: 65  LIAMNKRHVLEKEIKVNWATSPGNQPKQDTSSHHHIFVGDLSPEIEMHTLREAFAPFGEI 124

Query: 123 SNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPAMTNE 182
           SNCRIVRDPQTLKSKGYAFVSFVKKAEAE+AI AMNGQWLG+RSIRTNWSTRKPP    E
Sbjct: 125 SNCRIVRDPQTLKSKGYAFVSFVKKAEAESAIHAMNGQWLGNRSIRTNWSTRKPPPPRTE 184

Query: 183 RKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEK 242
           R RQ  + K ++++EVYNQSSPTNCTVYCGGF   +NE+L+ K FS FGTI DIR FK+K
Sbjct: 185 RSRQ-GNAKAVSYEEVYNQSSPTNCTVYCGGFTNGINEDLIEKAFSRFGTIQDIRSFKDK 243

Query: 243 GYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNSTLAQPSAPTTPQPNSTA- 301
           GYAF++F+TKE ATHAIE++HN +ING  VKCFWGKES + +T      P   Q + ++ 
Sbjct: 244 GYAFIRFSTKEAATHAIEAMHNAEINGQQVKCFWGKESSDPATAQNAQQPQQVQQSGSSV 303

Query: 302 ----PQFPYIYNQQMGYWYP----QAAAYTATAAQLPQQFYQ---------YGQLGY-PQ 343
                 +PY    ++GYWYP    QA   TA AAQ+P Q+ Q         YGQ  Y PQ
Sbjct: 304 AAANAHYPYQTYTEVGYWYPPGTYQAPPVTA-AAQMPGQYLQGVQPHYAAAYGQFPYQPQ 362

Query: 344 GYVGMVGRQVP-GWQGIP---GAQPTAQQMAVAQAQPSMMAAYAMQQFPTQ 390
           G      R VP GWQGIP      P    M      P  M AY M QF TQ
Sbjct: 363 G----AYRVVPAGWQGIPTPVAGPPPGTNM------PQTMMAYTMPQFQTQ 403




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332376136|gb|AEE63208.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383863609|ref|XP_003707272.1| PREDICTED: nucleolysin TIAR-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91086169|ref|XP_970456.1| PREDICTED: similar to TIA-1 homolog [Tribolium castaneum] gi|270010230|gb|EFA06678.1| hypothetical protein TcasGA2_TC009608 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307178104|gb|EFN66931.1| Nucleolysin TIAR [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332029721|gb|EGI69600.1| Nucleolysin TIAR [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110756942|ref|XP_395357.3| PREDICTED: nucleolysin TIAR [Apis mellifera] gi|340713958|ref|XP_003395500.1| PREDICTED: nucleolysin TIAR-like [Bombus terrestris] gi|350421173|ref|XP_003492759.1| PREDICTED: nucleolysin TIAR-like [Bombus impatiens] gi|380025693|ref|XP_003696603.1| PREDICTED: nucleolysin TIAR-like [Apis florea] Back     alignment and taxonomy information
>gi|193648018|ref|XP_001950341.1| PREDICTED: nucleolysin TIAR-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357610697|gb|EHJ67099.1| TIA-1-related RNA binding protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|427789733|gb|JAA60318.1| Putative rox8 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
FB|FBgn0005649470 Rox8 "Rox8" [Drosophila melano 0.725 0.602 0.648 8.2e-112
MGI|MGI:107913392 Tial1 "Tia1 cytotoxic granule- 0.617 0.614 0.575 1e-93
RGD|1595845392 Tial1 "Tia1 cytotoxic granule- 0.617 0.614 0.575 1e-93
UNIPROTKB|E2RA41392 TIAL1 "Uncharacterized protein 0.617 0.614 0.575 1.4e-92
UNIPROTKB|F2Z5F9392 LOC100736782 "Uncharacterized 0.617 0.614 0.575 1.4e-92
UNIPROTKB|Q01085375 TIAL1 "Nucleolysin TIAR" [Homo 0.707 0.736 0.590 7e-92
UNIPROTKB|F2Z4H8380 TIAL1 "Uncharacterized protein 0.707 0.726 0.590 7e-92
UNIPROTKB|F1NS94389 374274 "Uncharacterized protei 0.617 0.619 0.575 9.9e-92
UNIPROTKB|F1NY49388 374274 "Uncharacterized protei 0.617 0.621 0.575 9.9e-92
ZFIN|ZDB-GENE-040426-1547389 tial1 "TIA1 cytotoxic granule- 0.641 0.642 0.559 1.3e-91
FB|FBgn0005649 Rox8 "Rox8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1015 (362.4 bits), Expect = 8.2e-112, Sum P(3) = 8.2e-112
 Identities = 194/299 (64%), Positives = 234/299 (78%)

Query:     3 DESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFXXXXXXXXX 62
             DESQP TLYVGNLD SV+E+LL ALFS +GPVK CK+IREPGNDPYAF+E+         
Sbjct:     2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTA 61

Query:    63 XXXMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEI 122
                MNKR+FLEKE+KVNWA+SPGNQPK D S+H+HIFVGDLSPEIET+TL+EAFAPFGEI
Sbjct:    62 LTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEI 121

Query:   123 SNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRK--PPAMT 180
             SNCRIVRDP T+KSKGYAFVSFVKKAEAENAI AMNGQW+GSRSIRTNWSTRK  PP   
Sbjct:   122 SNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREP 181

Query:   181 NERKRQNSH-------------TKTITFDEVYNQSSPTNCTVYCGGFGKD-LNEELVSKV 226
             ++   Q                ++  TF+EVYNQSSPTN TVYCGGF  + ++++L+ K 
Sbjct:   182 SKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKH 241

Query:   227 FSPFGTIVDIRVFKEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNST 285
             F  FG I D+RVFK+KG++F+KF TKE A HAIE  HN++++G+ VKCFWGKE+  +++
Sbjct:   242 FVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNS 300


