Psyllid ID: psy2620

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-
MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDFSKIKLEEEAS
ccccccEEEEcccHHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHcccccccccccccccccccccccEEEcccHHHHHHHHcccccEEEEEEEcEEEEEEccEEEEccccHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccEEEccccccEEEEEccEEEEEEcccEEEEEEEEEEcccccccccccccEEEEEEEEccccccccccccEEEEEcccccccccccEEEEEEccccccccccEEEEEEEEEccccccccccHHHHHHccccccccccccccEEcccccccccEEEcccccccccHHHHHHHHHHHHHHHccccccccccccHHHcc
cccEEEEEEEcccHHHHHHHHHHHHccccEEEEcccccccHHHcEEccHHHHHHHccccccccHHHccHHHccEEccccEEEcccHHHHHHHHHcHHHHccEEEccEEEEEEccEEEEccccHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHcccccccccEHHHHHHHccccHHHHHHHHHHcccccccHHHHcEHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEccccccEEEEEccEEEEEEEccEEEEEEEEEEcHHHcHHHEEEEEEEEEEEEEEccccccccccccEEEEEcHHHHcccccEEEEEEEHHHcccccccEEEEEEEEcccccHHHHcHHHHcccccccEEEEEEEEEEEEccccccccEEEccccccccEcHHHHHHHHHHHHHHHcccccccccccccccc
MDEEYDAIVLGTGLKECILSgmlsvsgkkvlhidrnkyyggesasitpLEELFSKfgstlpdevtfgrgrdwnvdlipKFLMANGSLVKLLIHTGVTrylefksvegsyvfkggkiskvpvdqKEALASDLMGLFEKRRFRNFLVYIQEfseadpktwkdinpqsattaqlydkfgldpntkdftghalalyrddeyiNDLAIHTIRRIKLYSDSlarygkspylypmyglgelpqSFARLSAIYggtymldkpvdeIVIENGkvvgvrsgteiarckqvycdpsyvqDRVKKLNQVIRCIclmdhpipntkdalscqiiipqkqvnrksdIYVSLVSYTHQVSAKGWFIAMVSTTvetdnpeleikpgldllgsykkkfvtvsdyyeptdlgtesqifistsydatthfETVCTDVVNLfkrgtgedfdfskikleeeas
MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKsvegsyvfkggkiskvpvdQKEALASDLMGLFEKRRFRNFLVYIQEfseadpktwkdinPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVEtdnpeleikpgldllgsYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRgtgedfdfskikleeeas
MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDFSKIKLEEEAS
****YDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDF**********
MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALA*DLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTT********EIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFD***********
MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDFSKIKLEEEAS
*DEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDF**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDFSKIKLEEEAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query441 2.2.26 [Sep-21-2011]
P50395445 Rab GDP dissociation inhi yes N/A 0.986 0.977 0.673 1e-178
P21856447 Rab GDP dissociation inhi yes N/A 0.993 0.979 0.666 1e-177
O97555447 Rab GDP dissociation inhi yes N/A 0.993 0.979 0.662 1e-177
P50398447 Rab GDP dissociation inhi yes N/A 0.993 0.979 0.662 1e-177
P50396447 Rab GDP dissociation inhi yes N/A 0.993 0.979 0.662 1e-176
Q8HXX7447 Rab GDP dissociation inhi N/A N/A 0.993 0.979 0.662 1e-176
Q7YQM0447 Rab GDP dissociation inhi N/A N/A 0.993 0.979 0.662 1e-176
O97556445 Rab GDP dissociation inhi no N/A 0.986 0.977 0.662 1e-176
Q5RCE1445 Rab GDP dissociation inhi yes N/A 0.986 0.977 0.668 1e-176
P60028447 Rab GDP dissociation inhi no N/A 0.993 0.979 0.659 1e-176
>sp|P50395|GDIB_HUMAN Rab GDP dissociation inhibitor beta OS=Homo sapiens GN=GDI2 PE=1 SV=2 Back     alignment and function desciption
 Score =  623 bits (1607), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 293/435 (67%), Positives = 356/435 (81%)

Query: 1   MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTL 60
           M+EEYD IVLGTGL ECILSG++SV+GKKVLH+DRN YYGGESASITPLE+L+ +F    
Sbjct: 1   MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPG 60

Query: 61  PDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVP 120
               + GRGRDWNVDLIPKFLMANG LVK+L++T VTRYL+FK  EGS+V+KGGKI KVP
Sbjct: 61  SPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP 120

Query: 121 VDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPN 180
             + EALAS LMGLFEKRRFR FLVY+  F E DP+T++ I+P+  T   +Y KF L  +
Sbjct: 121 STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQD 180

Query: 181 TKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFAR 240
             DFTGHALALYR D+Y++     TI RIKLYS+SLARYGKSPYLYP+YGLGELPQ FAR
Sbjct: 181 VIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR 240

Query: 241 LSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRC 300
           LSAIYGGTYML+KP++EI+++NGKV+GV+S  EIARCKQ+ CDPSYV+DRV+K+ QVIR 
Sbjct: 241 LSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV 300

Query: 301 ICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETD 360
           IC++ HPI NT DA SCQIIIPQ QVNRKSDIYV ++S+ H V+A+G +IA+VSTTVET 
Sbjct: 301 ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK 360

Query: 361 NPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNL 420
            PE EI+P L+LL   ++KFV++SD   P DLGTESQIFIS +YDATTHFET C D+ N+
Sbjct: 361 EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI 420

Query: 421 FKRGTGEDFDFSKIK 435
           +KR TG +FDF ++K
Sbjct: 421 YKRMTGSEFDFEEMK 435
Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Homo sapiens (taxid: 9606)
>sp|P21856|GDIA_BOVIN Rab GDP dissociation inhibitor alpha OS=Bos taurus GN=GDI1 PE=1 SV=1 Back     alignment and function description
>sp|O97555|GDIA_CANFA Rab GDP dissociation inhibitor alpha OS=Canis familiaris GN=GDI1 PE=2 SV=1 Back     alignment and function description
>sp|P50398|GDIA_RAT Rab GDP dissociation inhibitor alpha OS=Rattus norvegicus GN=Gdi1 PE=1 SV=1 Back     alignment and function description
>sp|P50396|GDIA_MOUSE Rab GDP dissociation inhibitor alpha OS=Mus musculus GN=Gdi1 PE=1 SV=3 Back     alignment and function description
>sp|Q8HXX7|GDIA_MACFA Rab GDP dissociation inhibitor alpha OS=Macaca fascicularis GN=GDI1 PE=2 SV=1 Back     alignment and function description
>sp|Q7YQM0|GDIA_PONPY Rab GDP dissociation inhibitor alpha OS=Pongo pygmaeus GN=GDI1 PE=2 SV=1 Back     alignment and function description
>sp|O97556|GDIB_CANFA Rab GDP dissociation inhibitor beta OS=Canis familiaris GN=GDI2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCE1|GDIB_PONAB Rab GDP dissociation inhibitor beta OS=Pongo abelii GN=GDI2 PE=2 SV=1 Back     alignment and function description
>sp|P60028|GDIA_PANTR Rab GDP dissociation inhibitor alpha OS=Pan troglodytes GN=GDI1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query441
91080775443 PREDICTED: similar to rab gdp-dissociati 0.988 0.984 0.831 0.0
357614755443 putative rab gdp-dissociation inhibitor 0.988 0.984 0.833 0.0
242025420442 Rab GDP dissociation inhibitor alpha, pu 0.988 0.986 0.832 0.0
332376005443 unknown [Dendroctonus ponderosae] 0.988 0.984 0.826 0.0
157133861443 rab gdp-dissociation inhibitor [Aedes ae 0.988 0.984 0.819 0.0
194765529443 GF21994 [Drosophila ananassae] gi|190617 0.988 0.984 0.812 0.0
195438220443 GK24240 [Drosophila willistoni] gi|19416 0.988 0.984 0.817 0.0
195339459443 GM12441 [Drosophila sechellia] gi|195577 0.988 0.984 0.812 0.0
24583049443 GDP dissociation inhibitor, isoform A [D 0.988 0.984 0.812 0.0
195397925443 GJ18203 [Drosophila virilis] gi|19414123 0.988 0.984 0.817 0.0
>gi|91080775|ref|XP_968281.1| PREDICTED: similar to rab gdp-dissociation inhibitor [Tribolium castaneum] gi|270005439|gb|EFA01887.1| hypothetical protein TcasGA2_TC007497 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/438 (83%), Positives = 402/438 (91%), Gaps = 2/438 (0%)

Query: 1   MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTL 60
           MDEEYDAIVLGTGLKECILSGMLSVSGKKVLH+DRNKYYGGESASI PLEELFSKFG+  
Sbjct: 1   MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHVDRNKYYGGESASICPLEELFSKFGAPA 60

Query: 61  PDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVP 120
           PDE ++GRGRDWNVDLIPKFLMANG LVKLLIHTGVTRYLEFKSVEGSYV+KGGKISKVP
Sbjct: 61  PDE-SYGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSVEGSYVYKGGKISKVP 119

Query: 121 VDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPN 180
           VDQKEALASDLMG+FEKRRFRNFL+Y+Q+F + DPKTWKD +P +A    LYDKFGLD N
Sbjct: 120 VDQKEALASDLMGMFEKRRFRNFLIYVQDFQQEDPKTWKDFDPNTADMQALYDKFGLDKN 179

Query: 181 TKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFAR 240
           T+DFTGHALAL+RDD+Y+   A+ TI RIKLYSDSLARYGKSPYLYPMYGLGELPQ FAR
Sbjct: 180 TQDFTGHALALFRDDDYLKRPALETINRIKLYSDSLARYGKSPYLYPMYGLGELPQGFAR 239

Query: 241 LSAIYGGTYMLDKPVDEIVI-ENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIR 299
           LSAIYGGTYMLDKP+DEIV+ E G+VVGVRSGTE+A+CKQVYCDP+YV DRV+K  +V+R
Sbjct: 240 LSAIYGGTYMLDKPIDEIVLGEGGRVVGVRSGTEVAKCKQVYCDPTYVPDRVRKKGRVVR 299

Query: 300 CICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVET 359
           CICLMDHPI NTKDALS QIIIPQKQV R SDIYVSLVSYTHQV+AKGWF+AMVSTTVET
Sbjct: 300 CICLMDHPIANTKDALSTQIIIPQKQVGRNSDIYVSLVSYTHQVAAKGWFVAMVSTTVET 359

Query: 360 DNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVN 419
           DNPE+EIKPGLDLLGS ++KF++VSDYYEPTD G +SQIFIS SYDATTHFET C DV++
Sbjct: 360 DNPEIEIKPGLDLLGSIRQKFISVSDYYEPTDDGLQSQIFISQSYDATTHFETTCLDVLD 419