GO:0008143 "poly(A) RNA binding" evidence=NAS
GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0005685 "U1 snRNP" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=IC
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
MGI|MGI:107913 Tial1 "Tia1 cytotoxic granule-associated RNA binding protein-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1595845 Tial1 "Tia1 cytotoxic granule-associated RNA binding protein-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RA41 TIAL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5F9 LOC100736782 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q01085 TIAL1 "Nucleolysin TIAR" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4H8 TIAL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NS94 374274 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY49 374274 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1547 tial1 "TIA1 cytotoxic granule-associated RNA binding protein-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P70318TIAR_MOUSENo assigned EC number0.49510.93580.9311yesN/A
Q01085TIAR_HUMANNo assigned EC number0.61560.70760.736yesN/A
P52912TIA1_MOUSENo assigned EC number0.51390.84100.8497noN/A
P31483TIA1_HUMANNo assigned EC number0.51540.84350.8523noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-48
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 9e-36
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-34
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-34
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-33
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-31
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 3e-29
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 2e-28
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-27
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 5e-27
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 1e-25
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-24
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 2e-24
smart0036073 smart00360, RRM, RNA recognition motif 4e-24
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-23
pfam0007670 pfam00076, RRM_1, RNA recognition motif 9e-22
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-20
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-19
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 3e-19
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 1e-18
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 3e-18
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 5e-18
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 8e-18
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 8e-18
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 9e-18
smart0036073 smart00360, RRM, RNA recognition motif 1e-17
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-17
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 6e-17
pfam0007670 pfam00076, RRM_1, RNA recognition motif 8e-17
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-16
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-16
smart0036073 smart00360, RRM, RNA recognition motif 2e-16
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-16
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-16
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 3e-16
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 5e-16
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 8e-16
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-15
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-15
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-15
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-15
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-15
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-15
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 4e-15
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 4e-15
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-15
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-15
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 5e-15
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 6e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-14
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-14
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-14
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 2e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-14
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 3e-14
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-14
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-14
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-14
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 6e-14
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 8e-14
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 9e-14
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-13
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-13
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-13
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 1e-13
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-13
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-13
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 3e-13
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-13
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 4e-13
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 5e-13
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 5e-13
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-13
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 7e-13
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 8e-13
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-12
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 3e-12
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-12
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 4e-12
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 5e-12
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 6e-12
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 6e-12
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 6e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 7e-12
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 8e-12
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 8e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-12
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 9e-12
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-11
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-11
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-11
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-11
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 2e-11
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 3e-11
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 3e-11
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-11
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-11
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-11
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-11
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 4e-11
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 4e-11
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 4e-11
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-11
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 1e-10
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-10
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 1e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-10
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 1e-10
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-10
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 3e-10
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-10
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-10
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 3e-10
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 5e-10
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 5e-10
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 5e-10
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 5e-10
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-10
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 7e-10
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 7e-10
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 7e-10
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 8e-10
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 9e-10
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-09
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-09
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-09
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-09
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-09
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-09
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-09
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 2e-09
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 2e-09
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 2e-09
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 2e-09
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 2e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-09
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 3e-09
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 3e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-09
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 4e-09
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 4e-09
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-09
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 5e-09
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 5e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 6e-09
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 6e-09
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 7e-09
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 8e-09
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 8e-09
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 9e-09
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-08
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-08
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-08
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 1e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-08
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 2e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-08
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-08
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-08
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-08
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-08
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-08
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 2e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-08
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 3e-08
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 3e-08
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 3e-08
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-08
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 4e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-08
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 4e-08
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 4e-08
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 4e-08
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-08
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-08
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-08
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 5e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 5e-08
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 5e-08
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 6e-08
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 6e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-08
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 7e-08
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 7e-08
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 7e-08
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 7e-08
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 8e-08
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 8e-08
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 8e-08
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 8e-08
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 8e-08
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 8e-08
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 9e-08
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 9e-08
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 9e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 9e-08
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 9e-08
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-07
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-07
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-07
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-07
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 1e-07
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 1e-07
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 1e-07
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-07
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-07
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-07
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-07
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 2e-07
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-07
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-07
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 2e-07
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 2e-07
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-07
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-07
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 3e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 3e-07
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 3e-07
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 3e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-07
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 4e-07
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 4e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 4e-07
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 4e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 5e-07
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 5e-07
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 5e-07
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 5e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 6e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 6e-07
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 6e-07
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 6e-07
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-07
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 6e-07
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 6e-07
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 6e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 7e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 7e-07
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 8e-07
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 8e-07
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 9e-07
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 9e-07
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 1e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-06
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-06
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 1e-06
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 1e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-06
cd1242679 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in p 1e-06
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 1e-06
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-06
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 1e-06
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 2e-06
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-06
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-06
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 2e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 2e-06
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 2e-06
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-06
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 3e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-06
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 3e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 3e-06
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 3e-06
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 3e-06
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 3e-06
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 3e-06
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 3e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 3e-06
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 3e-06
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 3e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-06
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-06
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 4e-06
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 4e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 4e-06
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 4e-06
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-06
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 4e-06
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 4e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 5e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 5e-06
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 5e-06
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 5e-06
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 5e-06
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 5e-06
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 6e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-06
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 6e-06
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 6e-06
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 6e-06
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 6e-06
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 7e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 7e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 7e-06
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 7e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 7e-06
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 7e-06
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 7e-06
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 8e-06
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 9e-06
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 9e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 9e-06
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 9e-06
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 9e-06
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 1e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 1e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-05
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-05
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 1e-05
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 1e-05
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 1e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-05
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 1e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 2e-05
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 2e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 2e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-05
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-05
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-05
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 2e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 2e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-05
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-05
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-05
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 2e-05
cd1227471 cd12274, RRM2_NEFsp, RNA recognition motif 2 in ve 2e-05
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 2e-05
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 2e-05
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 2e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 2e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-05
cd1233179 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif 2e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 3e-05
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 3e-05
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 3e-05
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 3e-05
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 3e-05
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 3e-05
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 3e-05
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 3e-05
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 3e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 3e-05
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 3e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-05
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 4e-05
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 4e-05
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 4e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 4e-05
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 4e-05
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 4e-05
cd1230386 cd12303, RRM_spSet1p_like, RNA recognition motif i 4e-05
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 4e-05
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 4e-05
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 4e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 5e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 5e-05
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 5e-05
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 5e-05
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 5e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 5e-05
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 5e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 5e-05
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 5e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 6e-05
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-05
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 6e-05
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 6e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 6e-05
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 7e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 7e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 7e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 7e-05
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 7e-05
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 7e-05
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 7e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 7e-05
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 8e-05
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 8e-05
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 8e-05
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 8e-05
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 8e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 8e-05
cd1261181 cd12611, RRM1_NGR1_NAM8_like, RNA recognition moti 8e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 8e-05
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 8e-05
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 9e-05
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 9e-05
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 9e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 9e-05
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 9e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 1e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-04
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-04
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 1e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 1e-04
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 1e-04
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 1e-04
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 1e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 1e-04
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 1e-04
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 1e-04
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 1e-04
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 1e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 1e-04
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 1e-04
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 1e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 1e-04
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 1e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-04
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 2e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-04
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 2e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 2e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 2e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 2e-04
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 2e-04
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 2e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-04
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 2e-04
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 2e-04
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2e-04
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-04
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 2e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-04
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 2e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 2e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 3e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 3e-04
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 3e-04
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 3e-04
cd1227471 cd12274, RRM2_NEFsp, RNA recognition motif 2 in ve 3e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 3e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 3e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-04
cd1252074 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA 3e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 3e-04
cd1246181 cd12461, RRM_SCAF4, RNA recognition motif found in 3e-04
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 3e-04
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 3e-04
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 3e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 4e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 4e-04
cd1261181 cd12611, RRM1_NGR1_NAM8_like, RNA recognition moti 4e-04
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 4e-04
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 4e-04
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 5e-04
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 5e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 5e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 5e-04
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 5e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-04
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 6e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 6e-04
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 6e-04
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 6e-04
cd1222884 cd12228, RRM_ENOX, RNA recognition motif (RRM) in 6e-04
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 6e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 7e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 7e-04
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 7e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 8e-04
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 8e-04
cd1243676 cd12436, RRM1_2_MATR3_like, RNA recognition motif 8e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 9e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 9e-04
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 0.001
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.001
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.001
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 0.001
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.001
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.001
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.001
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 0.001
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 0.001
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.001
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.001
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.001
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 0.001
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.001
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 0.001
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 0.001
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 0.001
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.001
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 0.001
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 0.001
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.001
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 0.001
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.001
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 0.001
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 0.001
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 0.001
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 0.001
cd12540105 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 0.001
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 0.001
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 0.001
smart0036170 smart00361, RRM_1, RNA recognition motif 0.001
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.001
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 0.002
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.002
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.002
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 0.002
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 0.002
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.002
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.002
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.002
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 0.002
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.002
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 0.002
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.002
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 0.002
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.002
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 0.002
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 0.002
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 0.002
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 0.002
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 0.002
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 0.002
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 0.002
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 0.002
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 0.002
cd1225976 cd12259, RRM_SRSF11_SREK1, RNA recognition motif i 0.002
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 0.002
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 0.003
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 0.003
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 0.003
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 0.003
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 0.003
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 0.003
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.003
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 0.003
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 0.003
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 0.003
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.003
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.004
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 0.004
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 0.004
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.004
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 0.004
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 0.004
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 0.004
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.004
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 0.004
cd1252174 cd12521, RRM3_MRN1, RNA recognition motif 3 of RNA 0.004
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 0.004
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
 Score =  157 bits (400), Expect = 3e-48
 Identities = 58/75 (77%), Positives = 67/75 (89%)

Query: 97  HIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITA 156
           HIFVGDLSPEI+T+TL+ AFAPFGEIS+ R+V+D QT KSKGY FVSFVKK +AENAI +
Sbjct: 1   HIFVGDLSPEIDTETLRAAFAPFGEISDARVVKDMQTGKSKGYGFVSFVKKEDAENAIQS 60

Query: 157 MNGQWLGSRSIRTNW 171
           MNGQWLG R+IRTNW
Sbjct: 61  MNGQWLGGRAIRTNW 75


This subfamily corresponds to the RRM2 of nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin TIA-1-related protein (TIAR), both of which are granule-associated RNA binding proteins involved in inducing apoptosis in cytotoxic lymphocyte (CTL) target cells. TIA-1 and TIAR share high sequence similarity. They are expressed in a wide variety of cell types. TIA-1 can be phosphorylated by a serine/threonine kinase that is activated during Fas-mediated apoptosis. TIAR is mainly localized in the nucleus of hematopoietic and nonhematopoietic cells. It is translocated from the nucleus to the cytoplasm in response to exogenous triggers of apoptosis. Both, TIA-1 and TIAR, bind specifically to poly(A) but not to poly(C) homopolymers. They are composed of three N-terminal highly homologous RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a glutamine-rich C-terminal auxiliary domain containing a lysosome-targeting motif. TIA-1 and TIAR interact with RNAs containing short stretches of uridylates and their RRM2 can mediate the specific binding to uridylate-rich RNAs. The C-terminal auxiliary domain may be responsible for interacting with other proteins. In addition, TIA-1 and TIAR share a potential serine protease-cleavage site (Phe-Val-Arg) localized at the junction between their RNA binding domains and their C-terminal auxiliary domains. Length = 75

>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240872 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240720 cd12274, RRM2_NEFsp, RNA recognition motif 2 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in Saccharomyces cerevisiae protein Nrd1, Schizosaccharomyces pombe Rpb7-binding protein seb1 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast Schizosaccharomyces pombe SET domain-containing protein 1 (spSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241055 cd12611, RRM1_NGR1_NAM8_like, RNA recognition motif 1 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240720 cd12274, RRM2_NEFsp, RNA recognition motif 2 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240964 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and CTD-associated factor 4 (SCAF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241055 cd12611, RRM1_NGR1_NAM8_like, RNA recognition motif 1 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the matrin 3 family of nuclear proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins Back     alignment and domain information
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240705 cd12259, RRM_SRSF11_SREK1, RNA recognition motif in serine/arginine-rich splicing factor 11 (SRSF11), splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240965 cd12521, RRM3_MRN1, RNA recognition motif 3 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
KOG0148|consensus321 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0117|consensus506 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG0145|consensus360 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
KOG0127|consensus 678 100.0
KOG0144|consensus510 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
KOG0123|consensus369 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
KOG0123|consensus369 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG0147|consensus549 99.97
KOG0110|consensus725 99.97
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.97
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.97
KOG0144|consensus 510 99.96
KOG0124|consensus544 99.96
KOG0127|consensus678 99.96
KOG0148|consensus321 99.96
KOG0117|consensus 506 99.95
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.95
KOG0131|consensus203 99.95
KOG4211|consensus510 99.94
KOG0145|consensus360 99.94
KOG0109|consensus346 99.93
KOG0131|consensus203 99.93
KOG1190|consensus492 99.93
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.92
KOG4212|consensus608 99.92
KOG4205|consensus311 99.91
KOG0109|consensus346 99.91
KOG1190|consensus492 99.91
KOG0110|consensus725 99.9
KOG0124|consensus 544 99.89
KOG4205|consensus311 99.88
KOG0146|consensus371 99.87
KOG1365|consensus508 99.87
KOG0120|consensus500 99.86
KOG0146|consensus371 99.86
KOG4206|consensus221 99.85
KOG0105|consensus241 99.85
KOG1456|consensus494 99.83
KOG1456|consensus494 99.81
KOG4206|consensus221 99.81
KOG0147|consensus549 99.79
KOG0105|consensus241 99.77
KOG1457|consensus284 99.77
KOG4211|consensus 510 99.76
KOG1457|consensus284 99.74
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.74
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.72
KOG0106|consensus216 99.71
KOG0106|consensus216 99.71
KOG0125|consensus376 99.64
KOG1548|consensus382 99.63
KOG0122|consensus270 99.63
KOG0107|consensus195 99.62
KOG1548|consensus382 99.62
KOG0149|consensus247 99.62
KOG4212|consensus 608 99.62
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.62
PLN03120260 nucleic acid binding protein; Provisional 99.61
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.58
KOG0122|consensus270 99.57
KOG0125|consensus376 99.55
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.55
KOG0149|consensus247 99.54
KOG0114|consensus124 99.54
KOG0121|consensus153 99.54
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.54
KOG0121|consensus153 99.53
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.53
KOG0107|consensus195 99.53
PLN03121243 nucleic acid binding protein; Provisional 99.5
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.5
KOG0113|consensus335 99.5
PLN03120260 nucleic acid binding protein; Provisional 99.47
PLN03213 759 repressor of silencing 3; Provisional 99.47
KOG4207|consensus256 99.47
KOG0114|consensus124 99.46
KOG1365|consensus508 99.46
KOG0126|consensus219 99.44
smart0036272 RRM_2 RNA recognition motif. 99.43
KOG0132|consensus 894 99.42
KOG0130|consensus170 99.42
KOG4207|consensus256 99.41
KOG0120|consensus500 99.4
KOG0111|consensus298 99.37
KOG0132|consensus 894 99.37
PLN03213 759 repressor of silencing 3; Provisional 99.37
smart0036272 RRM_2 RNA recognition motif. 99.37
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.36
KOG0129|consensus520 99.36
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.36
PLN03121243 nucleic acid binding protein; Provisional 99.36
KOG0108|consensus 435 99.36
KOG4660|consensus549 99.35
smart0036071 RRM RNA recognition motif. 99.35
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.35
KOG4307|consensus 944 99.32
KOG0130|consensus170 99.32
smart0036071 RRM RNA recognition motif. 99.32
KOG0128|consensus881 99.31
KOG0129|consensus520 99.3
KOG0111|consensus298 99.3
KOG0113|consensus335 99.29
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.28
KOG4454|consensus267 99.27
smart0036170 RRM_1 RNA recognition motif. 99.23
KOG0126|consensus219 99.22
KOG0108|consensus435 99.21
KOG0226|consensus290 99.16
KOG0415|consensus479 99.13
smart0036170 RRM_1 RNA recognition motif. 99.11
KOG4210|consensus285 99.05
KOG0112|consensus 975 99.01
KOG0153|consensus377 99.0
KOG0153|consensus377 98.97
KOG0415|consensus479 98.97
KOG0128|consensus881 98.97
KOG4660|consensus 549 98.96
KOG4208|consensus214 98.95
KOG4454|consensus267 98.95
KOG4661|consensus 940 98.95
KOG0112|consensus 975 98.93
KOG4307|consensus 944 98.93
KOG4208|consensus214 98.87
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.84
KOG0226|consensus290 98.83
KOG4210|consensus285 98.79
KOG4661|consensus 940 98.77
KOG0533|consensus243 98.65
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.65
KOG0533|consensus243 98.6
KOG0151|consensus 877 98.6
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.6
KOG0116|consensus419 98.54
KOG0116|consensus419 98.51
KOG0151|consensus 877 98.39
KOG4209|consensus231 98.38
KOG4209|consensus231 98.37
KOG2193|consensus 584 98.33
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.3
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.29
KOG4676|consensus479 98.24
KOG2193|consensus 584 98.22
KOG4849|consensus 498 98.2
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.18
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 98.0
KOG4849|consensus 498 97.91
KOG4676|consensus 479 97.89
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.85
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.81
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.77
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.71
KOG1855|consensus484 97.69
KOG0115|consensus275 97.64
KOG1995|consensus351 97.63
KOG2591|consensus 684 97.58
KOG3152|consensus278 97.55
KOG1995|consensus351 97.52
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.37
KOG1855|consensus484 97.36
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.34
KOG2202|consensus260 97.34
KOG2314|consensus 698 97.29
KOG0115|consensus275 97.29
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.25
KOG2314|consensus 698 97.22
KOG3152|consensus278 97.2
KOG2416|consensus718 97.15
PF15023166 DUF4523: Protein of unknown function (DUF4523) 97.12
KOG2202|consensus260 97.05
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.98
KOG1996|consensus378 96.93
KOG1996|consensus378 96.81
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.6
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.52
KOG2416|consensus718 96.51
KOG2591|consensus 684 96.37
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.33
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.23
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.18
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.17
KOG4285|consensus350 96.01
KOG1924|consensus 1102 95.91
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 95.88
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.79
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 95.65
KOG0804|consensus493 95.59
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.49
KOG2068|consensus327 95.44
KOG2068|consensus327 95.02
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 94.9
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.79
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.7
KOG0804|consensus 493 94.59
KOG4574|consensus 1007 94.21
KOG4574|consensus 1007 93.91
KOG2135|consensus526 93.86
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 93.84
KOG2135|consensus526 93.81
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.8
KOG4285|consensus350 93.76
KOG1924|consensus 1102 93.27
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 93.24
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 92.91
KOG2318|consensus 650 91.22
KOG2253|consensus 668 90.98
KOG2253|consensus 668 89.99
KOG4019|consensus193 88.91
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 87.18
KOG4019|consensus193 85.31
KOG2236|consensus483 85.14
KOG2318|consensus 650 85.01
PF14111153 DUF4283: Domain of unknown function (DUF4283) 83.74
KOG2295|consensus648 81.59
PF03468116 XS: XS domain; InterPro: IPR005380 The XS (rice ge 80.43
>KOG0148|consensus Back     alignment and domain information
Probab=100.00  E-value=6.2e-50  Score=324.44  Aligned_cols=242  Identities=58%  Similarity=1.035  Sum_probs=225.0