Query: 420 LFKRGTGEDFDFSKIKLE 437
           +FKRGTGE+FDFSKIK E
Sbjct: 420 IFKRGTGEEFDFSKIKHE 437

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357614755|gb|EHJ69256.1| putative rab gdp-dissociation inhibitor [Danaus plexippus] Back     alignment and taxonomy information
>gi|242025420|ref|XP_002433122.1| Rab GDP dissociation inhibitor alpha, putative [Pediculus humanus corporis] gi|212518663|gb|EEB20384.1| Rab GDP dissociation inhibitor alpha, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332376005|gb|AEE63143.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|157133861|ref|XP_001663045.1| rab gdp-dissociation inhibitor [Aedes aegypti] gi|108870669|gb|EAT34894.1| AAEL012904-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194765529|ref|XP_001964879.1| GF21994 [Drosophila ananassae] gi|190617489|gb|EDV33013.1| GF21994 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195438220|ref|XP_002067035.1| GK24240 [Drosophila willistoni] gi|194163120|gb|EDW78021.1| GK24240 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195339459|ref|XP_002036337.1| GM12441 [Drosophila sechellia] gi|195577837|ref|XP_002078775.1| GD22354 [Drosophila simulans] gi|194130217|gb|EDW52260.1| GM12441 [Drosophila sechellia] gi|194190784|gb|EDX04360.1| GD22354 [Drosophila simulans] Back     alignment and taxonomy information
>gi|24583049|ref|NP_523524.2| GDP dissociation inhibitor, isoform A [Drosophila melanogaster] gi|386769370|ref|NP_001245953.1| GDP dissociation inhibitor, isoform B [Drosophila melanogaster] gi|7297522|gb|AAF52777.1| GDP dissociation inhibitor, isoform A [Drosophila melanogaster] gi|17862730|gb|AAL39842.1| LD46767p [Drosophila melanogaster] gi|28317097|gb|AAO39567.1| LP03430p [Drosophila melanogaster] gi|220942300|gb|ACL83693.1| Gdi-PA [synthetic construct] gi|220952776|gb|ACL88931.1| Gdi-PA [synthetic construct] gi|383291407|gb|AFH03627.1| GDP dissociation inhibitor, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195397925|ref|XP_002057578.1| GJ18203 [Drosophila virilis] gi|194141232|gb|EDW57651.1| GJ18203 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query441
FB|FBgn0004868448 Gdi "GDP dissociation inhibito 0.975 0.959 0.791 1.5e-186
WB|WBGene00001558459 gdi-1 [Caenorhabditis elegans 0.984 0.945 0.695 1e-169
ZFIN|ZDB-GENE-050522-504447 gdi1 "GDP dissociation inhibit 0.990 0.977 0.678 1.9e-163
UNIPROTKB|P50395445 GDI2 "Rab GDP dissociation inh 0.979 0.970 0.678 1.2e-161
UNIPROTKB|P21856447 GDI1 "Rab GDP dissociation inh 0.993 0.979 0.666 6.5e-161
UNIPROTKB|I3L893447 GDI1 "Uncharacterized protein" 0.993 0.979 0.666 1.4e-160
UNIPROTKB|F1PWQ0447 GDI1 "Rab GDP dissociation inh 0.993 0.979 0.664 2.2e-160
UNIPROTKB|O97555447 GDI1 "Rab GDP dissociation inh 0.993 0.979 0.662 2.8e-160
RGD|2676447 Gdi1 "GDP dissociation inhibit 0.993 0.979 0.662 3.6e-160
ZFIN|ZDB-GENE-030131-2485448 gdi2 "GDP dissociation inhibit 0.986 0.970 0.671 3.6e-160
FB|FBgn0004868 Gdi "GDP dissociation inhibitor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1809 (641.9 bits), Expect = 1.5e-186, P = 1.5e-186
 Identities = 346/437 (79%), Positives = 381/437 (87%)

Query:     1 MDEEYDAIVLGTGLKECILSG-MLSVSGKKVLHIDRNKYYGGESASITPLEELFSKF--G 57
             MDEEYD  VLGTGLKECILSG MLSVSGKKVLHIDRNKYYGGESASITPLEELF ++  G
Sbjct:     1 MDEEYDVDVLGTGLKECILSGIMLSVSGKKVLHIDRNKYYGGESASITPLEELFQRYRTG 60

Query:    58 STLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKIS 117
             +  P    FGRGRDWNVDLIPKFLMANG LVKLLIHTGVTRYLEFKS+EGSYV+KGGKI+
Sbjct:    61 AARP---RFGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSIEGSYVYKGGKIA 117

Query:   118 KVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGL 177
             KVPVDQK     DLMG+FEKRRFRNFL+Y+Q+F E DPKTWKD +P  A    LYDKFGL
Sbjct:   118 KVPVDQKRPWHPDLMGMFEKRRFRNFLIYVQDFREDDPKTWKDFDPTKANMQGLYDKFGL 177

Query:   178 DPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQS 237
             D NT+DFTGHALAL+RDDEY+N+ A++TIRRIKLYSDSLARYGKSPYLYPMYGLGELPQ 
Sbjct:   178 DKNTQDFTGHALALFRDDEYLNEPAVNTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQG 237

Query:   238 FARLSAIYGGTYMLDKPVDEIVI-ENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQ 296
             FARLSAIYGGTYMLDKP+DEIV+ E GKVVGVRSG E+A+CKQVYCDPSYV  R++K  +
Sbjct:   238 FARLSAIYGGTYMLDKPIDEIVLGEGGKVVGVRSGEEVAKCKQVYCDPSYVPRRLRKRGK 297