Q ss_pred             CCCCCCeEEEeCCChhccHHHHHHHhcccCCceEEEEeecCCCCCeEEEEEccHHHHHHHHHHhcCeeeccceeeEeecC
Q psy2618           3 DESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWAS   82 (390)
Q Consensus         3 ~~~~~~~l~v~nLp~~~~~~~l~~~f~~~G~v~~v~~~~~~~~~g~afV~F~~~~~A~~a~~~l~~~~~~g~~l~v~~~~   82 (390)
                      ++++.|||||+||+.++||+-|..||++.|+|.+++++.+                                +++|.|+.
T Consensus         2 ~~~~prtlyvgnld~~vte~~i~~lf~qig~v~~~k~i~~--------------------------------e~~v~wa~   49 (321)
T KOG0148|consen    2 GSDEPRTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVIFD--------------------------------ELKVNWAT   49 (321)
T ss_pred             CCCCCceEEeeccChhhHHHHHHHHHHhccccccceeehh--------------------------------hhcccccc
Confidence            4678899999999999999999999999999999999865                                78888998


Q ss_pred             CCCCCCCCCCCCceEEEEcCCCcccCHHHHHHHhCCCCCeeEEEEeeCCCCCCCCcEEEEEecCHHHHHHHHHHhcCcee
Q psy2618          83 SPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWL  162 (390)
Q Consensus        83 ~~~~~~~~~~~~~~~l~v~nl~~~~~~~~l~~~f~~~G~i~~~~~~~~~~~g~~~g~afv~f~~~~~a~~a~~~l~~~~~  162 (390)
                      .+...++.....+..+||+.|..+++.++|++.|.+||+|.+++|++|..|++++||+||.|.+.++|++||..++|..|
T Consensus        50 ~p~nQsk~t~~~hfhvfvgdls~eI~~e~lr~aF~pFGevS~akvirD~~T~KsKGYgFVSf~~k~dAEnAI~~MnGqWl  129 (321)
T KOG0148|consen   50 APGNQSKPTSNQHFHVFVGDLSPEIDNEKLREAFAPFGEVSDAKVIRDMNTGKSKGYGFVSFPNKEDAENAIQQMNGQWL  129 (321)
T ss_pred             CcccCCCCccccceeEEehhcchhcchHHHHHHhccccccccceEeecccCCcccceeEEeccchHHHHHHHHHhCCeee
Confidence            88777788888899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeeEEEeecCCCCCCCcccccccCCCCccccccccccCCCCCcceeEEcCCCCCCcHHHHHhhhcCCCceeEEEEecCC
Q psy2618         163 GSRSIRTNWSTRKPPAMTNERKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNEELVSKVFSPFGTIVDIRVFKEK  242 (390)
Q Consensus       163 ~g~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~~l~~~~~~~~l~~~f~~~g~v~~~~~~~~~  242 (390)
                      ++|.|+..|+.+++         .........++++++..++++|+|||||++..++|++|++.|++||.|.+|++.+++
T Consensus       130 G~R~IRTNWATRKp---------~e~n~~~ltfdeV~NQssp~NtsVY~G~I~~~lte~~mr~~Fs~fG~I~EVRvFk~q  200 (321)
T KOG0148|consen  130 GRRTIRTNWATRKP---------SEMNGKPLTFDEVYNQSSPDNTSVYVGNIASGLTEDLMRQTFSPFGPIQEVRVFKDQ  200 (321)
T ss_pred             ccceeeccccccCc---------cccCCCCccHHHHhccCCCCCceEEeCCcCccccHHHHHHhcccCCcceEEEEeccc
Confidence            99999999999887         122333467888999999999999999999999999999999999999999999999