Query:   297 VIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTT 356
             VIRCIC+ DHP  +TKD LS QIIIPQKQV RKSDIYVSLVS THQV+AKGWF+ MVSTT
Sbjct:   298 VIRCICIQDHPGASTKDGLSTQIIIPQKQVGRKSDIYVSLVSSTHQVAAKGWFVGMVSTT 357

Query:   357 VETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTD 416
             VET+NPE+EIKPGLDLL    +KFVT+SDY EP D G+ESQIFIS SYDATTHFET C D
Sbjct:   358 VETENPEVEIKPGLDLLEPIAQKFVTISDYLEPIDDGSESQIFISESYDATTHFETTCWD 417

Query:   417 VVNLFKRGTGEDFDFSK 433
             V+N+FKRGTGE FDFSK
Sbjct:   418 VLNIFKRGTGETFDFSK 434
GO:0005092 "GDP-dissociation inhibitor activity" evidence=ISS;NAS;IDA
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0016192 "vesicle-mediated transport" evidence=NAS
GO:0008021 "synaptic vesicle" evidence=NAS
GO:0015031 "protein transport" evidence=IEA
GO:0005093 "Rab GDP-dissociation inhibitor activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
WB|WBGene00001558 gdi-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-504 gdi1 "GDP dissociation inhibitor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P50395 GDI2 "Rab GDP dissociation inhibitor beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P21856 GDI1 "Rab GDP dissociation inhibitor alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L893 GDI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWQ0 GDI1 "Rab GDP dissociation inhibitor alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O97555 GDI1 "Rab GDP dissociation inhibitor alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2676 Gdi1 "GDP dissociation inhibitor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2485 gdi2 "GDP dissociation inhibitor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61598GDIB_MOUSENo assigned EC number0.65970.98630.9775noN/A
P50399GDIB_RATNo assigned EC number0.65970.98630.9775noN/A
P50398GDIA_RATNo assigned EC number0.66210.99310.9798yesN/A
P50397GDIB_BOVINNo assigned EC number0.66430.98630.9775noN/A
P50396GDIA_MOUSENo assigned EC number0.66210.99310.9798yesN/A
P50395GDIB_HUMANNo assigned EC number0.67350.98630.9775yesN/A
P31150GDIA_HUMANNo assigned EC number0.65980.99310.9798noN/A
Q5RCE1GDIB_PONABNo assigned EC number0.66890.98630.9775yesN/A
P39958GDI1_YEASTNo assigned EC number0.53220.96590.9445yesN/A
O97555GDIA_CANFANo assigned EC number0.66210.99310.9798yesN/A
O97556GDIB_CANFANo assigned EC number0.66200.98630.9775noN/A
Q10305GDI1_SCHPONo assigned EC number0.55070.98860.9909yesN/A
P21856GDIA_BOVINNo assigned EC number0.66660.99310.9798yesN/A
Q8HXX7GDIA_MACFANo assigned EC number0.66210.99310.9798N/AN/A
Q7YQM0GDIA_PONPYNo assigned EC number0.66210.99310.9798N/AN/A
P60028GDIA_PANTRNo assigned EC number0.65980.99310.9798noN/A
Q6Q7J2GDIB_PIGNo assigned EC number0.66200.98630.9775noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query441
pfam00996439 pfam00996, GDI, GDP dissociation inhibitor 0.0
PTZ00363443 PTZ00363, PTZ00363, rab-GDP dissociation inhibitor 0.0
COG5044434 COG5044, MRS6, RAB proteins geranylgeranyltransfer 1e-130
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 7e-05
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 0.004
>gnl|CDD|216232 pfam00996, GDI, GDP dissociation inhibitor Back     alignment and domain information 
 Score =  753 bits (1947), Expect = 0.0
 Identities = 312/441 (70%), Positives = 359/441 (81%), Gaps = 5/441 (1%)

Query: 1   MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKF--GS 58
           MDEEYD IVLGTGLKECILSG+LSV GKKVLHIDRN YYGGESAS++ LE+L+++F  G 
Sbjct: 1   MDEEYDVIVLGTGLKECILSGLLSVDGKKVLHIDRNDYYGGESASLS-LEQLYARFRGGE 59

Query: 59  TLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISK 118
             P     GR RDWNVDLIPKFLMANG LVKLLIHT VTRYLEFK+VEGSYV+KGGKI K
Sbjct: 60  EKPPSK-LGRSRDWNVDLIPKFLMANGELVKLLIHTDVTRYLEFKAVEGSYVYKGGKIHK 118

Query: 119 VPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLD 178
           VP ++ EAL+S LMG+FEKRRFR FL Y+Q++ E DPKT   ++P+  T  ++Y KFGLD
Sbjct: 119 VPANEMEALSSPLMGIFEKRRFRKFLTYVQDYDEDDPKTHDGLDPRKRTMLEVYKKFGLD 178

Query: 179 PNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSF 238
            NT DF GHALALYRDD+Y+N  A+ T+ RIKLYS+SLARYGKSPYLYP+YGLGELPQ F
Sbjct: 179 ENTIDFIGHALALYRDDDYLNQPALPTVERIKLYSESLARYGKSPYLYPLYGLGELPQGF 238

Query: 239 ARLSAIYGGTYMLDKPVDEIVI-ENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQV 297
           ARLSAIYGGTYML+KPVDEIV  ENGKVVGV+SG E+AR KQV CDPSY  D+V+K+ QV
Sbjct: 239 ARLSAIYGGTYMLNKPVDEIVYDENGKVVGVKSGGEVARAKQVICDPSYFPDKVRKVGQV 298

Query: 298 IRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTV 357
           IR IC++ HPIPNT DA S QIIIPQ QV RKSDIY+S  SY H V  KG +IA+VSTTV
Sbjct: 299 IRAICILSHPIPNTNDAGSVQIIIPQNQVGRKSDIYISCCSYAHNVCPKGKYIAIVSTTV 358

Query: 358 ETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDV 417
           ET+NPE E+ PGLDLLG   +KFV +SD YEPTD G+E QIFIS SYDATTHFET C DV
Sbjct: 359 ETENPESELAPGLDLLGPIDEKFVKISDLYEPTDDGSEDQIFISQSYDATTHFETTCNDV 418

Query: 418 VNLFKRGTGEDFDFSKIKLEE 438
           +++FKR TG+  DFSK    E
Sbjct: 419 LDIFKRYTGKALDFSKSPAAE 439

Length = 439
>gnl|CDD|185577 PTZ00363, PTZ00363, rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>gnl|CDD|227377 COG5044, MRS6, RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 441
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 100.0
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 100.0
KOG1439|consensus440 100.0
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 100.0
KOG4405|consensus547 100.0
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.97
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.97
KOG4254|consensus561 99.96
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.96
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.95
PRK07233434 hypothetical protein; Provisional 99.89
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.89
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.88
PRK12416463 protoporphyrinogen oxidase; Provisional 99.88
PRK07208479 hypothetical protein; Provisional 99.88
PLN02576496 protoporphyrinogen oxidase 99.86
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.86
PLN02612567 phytoene desaturase 99.79
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.79
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.78
PLN02487569 zeta-carotene desaturase 99.77
PLN02268435 probable polyamine oxidase 99.68
PRK13977 576 myosin-cross-reactive antigen; Provisional 99.66
PLN02529 738 lysine-specific histone demethylase 1 99.64
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.63
PLN02568 539 polyamine oxidase 99.63
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.63
PLN02676487 polyamine oxidase 99.6
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.59
PLN03000 881 amine oxidase 99.59
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.56
KOG0029|consensus501 99.47
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.44
KOG1276|consensus491 99.42
PRK11728393 hydroxyglutarate oxidase; Provisional 99.41
COG2081408 Predicted flavoproteins [General function predicti 99.41
KOG2820|consensus399 99.39
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.38
COG0579429 Predicted dehydrogenase [General function predicti 99.36
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.35
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.33
PRK08274 466 tricarballylate dehydrogenase; Validated 99.31
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.31
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.3
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.3
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.29
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.28
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.27
KOG0685|consensus498 99.27
PLN02976 1713 amine oxidase 99.27
COG3349485 Uncharacterized conserved protein [Function unknow 99.25
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.23
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.23
PRK10157 428 putative oxidoreductase FixC; Provisional 99.21
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.2
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.19
PRK10015 429 oxidoreductase; Provisional 99.19
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.16
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.15
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.14
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.12
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.11
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.11
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.1
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 99.09
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.08
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.07
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.06
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.05
PRK07121492 hypothetical protein; Validated 99.05
PRK05257494 malate:quinone oxidoreductase; Validated 99.04
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.02
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.99
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.99
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.98
PRK06175433 L-aspartate oxidase; Provisional 98.97
PRK02106 560 choline dehydrogenase; Validated 98.94
PRK06847375 hypothetical protein; Provisional 98.93
PRK07190 487 hypothetical protein; Provisional 98.93
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.93
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.93
PRK06185407 hypothetical protein; Provisional 98.92
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.92
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.92
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.89
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.88
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.88
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.88
PRK09126392 hypothetical protein; Provisional 98.88
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.87
KOG2844|consensus 856 98.87
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.87
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.87
PRK08163396 salicylate hydroxylase; Provisional 98.86
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.85
PRK12839 572 hypothetical protein; Provisional 98.85
PRK08013400 oxidoreductase; Provisional 98.84
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.84
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.84
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.84
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.83
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.83
PRK06184 502 hypothetical protein; Provisional 98.83
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.83
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.82
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.82
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.82
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.81
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.8
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.8
PLN02985514 squalene monooxygenase 98.8
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.79
PRK08401 466 L-aspartate oxidase; Provisional 98.79
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.79
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.79
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.79
PRK07804 541 L-aspartate oxidase; Provisional 98.79
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.78
PRK06834 488 hypothetical protein; Provisional 98.78
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.77
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 98.77
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.77
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.76
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.76
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.74
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.73
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.72
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.71
PLN02697 529 lycopene epsilon cyclase 98.71
PRK08275 554 putative oxidoreductase; Provisional 98.71
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.71
PRK07395 553 L-aspartate oxidase; Provisional 98.7
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.7
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.69
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.69
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.69
PRK08071 510 L-aspartate oxidase; Provisional 98.68
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.67
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.67
PRK07236386 hypothetical protein; Provisional 98.65
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.64
PRK07512 513 L-aspartate oxidase; Provisional 98.62
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.61
PRK08244493 hypothetical protein; Provisional 98.61
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.61
PRK07588391 hypothetical protein; Provisional 98.6
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.58
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.58
KOG1298|consensus509 98.58
COG2303542 BetA Choline dehydrogenase and related flavoprotei 98.58
PLN02815 594 L-aspartate oxidase 98.56
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.55
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.55
PRK05868372 hypothetical protein; Validated 98.52
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.51
PRK09077 536 L-aspartate oxidase; Provisional 98.5
KOG0042|consensus 680 98.49
PRK06475400 salicylate hydroxylase; Provisional 98.46
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.45
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.45
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.45
PRK06116450 glutathione reductase; Validated 98.45
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.45
PRK06996398 hypothetical protein; Provisional 98.44
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.43
PRK06370463 mercuric reductase; Validated 98.42
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.39
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.39
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.39
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.38
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.38
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.37
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.36
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.35
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.34
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.34
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.34
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.33
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.3
PLN02785587 Protein HOTHEAD 98.29
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.28
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.27
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.27
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.26
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.26
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.25
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.25
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.25
KOG2665|consensus453 98.24
PRK07045388 putative monooxygenase; Reviewed 98.24
KOG2404|consensus477 98.24
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.24
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.23
PLN02661357 Putative thiazole synthesis 98.22
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.22
PTZ00052499 thioredoxin reductase; Provisional 98.2
KOG1399|consensus448 98.19
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.19
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.18
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.18
KOG2852|consensus380 98.18
PRK13748561 putative mercuric reductase; Provisional 98.17
PRK14694468 putative mercuric reductase; Provisional 98.15
TIGR02053463 MerA mercuric reductase. This model represents the 98.13
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.13
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.12
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.11
PTZ00058561 glutathione reductase; Provisional 98.09
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.08
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.08
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.08
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.06
COG3573 552 Predicted oxidoreductase [General function predict 98.06
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.05
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.05
KOG2853|consensus509 98.05
PRK12831464 putative oxidoreductase; Provisional 98.05
PLN02463 447 lycopene beta cyclase 98.04
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.04
PRK14727479 putative mercuric reductase; Provisional 98.04
PRK06126 545 hypothetical protein; Provisional 98.03
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.03
PRK11445351 putative oxidoreductase; Provisional 98.02
PTZ00367567 squalene epoxidase; Provisional 98.02
PRK06753373 hypothetical protein; Provisional 98.01
PRK08294 634 phenol 2-monooxygenase; Provisional 98.01
PLN02507499 glutathione reductase 98.01
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.0
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.99
PRK09897 534 hypothetical protein; Provisional 97.98
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.96
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.96
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.95
KOG2614|consensus420 97.95
PRK07538413 hypothetical protein; Provisional 97.95
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.94
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.94
PRK10262321 thioredoxin reductase; Provisional 97.93
PLN02546558 glutathione reductase 97.93
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.93
KOG2415|consensus 621 97.93
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.92
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.91
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.91
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.9
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.9
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.9
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.88
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.85
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.85