Q ss_pred             CeEEEEecCHHHHHHHHHHhcCceecCeEEEEEecccCCCCCC
Q psy2618         243 GYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESENNST  285 (390)
Q Consensus       243 g~~fv~f~~~~~a~~a~~~l~~~~~~g~~i~v~~~~~~~~~~~  285 (390)
                      ||+||+|++.|.|.+||..+|+.++.|..++|+|.+.......
T Consensus       201 GYaFVrF~tkEaAahAIv~mNntei~G~~VkCsWGKe~~~~~~  243 (321)
T KOG0148|consen  201 GYAFVRFETKEAAAHAIVQMNNTEIGGQLVRCSWGKEGDDGIN  243 (321)
T ss_pred             ceEEEEecchhhHHHHHHHhcCceeCceEEEEeccccCCCCCC
Confidence            9999999999999999999999999999999999988765433



>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG4019|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4019|consensus Back     alignment and domain information
>KOG2236|consensus Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>KOG2295|consensus Back     alignment and domain information
>PF03468 XS: XS domain; InterPro: IPR005380 The XS (rice gene X and SGS3) domain is found in a family of plant proteins including gene X Q9SBW2 from SWISSPROT and SGS3 Q9LDX1 from SWISSPROT Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 2e-34
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 3e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 5e-34
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 2e-05
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 1e-29
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 5e-25
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 3e-13
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 9e-04
3bs9_A87 X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 8e-25
2cqi_A103 Solution Structure Of The Rna Binding Domain Of Nuc 6e-19
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-18
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 7e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 1e-18
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 5e-05
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 4e-15
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-11
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 7e-15
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 1e-14
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 3e-06
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 2e-14
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 4e-11
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 4e-14
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-12
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 4e-14
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-12
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 8e-13
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-12
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 2e-12
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 2e-12
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 4e-04
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 3e-12
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 3e-11
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 3e-11
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-11
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 3e-11
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-11
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 4e-11
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 4e-11
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-10
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-10
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 2e-10
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 6e-07
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 4e-10
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 7e-07
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-09
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-04
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 1e-09
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 1e-09
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 1e-09
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 1e-09
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 3e-07
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 1e-09
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 9e-07
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 1e-09
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 7e-07
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 2e-09
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 1e-06
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 5e-09
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 6e-09
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 9e-09
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 1e-08
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 2e-08
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-08
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 5e-08
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 5e-08
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 6e-08
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 1e-04
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 8e-08
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 9e-08
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 1e-07
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 1e-07
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 4e-04
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 2e-07
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 2e-07
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 1e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 2e-07
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 3e-07
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 4e-07
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 4e-07
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 9e-07
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 2e-06
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 2e-06
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 2e-06
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 3e-06
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 3e-06
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 3e-06
2khc_A118 Bruno Rrm3+ Length = 118 4e-06
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 4e-06
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 4e-06
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 5e-06
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 5e-06
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 6e-06
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 6e-06
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 6e-06
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 6e-06
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 7e-06
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 8e-06
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 8e-06
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 8e-06
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 8e-06
2la4_A101 Nmr Structure Of The C-Terminal Rrm Domain Of Poly( 9e-06
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 9e-06
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 1e-05
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 3e-04
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 1e-05
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 2e-05
2u2f_A85 Solution Structure Of The Second Rna-Binding Domain 2e-05
2hyi_B91 Structure Of The Human Exon Junction Complex With A 2e-05
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 2e-05
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 2e-05
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-05
1sxl_A97 Resonance Assignments And Solution Structure Of The 2e-05
2dnh_A105 Solution Structure Of Rna Binding Domain In Bruno-L 3e-05
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 3e-05
2dhg_A104 Solution Structure Of The C-Terminal Rna Recognitio 3e-05
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 3e-05
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 4e-05
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 9e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 1e-04
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 1e-04
2div_A99 Solution Structure Of The Rrm Domain Of Trna Seleno 1e-04
2jvo_A108 Segmental Isotope Labeling Of Npl3 Length = 108 2e-04
1x5p_A97 Solution Structure Of Rrm Domain In Parp14 Length = 2e-04
2ytc_A85 Solution Structure Of Rna Binding Domain In Pre-Mrn 2e-04
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 2e-04
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 2e-04
2jx2_A121 Solution Structure Of Nelf E Rrm Length = 121 2e-04
2osq_A74 Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length 3e-04
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 3e-04
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 4e-04
1x4h_A111 Solution Structure Of Rrm Domain In Rna-Binding Pro 4e-04
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 5e-04
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 6e-04
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure

Iteration: 1

Score = 143 bits (361), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 65/98 (66%), Positives = 77/98 (78%) Query: 81 ASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYA 140 SS + K+DTSNH+H+FVGDLSPEI T+ +K AFAPFG+IS+ R+V+D T KSKGY Sbjct: 1 GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYG 60 Query: 141 FVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPA 178 FVSF K +AENAI M GQWLG R IRTNW+TRKPPA Sbjct: 61 FVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPA 98
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3BS9|A Chain A, X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 Back     alignment and structure
>pdb|2CQI|A Chain A, Solution Structure Of The Rna Binding Domain Of Nucleolysin Tiar Length = 103 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2LA4|A Chain A, Nmr Structure Of The C-Terminal Rrm Domain Of Poly(U) Binding 1 Length = 101 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|2U2F|A Chain A, Solution Structure Of The Second Rna-Binding Domain Of Hu2af65 Length = 85 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|2DNH|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 5 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2DHG|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif In Trna Selenocysteine Associated Protein Length = 104 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|2DIV|A Chain A, Solution Structure Of The Rrm Domain Of Trna Selenocysteine Associated Protein Length = 99 Back     alignment and structure
>pdb|2JVO|A Chain A, Segmental Isotope Labeling Of Npl3 Length = 108 Back     alignment and structure
>pdb|1X5P|A Chain A, Solution Structure Of Rrm Domain In Parp14 Length = 97 Back     alignment and structure
>pdb|2YTC|A Chain A, Solution Structure Of Rna Binding Domain In Pre-Mrna- Splicing Factor Rbm22 Length = 85 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|2JX2|A Chain A, Solution Conformation Of Rna-Bound Nelf-E Rrm Length = 121 Back     alignment and structure
>pdb|2OSQ|A Chain A, Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length = 74 Back     alignment and structure
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure
>pdb|1X4H|A Chain A, Solution Structure Of Rrm Domain In Rna-Binding Protein 28 Length = 111 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-95
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-42
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-77
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-40
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-14
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-74
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-57
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-72
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-47
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-38
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-71
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-55
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-66
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-46
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-14
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-64
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-37
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-17
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-08
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-63
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-41
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-11
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-58
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-41
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-57
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 6e-41
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-57
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-41
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-54
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 9e-42
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-50
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-18
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-14
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-47
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-16
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-14
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-47
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-28
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-45
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-25
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-13
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-40
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-15
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-40
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 9e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-11
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-38
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-13
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-36
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 7e-15
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-14
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 6e-36
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 4e-15
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 7e-11
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 7e-36
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-12
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-35
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-25
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-21
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-35
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-32
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-08
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-34
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-22
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-19
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-34
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-16
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-34
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-31
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 8e-16
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-33
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-33
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-32
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-30
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 7e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-08
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 8e-32
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-17
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-14
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-31
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-13
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-31
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-15
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-15
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-31
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-16
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 5e-14
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 4e-31
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-14
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 7e-12
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-30
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-13
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-11
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-30
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-13
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-13
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-30
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-21
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-14
2div_A99 TRNA selenocysteine associated protein; structural 4e-30
2div_A99 TRNA selenocysteine associated protein; structural 8e-19
2div_A99 TRNA selenocysteine associated protein; structural 6e-11
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-29
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 9e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-12
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-29
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-13
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-28
2cpj_A99 Non-POU domain-containing octamer-binding protein; 8e-23
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-20
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-28
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 8e-14
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-11
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-28
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-13
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-11
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-28
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 7e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 4e-12
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-28
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-13
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-10
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-28
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-16
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-14
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-28
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 8e-16
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-15
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-28
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-19
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 4e-16
1x5p_A97 Negative elongation factor E; structure genomics, 3e-28
1x5p_A97 Negative elongation factor E; structure genomics, 2e-22
1x5p_A97 Negative elongation factor E; structure genomics, 2e-15
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-28
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 4e-28
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-15
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-13
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 8e-28
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-19
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-27
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-13
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-27
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-14
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-14
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-27
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-13
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-12
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-27
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-14
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-12
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-26
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-13
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-26
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-16
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 4e-13
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-26
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-13
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-12
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-26
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-10
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-25
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-17
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-13
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-25
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-14
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-09
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-25
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 9e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 4e-25
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-10
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 5e-25
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 6e-25
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-15
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-15
2cph_A107 RNA binding motif protein 19; RNA recognition moti 7e-25
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-24
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-12
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-24
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-15
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-14
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-24
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-12
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-23
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-22
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-13
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-23
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-22
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 8e-17
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-23
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-14
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-11
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-23
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-14
1x5o_A114 RNA binding motif, single-stranded interacting pro 7e-13
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-23
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 7e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 5e-07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-23
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-14
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-13
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-23
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-11
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-11
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-23
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-17
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-10
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 8e-23
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-20
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-20
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-22
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-13
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-22
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-14
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-22
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-13
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-08
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-22
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-14
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-22
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-17
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-11
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 8e-22
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-13
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-11
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 8e-22
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 7e-12
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 6e-10
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-21
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-15
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-10
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-21
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-12
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-09
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-21
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-11
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-21
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-19
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-13
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-21
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-12
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 4e-21
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 5e-13
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-21
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-11
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-21
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-14
3n9u_C156 Cleavage and polyadenylation specificity factor S; 8e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-21
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 6e-12
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 8e-21
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-19
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-20
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-12
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 3e-20
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 3e-12
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-20
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 5e-20
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-17
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-14
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-20
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-14
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-11
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-20
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-18
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 8e-20
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-15
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-19
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-12
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-19
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-09
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-19
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-15
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-14
2la6_A99 RNA-binding protein FUS; structural genomics, nort 4e-19
2la6_A99 RNA-binding protein FUS; structural genomics, nort 7e-12
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-11
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 5e-19
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-14
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-19
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 8e-06
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-19
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-07
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 6e-19
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 7e-13
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-11
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-18
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-10
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-18
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-08
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-18
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-18
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 9e-07
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 6e-06
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-18
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-10
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-18
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 5e-08
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-18
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 9e-17
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-14
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 7e-18
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-06
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 7e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-18
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-14
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-11
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-17
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 7e-06
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-17
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-17
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-17
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-08
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-17
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-15
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 5e-17
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-08
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-17
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-09
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-17
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 6e-15
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 9e-17
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-15
2dis_A109 Unnamed protein product; structural genomics, RRM 5e-14
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-16
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-13
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-15
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 4e-10
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-07
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-15
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-12
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-15
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-15
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-10
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-15
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 4e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-15
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-11
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-14
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-07
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 5e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-14
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-12
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-14
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-13
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-14
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 7e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-08
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 7e-14
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-10
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 9e-14
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-13
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 6e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-14
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-11
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-10
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 1e-13
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 1e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-13
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 4e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 5e-13
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 7e-13
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 8e-12
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 7e-13
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-10
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 9e-13
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 7e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-05
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-12
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-12
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-09
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-12
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-09
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-12
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 5e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-12
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 4e-07
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 8e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 9e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-12
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-10
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 7e-06
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-12
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-10
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 7e-12
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 9e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 6e-09
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 9e-12
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-11
2krb_A81 Eukaryotic translation initiation factor 3 subunit 9e-10
2krb_A81 Eukaryotic translation initiation factor 3 subunit 4e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-10
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 5e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 5e-10
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 9e-10
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-09
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-07
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 8e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-08
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 4e-09
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 9e-07
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 8e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-09
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-08
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-06
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-08
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 6e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 4e-07
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 1e-06
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 3e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 3e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 4e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 5e-05
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 3e-06
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 7e-06
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 4e-04
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 7e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2dit_A112 HIV TAT specific factor 1 variant; structural geno 3e-05
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-04
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 7e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 7e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 7e-05
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 7e-05
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 2e-04
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 7e-04
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
 Score =  286 bits (734), Expect = 1e-95
 Identities = 58/303 (19%), Positives = 108/303 (35%), Gaps = 44/303 (14%)

Query: 3   DESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATA 62
                  + +  L   VT + +  L S    +K C V +  G    AF+  ++   A  A
Sbjct: 18  QFRNRRKILIRGLPGDVTNQEVHDLLSDYE-LKYCFVDKYKG---TAFVTLLNGEQAEAA 73

Query: 63  LAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEI 122
           + A ++    E+E+ V    +              + V +L P +  Q  +E   PFG +
Sbjct: 74  INAFHQSRLRERELSVQLQPTDAL-----------LCVANLPPSLTQQQFEELVRPFGSL 122

Query: 123 SNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKPPAMTNE 182
             C +V   +T +SKGY F  ++KK  A  A + + G+ LG R++  +W+          
Sbjct: 123 ERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPALL 182

Query: 183 RKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDLNE-ELVSKVFSPFGTIVDIRVF-- 239
             R                       +         N+ + + +  S   +    ++   
Sbjct: 183 HSR----------------------CLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACG 220

Query: 240 ---KEKGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKE-SENNSTLAQPSAPTTP 295
              + KG+A +++ T E A  A +      + G  ++  +        S LA   A    
Sbjct: 221 QDGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQAT 280