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.85
KOG1238|consensus 623 97.85
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.85
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.84
PLN02852491 ferredoxin-NADP+ reductase 97.83
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.82
PRK12814652 putative NADPH-dependent glutamate synthase small 97.78
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.78
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.76
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.72
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.72
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.72
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.72
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.66
PTZ00188506 adrenodoxin reductase; Provisional 97.65
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.63
KOG1335|consensus506 97.6
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.6
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.59
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.58
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.57
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.55
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.53
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.49
KOG0399|consensus2142 97.48
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.46
PRK07846451 mycothione reductase; Reviewed 97.45
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.44
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.43
PRK13984604 putative oxidoreductase; Provisional 97.42
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.37
COG4716 587 Myosin-crossreactive antigen [Function unknown] 97.22
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 97.08
KOG2960|consensus328 97.03
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.02
KOG2311|consensus 679 96.94
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.93
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.75
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 96.72
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.59
PRK13512438 coenzyme A disulfide reductase; Provisional 96.59
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.55
KOG4716|consensus503 96.39
KOG1800|consensus468 96.31
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.29
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.1
KOG0405|consensus478 96.01
KOG3855|consensus481 95.98
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.9
KOG0404|consensus322 95.82
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 95.81
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.74
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 95.57
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 95.52
COG4529474 Uncharacterized protein conserved in bacteria [Fun 95.5
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 95.32
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.27
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.22
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.9
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 94.84
PRK14989 847 nitrite reductase subunit NirD; Provisional 94.78
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.75
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.74
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 94.67
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.61
PRK05976472 dihydrolipoamide dehydrogenase; Validated 94.6
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.48
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.43
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.39
TIGR02053463 MerA mercuric reductase. This model represents the 94.2
PRK06370463 mercuric reductase; Validated 94.11
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 94.07
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 94.04
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 94.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 93.99
PRK07846451 mycothione reductase; Reviewed 93.93
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 93.92
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.9
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.87
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 93.79
PRK13512438 coenzyme A disulfide reductase; Provisional 93.74
PRK06292460 dihydrolipoamide dehydrogenase; Validated 93.72
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 93.7
PRK08229341 2-dehydropantoate 2-reductase; Provisional 93.66
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 93.66
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.63
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.61
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.58
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.55
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.54
PRK06327475 dihydrolipoamide dehydrogenase; Validated 93.41
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 93.35
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 93.33
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.31
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 93.28
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.27
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.22
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 93.22
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 93.2
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 93.13
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 92.99
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 92.95
PRK04148134 hypothetical protein; Provisional 92.94
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 92.85
KOG3923|consensus342 92.84
PRK07845466 flavoprotein disulfide reductase; Reviewed 92.84
PRK12921305 2-dehydropantoate 2-reductase; Provisional 92.69
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 92.66
PRK09564444 coenzyme A disulfide reductase; Reviewed 92.62
PTZ00153659 lipoamide dehydrogenase; Provisional 92.59
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 92.57
PTZ00058561 glutathione reductase; Provisional 92.48
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.36
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 92.35
PRK14989 847 nitrite reductase subunit NirD; Provisional 92.35
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 92.34
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.34
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.29
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 92.27
PRK10262321 thioredoxin reductase; Provisional 92.14
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 92.07
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 92.03
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 91.99
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 91.95
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 91.95
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 91.91
PRK12831464 putative oxidoreductase; Provisional 91.83
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.77
PRK12770352 putative glutamate synthase subunit beta; Provisio 91.56
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.5
PRK13748561 putative mercuric reductase; Provisional 91.48
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 91.43
PLN02546558 glutathione reductase 91.32
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 91.31
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 91.31
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 91.28
PRK06719157 precorrin-2 dehydrogenase; Validated 91.17
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.17
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 91.04
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.03
PRK14727479 putative mercuric reductase; Provisional 90.86
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.8
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 90.64
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 90.61
PTZ00052499 thioredoxin reductase; Provisional 90.53
PLN02353473 probable UDP-glucose 6-dehydrogenase 90.52
KOG2304|consensus298 90.47
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 90.46
PRK15116268 sulfur acceptor protein CsdL; Provisional 90.4
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 90.09
PTZ00082321 L-lactate dehydrogenase; Provisional 90.02
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.83
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 89.71
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.49
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 89.45
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 89.37
PRK07417279 arogenate dehydrogenase; Reviewed 89.33
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 89.33
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.31
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 89.23
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 89.09
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 89.06
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.97
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 88.94
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 88.93
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.83
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 88.76
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 88.74
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.65
KOG2755|consensus334 88.61
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 88.59
PTZ00318424 NADH dehydrogenase-like protein; Provisional 88.5
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.45
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 88.41
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 88.29
PRK06116450 glutathione reductase; Validated 87.98
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 87.97
PRK06223307 malate dehydrogenase; Reviewed 87.95
PRK11730715 fadB multifunctional fatty acid oxidation complex 87.9
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.9
PF03853169 YjeF_N: YjeF-related protein N-terminus; InterPro: 87.82
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 87.69
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 87.65
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.63
KOG3851|consensus446 87.29
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 87.25
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.21
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.1
PRK12549284 shikimate 5-dehydrogenase; Reviewed 87.09
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 86.99
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 86.82
PRK14694468 putative mercuric reductase; Provisional 86.64
PRK08306296 dipicolinate synthase subunit A; Reviewed 86.64
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 86.53
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 86.45
PRK08017256 oxidoreductase; Provisional 86.36
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 86.24
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 86.21
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 86.04
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.03
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 85.96
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 85.95
cd01483143 E1_enzyme_family Superfamily of activating enzymes 85.94
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 85.94
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 85.83
PLN02507499 glutathione reductase 85.82
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 85.71
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.65
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 85.53
PRK06849389 hypothetical protein; Provisional 85.36
PRK12779944 putative bifunctional glutamate synthase subunit b 85.32
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 85.32
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 85.31
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 85.24
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 85.23
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.2
PRK09496453 trkA potassium transporter peripheral membrane com 85.02
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 84.9
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 84.87
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 84.81
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 84.76
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 84.61
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 84.61
PRK12548289 shikimate 5-dehydrogenase; Provisional 84.39
PRK10669558 putative cation:proton antiport protein; Provision 84.38
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 84.36
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 84.26
PRK07502307 cyclohexadienyl dehydrogenase; Validated 84.19
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 84.17
COG0062203 Uncharacterized conserved protein [Function unknow 84.15
PLN02172461 flavin-containing monooxygenase FMO GS-OX 84.14
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 84.13
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 84.07
PLN02695370 GDP-D-mannose-3',5'-epimerase 84.03
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 84.01
KOG1335|consensus506 83.98
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 83.95
PRK08328231 hypothetical protein; Provisional 83.9
PRK05442326 malate dehydrogenase; Provisional 83.8
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 83.77
PLN03050246 pyridoxine (pyridoxamine) 5'-phosphate oxidase; Pr 83.73
PRK11154708 fadJ multifunctional fatty acid oxidation complex 83.64
PTZ00117319 malate dehydrogenase; Provisional 83.62
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 83.59
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 83.56
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 83.47
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information 
Probab=100.00  E-value=2.3e-78  Score=588.32  Aligned_cols=434  Identities=60%  Similarity=1.004  Sum_probs=364.7

Q ss_pred             CCCcccEEEECCChhHHHHHhhhccCCCeEEEEcCCCCCCCcccccCchHHHhhhhCCCC--CCccccCCCCceeeeccc
Q psy2620           1 MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTL--PDEVTFGRGRDWNVDLIP   78 (441)
Q Consensus         1 m~~~~DVvIIGaG~~Gl~aA~~La~~G~~V~vlE~~~~~GG~~~t~~~~~~~~~g~~~d~--p~~~~~g~~~~~~idl~p   78 (441)
                      |+++|||||+|+|+.+++.|++|+++|++|+++|+|++|||.++|++ ++++..++.-..  +.. .++.+++|++||.|
T Consensus         1 m~~~yDviI~GTGl~esila~als~~GkkVLhiD~n~yYGg~~asl~-l~~l~~~~~~~~~~~~~-~~~~sR~ynIDL~P   78 (438)
T PF00996_consen    1 MDEEYDVIILGTGLTESILAAALSRSGKKVLHIDRNDYYGGEWASLN-LDQLYEWFRPKQWTPPE-SLGRSRDYNIDLIP   78 (438)
T ss_dssp             --SBESEEEE--SHHHHHHHHHHHHTT--EEEE-SSSSSCGGG-EE--HHHHHHHHCCTCCHHHH-HHHTGGGC-EESS-
T ss_pred             CCccceEEEECCCcHHHHHHHHHHhcCCEEEecCCCCCcCCchhccc-HHHHHHHhhcccccccc-ccccccceeEecch
Confidence            89999999999999999999999999999999999999999999999 999988886542  111 46778999999999