Query: 296 QPN 298
             N
Sbjct: 281 ALN 283


>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 100.0
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.98
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.98
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.98
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.96
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.9
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.89
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.86
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.86
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.85
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.85
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.82
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.82
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.82
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.81
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.8
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.8
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.8
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.79
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.79
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.79
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.79
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.79
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.79
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.79
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.78
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.78
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.78
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.78
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.78
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.78
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.78
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.77
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.77
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.77
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.77
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.77
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.77
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.77
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.77
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.77
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.77
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.77
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.77
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.77
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.77
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.77
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.77
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.77
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.77
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.76
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.76
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.76
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.76
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.76
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.76
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.76
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.76
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.76
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.76
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.76
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.76
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.76
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.76
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.76
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.76
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.76
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.76
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.76
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.76
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.76
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.76
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.76
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.76
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.76
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.75
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.75
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.75
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.75
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.75
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.75
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.75
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.75
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.75
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.75
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.75
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.75
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.75
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.75
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.75
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.75
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.75
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.75
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.75
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.74
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.74
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.74
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.74
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.74
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.74
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.74
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.74
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.74
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.74
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.74
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.74
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.74
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.74
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.74
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.74
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.74
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.74
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.74
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.74
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.74
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
2div_A99 TRNA selenocysteine associated protein; structural 99.74
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.74
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.74
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.74
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.74
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.74
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.74
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.73
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.73
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.73
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.73
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.73
2div_A99 TRNA selenocysteine associated protein; structural 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.73
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.73
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.73
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.73
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.73
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.73
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.73
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.73
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.73
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.73
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.73
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.73
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.73
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.73
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.72
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.72
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.72
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.72
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.72
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.72
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.72
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.72
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.72
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.72
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.72
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.72
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.72
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.72
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.72
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.72
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.72
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.72
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.72
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.72
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.72
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.72
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.72
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.72
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.72
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.71
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.71
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.71
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.71
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.71
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.71
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.71
2dis_A109 Unnamed protein product; structural genomics, RRM 99.71
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.71
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.71
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.71
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.71
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.71
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.71
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.71
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.71
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.71
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.71
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.71
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.71
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.7
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.7
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.7
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.7
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.7
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.7
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.7
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.7
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.7
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.7
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.7
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.7
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.7
2dis_A109 Unnamed protein product; structural genomics, RRM 99.7
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.7
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.7
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.7
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.7
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.7
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.69
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.69
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.69
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.69
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.69
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.69
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.69
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.69
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.69
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.69
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.69
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.69
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.69
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.69
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.69
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.69
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.69
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.68
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.68
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.68
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.68
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.68
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.68
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.68
1x5p_A97 Negative elongation factor E; structure genomics, 99.68
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.68
1x5p_A97 Negative elongation factor E; structure genomics, 99.68
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.68
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.68
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.67
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.67
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.67
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.67
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.67
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.67
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.67
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.67
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.67
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.67
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.67
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.66
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.66
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.66
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.66
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.66
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.66
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.66
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.66
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.65
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.65
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.65
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.65
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.65
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.65
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.65
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.65
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.46
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.64
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.64
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.64
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.64
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.64
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.64
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.64
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.64
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.64
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.63
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.63
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.44
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.63
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.63
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.62
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.62
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.62
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.62
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.62
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.61
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.61
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.61
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.61
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.6
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.6
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.6
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.6
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.58
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.57
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.57
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.57
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.57
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.55
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.52
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.51
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.47
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.46
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.45
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.43
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.43
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.4
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.39
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.39
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.38
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.37
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.33
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.33
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.25
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.22
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.21
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.17
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.06
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.06
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.75
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.73
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.72
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.67
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.43
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.36
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.24
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.14
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.11
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.76
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.68
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.57
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.5
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.49
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 97.4
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.28
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.09
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.75
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.7
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.65
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.07
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.39
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 90.52
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 83.23
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=8.6e-47  Score=336.17  Aligned_cols=241  Identities=21%  Similarity=0.354  Sum_probs=220.7

Q ss_pred             CCCCeEEEeCCChhccHHHHHHHhcccCCceEEEEeecCCCCCeEEEEEccHHHHHHHHHHhcCeeeccceeeEeecCCC
Q psy2618           5 SQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWASSP   84 (390)
Q Consensus         5 ~~~~~l~v~nLp~~~~~~~l~~~f~~~G~v~~v~~~~~~~~~g~afV~F~~~~~A~~a~~~l~~~~~~g~~l~v~~~~~~   84 (390)
                      +++++|||+|||.++++++|+++|+.|| |.++++   ..++|||||+|.+.++|.+|++.|++..+.|+.|.|.++.  
T Consensus        20 ~~~~~l~V~nLp~~~te~~l~~~F~~~G-i~~~~~---~~~~g~afV~f~~~~~A~~A~~~l~~~~~~g~~i~v~~~~--   93 (284)
T 3smz_A           20 RNRRKILIRGLPGDVTNQEVHDLLSDYE-LKYCFV---DKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQP--   93 (284)
T ss_dssp             HCCCEEEEECCCTTCCHHHHHHHTTTSC-EEEEEE---ETTTTEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC--
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHHcC-CEEEEE---ecCCCEEEEEeCCHHHHHHHHHHcCCCeeCCeEEEEEecC--
Confidence            4689999999999999999999999999 999988   3467899999999999999999999999999999999864  


Q ss_pred             CCCCCCCCCCceEEEEcCCCcccCHHHHHHHhCCCCCeeEEEEeeCCCCCCCCcEEEEEecCHHHHHHHHHHhcCceeCC
Q psy2618          85 GNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGS  164 (390)
Q Consensus        85 ~~~~~~~~~~~~~l~v~nl~~~~~~~~l~~~f~~~G~i~~~~~~~~~~~g~~~g~afv~f~~~~~a~~a~~~l~~~~~~g  164 (390)
                               ..++|||+|||+++++++|+++|+.||.|..+.++.++.+|+++|||||+|.+.++|.+|++.+++..+.|
T Consensus        94 ---------~~~~l~v~nlp~~~t~~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g  164 (284)
T 3smz_A           94 ---------TDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGP  164 (284)
T ss_dssp             ---------CSCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETT
T ss_pred             ---------CCCEEEEcCCCCcCCHHHHHHHHHhcCCeeEEEEEeeCCCCccceEEEEEECCHHHHHHHHHHhCCCEeCC
Confidence                     34789999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEEeecCCCCCCCcccccccCCCCccccccccccCCCCCcceeEEcCCCCCC-cHHHHHhhhcCCCceeEEEEecC--
Q psy2618         165 RSIRTNWSTRKPPAMTNERKRQNSHTKTITFDEVYNQSSPTNCTVYCGGFGKDL-NEELVSKVFSPFGTIVDIRVFKE--  241 (390)
Q Consensus       165 ~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~~l~~~~-~~~~l~~~f~~~g~v~~~~~~~~--  241 (390)
                      +.|.|.++......                      ......++|||+|||..+ ++++|+++|+.||.|.++.+.++  
T Consensus       165 ~~i~v~~a~~~~~~----------------------~~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~~v~i~~~~~  222 (284)
T 3smz_A          165 RTLYVHWTDAGQLT----------------------PALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQD  222 (284)
T ss_dssp             EECEEEECCGGGCC----------------------TTTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCSEEEEEECSS
T ss_pred             cEEEEEECCCCCCC----------------------cccCCccEEEEecCCcccCCHHHHHHHhhCCCCeEEEEEEECCC
Confidence            99999998654221                      112345679999999995 99999999999999999999876  