Q ss_pred             ceeecCchHHHHHHHhCCcceeEEEEecceEEEeCCeEEeCCCChHHHhhhccCChHHHHHHHHHHHHHHhhcccCcccc
Q psy2620          79 KFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTW  158 (441)
Q Consensus        79 ~~l~~~~~~~~~l~~~~~~~~l~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~k~~l~~~~~~~~~~~~~~~~~~  158 (441)
                      +++++.|+++++|.++++.+|+||+.+++.|++.+|++.++|+++.|+|+++++++++||.+|||+.++..+.+.++..|
T Consensus        79 Kll~a~g~LV~lLi~S~V~rYLEFk~V~~~~v~~~~~l~kVP~sr~dvf~s~~lsl~eKR~lmkFl~~v~~~~~~~~~~~  158 (438)
T PF00996_consen   79 KLLYARGPLVKLLISSGVTRYLEFKAVDGSYVYKNGKLHKVPCSREDVFKSKLLSLFEKRRLMKFLKFVANYEEDDPSTH  158 (438)
T ss_dssp             -BEETTSHHHHHHHHCTGGGGSEEEEESEEEEEETTEEEE--SSHHHHHC-TTS-HHHHHHHHHHHHHHHHGCTTBGGGS
T ss_pred             HhhhccCHHHHHHHhCCcccceEEEEcceeEEEeCCEEeeCCCCHHHhhcCCCccHHHHHHHHHHHHHHhhcccCCcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988778788


Q ss_pred             cccCCCCCcHHHHHHHhCCCcchhHHHHHHhhcccCccccchhHHHHHHHHHHHHHHhhhhCCCCeeeecCCcchHHHHH
Q psy2620         159 KDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSF  238 (441)
Q Consensus       159 ~~~~~~~~s~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~s~~~~G~~~~~~~~gG~~~l~~~l  238 (441)
                      +..++...++.++++++++++.+++++.+++++...+.+...|+..++.++..|+.|+++||++||+||.||.|+|+|+|
T Consensus       159 ~~~~~~~~~~~e~~~~f~L~~~~~~~i~haiaL~~~~~~~~~p~~~~l~ri~~yl~SlgryG~sPfLyP~YG~GELpQ~F  238 (438)
T PF00996_consen  159 KGLDPEKKTFQELLKKFGLSENLIDFIGHAIALSLDDSYLTEPAREGLERIKLYLSSLGRYGKSPFLYPLYGLGELPQAF  238 (438)
T ss_dssp             TTG-TTTSBHHHHHHHTTS-HHHHHHHHHHTS-SSSSGGGGSBSHHHHHHHHHHHHHHCCCSSSSEEEETT-TTHHHHHH
T ss_pred             hccccccccHHHHHHhcCCCHHHHHHHHHhhhhccCcccccccHHHHHHHHHHHHHHHhccCCCCEEEEccCCccHHHHH
Confidence            87777789999999999999999999999999999888888899999999999999999999999999999999999999


Q ss_pred             HHHHHHcCcEEEcccceeEEEE-eCCEEEEEEeCCeEEEcCEEEECCCCCccccccccceEEEEEEecCCCCCCCCCCee
Q psy2620         239 ARLSAIYGGTYMLDKPVDEIVI-ENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSC  317 (441)
Q Consensus       239 ~~~~~~~G~~i~~~~~V~~i~~-~~~~~~~v~~~g~~~~a~~vI~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (441)
                      ||.++.+||.++||++|.+|.. ++|++.+|+.+|++++|++||.+|+++|++++..+++.|+++++++|+..+....+.
T Consensus       239 cRl~AV~GG~Y~L~~~i~~i~~~~~g~~~gV~s~ge~v~~k~vI~dpsy~p~~v~~~~~V~RaI~Il~~pi~~t~~~~s~  318 (438)
T PF00996_consen  239 CRLSAVYGGTYMLNRPIDEIVVDEDGKVIGVKSEGEVVKAKKVIGDPSYLPEKVKKTGQVSRAICILDHPIPNTEDASSV  318 (438)
T ss_dssp             HHHHHHTT-EEESS--EEEEEEETTTEEEEEEETTEEEEESEEEEEGGGBGCGEEEEEEEEEEEEEESS-STTSTT-SSE
T ss_pred             HHHhhhcCcEEEeCCccceeeeecCCeEEEEecCCEEEEcCEEEECCccCcccccccceEEEEEEEEcCCCCCCCCCceE
Confidence            9999999999999999999988 578999999999999999999999999988877889999999999999887666778


Q ss_pred             EEEecCCCCCCCCcEEEEEecCCccccCCCeEEEEEEeeccCCChhhchHHHHhhcccccceeeeeeeccccCCCCCCCc
Q psy2620         318 QIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQ  397 (441)
Q Consensus       318 ~~~~p~~~~~~~~~i~~~~~~~~~~~~p~g~~~~~i~t~~~~~d~~~~l~~~l~~l~p~~~~~~~~~~~~~p~~~g~~~~  397 (441)
                      ++++|+.+.++.++||+.+++++++.||+|+|+++++|..++.+|.++|+++|+.|.|..+.|+++...|+|.++|..+|
T Consensus       319 ~IiiP~~~~~~~~dIyv~~~ss~~~~CP~G~yi~~~St~~~t~~p~~eL~~~l~lL~~i~e~f~~v~~~~~p~~~~~~~~  398 (438)
T PF00996