Q ss_pred             ---CCeEEEEecCHHHHHHHHHHhcCceecCeEEEEEecccCCC
Q psy2618         242 ---KGYAFVKFTTKETATHAIESIHNTDINGHTVKCFWGKESEN  282 (390)
Q Consensus       242 ---~g~~fv~f~~~~~a~~a~~~l~~~~~~g~~i~v~~~~~~~~  282 (390)
                         +|+|||+|.+.++|.+|+..|||..++|+.|.|.|+++...
T Consensus       223 g~~~g~afV~f~~~~~A~~A~~~l~g~~~~g~~l~v~~a~~~~~  266 (284)
T 3smz_A          223 GQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPGPP  266 (284)
T ss_dssp             CCEEEEEEEECSSHHHHHHHHHHHTTCEETTEECEEEECCSSSC
T ss_pred             CCcccEEEEEeCCHHHHHHHHHHhCCCccCCeEEEEEEecCCCc
Confidence               78999999999999999999999999999999999987754



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 9e-26
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 9e-18
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-25
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-17
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-21
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 6e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-19
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-13
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-18
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-14
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-18
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-18
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-16
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-17
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-16
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-16
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 8e-15
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-16
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 8e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-16
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 8e-09
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-16
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 8e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 6e-16
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 6e-13
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 3e-08
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-15
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-10
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 7e-10
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-15
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-11
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 6e-07
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-15
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-13
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-08
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-15
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-08
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-15
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-14
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 9e-08
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 9e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-14
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-09
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-14
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 8e-13
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-14
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-09
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-14
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-14
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 6e-12
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-11
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-14
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-13
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 5e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-14
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-14
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 6e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-14
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 8e-14
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 8e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 8e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-13
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-13
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-11
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-13
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 8e-13
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 3e-13
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-11
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 7e-07
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-13
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 7e-11
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 7e-13
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-11
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-06
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 7e-13
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 9e-13
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-12
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-12
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 4e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-10
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-12
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 4e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-12
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 8e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 6e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 6e-04
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 8e-12
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 7e-08
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 8e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 3e-11
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 3e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 6e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-10
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 7e-07
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-10
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 3e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 3e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 3e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-09
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-10
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.004
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-10
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 4e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-10
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 7e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.002
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-10
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-05
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 8e-10
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 5e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.001
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-09
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 6e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-09
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 3e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-09
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-07
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-09
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-07
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-09
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 8e-09
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 9e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-08
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 8e-08
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-06
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 9e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 4e-07
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.001
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-07
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-07
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 4e-06
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 2e-07
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-07
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-06
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 4e-06
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 3e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 7e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 4e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 4e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 8e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-04
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  100 bits (249), Expect = 9e-26
 Identities = 38/177 (21%), Positives = 68/177 (38%), Gaps = 4/177 (2%)

Query: 3   DESQPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPGNDP---YAFLEFVHHTVA 59
           +  Q   L++G L    T+E L + F Q G +  C V+R+P       + F+ +      
Sbjct: 2   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 61

Query: 60  ATALAAMNKRVFLEKEMKVNWASSPGNQPKQDTSNHYHIFVGDLSPEIETQTLKEAFAPF 119
             A+ A   +V           S   +Q          IFVG +  + E   L++ F  +
Sbjct: 62  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQY 121

Query: 120 GEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQWLGSRSIRTNWSTRKP 176
           G+I    I+ D  + K +G+AFV+F      +  +       +   +     +  K 
Sbjct: 122 GKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV-IQKYHTVNGHNCEVRKALSKQ 177


>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.96
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.86
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.83
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.83
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.82
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.82
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.82
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.82
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.82
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.81
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.81
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.81
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.81
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.81
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.81
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.81
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.8
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.8
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.79
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.79
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.79
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.79
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.79
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.78
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.78
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.78
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.78
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.78
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.78
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.78
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.78
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.78
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.78
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.77
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.77
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.77
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.77
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.76
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.76
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.76
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.76
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.76
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.76
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.76
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.76
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.76
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.75
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.75
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.75
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.75
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.74
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.74
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.74
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.74
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.74
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.74
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.74
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.74
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.74
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.74
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.74
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.74
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.73
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.73
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.73
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.73
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.73
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.73
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.73
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.73
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.72
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.72
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.72
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.72
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.72
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.72
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.71
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.71
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.71
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.71
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.71
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.71
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.7
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.7
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.7
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.7
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.7
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.69
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.68
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.67
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.66
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.66
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.65
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.62
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.58
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.54
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.53
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.52
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.52
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.51
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.49
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.47
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.46
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.45
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.43
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.42
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.41
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.15
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.13
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.78
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.78
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.69
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.54
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.4
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.27
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1e-31  Score=220.73  Aligned_cols=168  Identities=22%  Similarity=0.390  Sum_probs=148.4

Q ss_pred             CCCeEEEeCCChhccHHHHHHHhcccCCceEEEEeecCC---CCCeEEEEEccHHHHHHHHHHhcCeeeccceeeEeecC
Q psy2618           6 QPTTLYVGNLDVSVTEELLCALFSQIGPVKGCKVIREPG---NDPYAFLEFVHHTVAATALAAMNKRVFLEKEMKVNWAS   82 (390)
Q Consensus         6 ~~~~l~v~nLp~~~~~~~l~~~f~~~G~v~~v~~~~~~~---~~g~afV~F~~~~~A~~a~~~l~~~~~~g~~l~v~~~~   82 (390)
                      ..|+|||+|||+++++++|+++|+.||.|.+++++++..   ++|+|||+|.+.++|..|++. ++..+.++.+.+.+..
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~-~~~~~~~~~~~~~~~~   83 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA-RPHKVDGRVVEPKRAV   83 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHT-CSCEETTEECEEEECC
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHh-cCCcccccchhhhhhh
Confidence            348999999999999999999999999999999987753   568999999999999999975 6667788888888776


Q ss_pred             CCCCCC-CCCCCCceEEEEcCCCcccCHHHHHHHhCCCCCeeEEEEeeCCCCCCCCcEEEEEecCHHHHHHHHHHhcCce
Q psy2618          83 SPGNQP-KQDTSNHYHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAITAMNGQW  161 (390)
Q Consensus        83 ~~~~~~-~~~~~~~~~l~v~nl~~~~~~~~l~~~f~~~G~i~~~~~~~~~~~g~~~g~afv~f~~~~~a~~a~~~l~~~~  161 (390)
                      ...... .......++|||+|||+.+++++|+++|+.||.|..+.++.+..+|+++|||||+|.+.++|.+|++ +++..
T Consensus        84 ~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~  162 (183)
T d1u1qa_          84 SREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHT  162 (183)
T ss_dssp             CTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEE
T ss_pred             hcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCe
Confidence            554432 3345567899999999999999999999999999999999999999999999999999999999996 68899


Q ss_pred             eCCeeEEEeecCCC
Q psy2618         162 LGSRSIRTNWSTRK  175 (390)
Q Consensus       162 ~~g~~i~v~~~~~~  175 (390)
                      +.|+.|.|.++.++
T Consensus       163 ~~G~~i~V~~A~~k  176 (183)
T d1u1qa_         163 VNGHNCEVRKALSK  176 (183)
T ss_dssp             ETTEEEEEEECCCH
T ss_pred             ECCEEEEEEecCCc
Confidence            99999999998654



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure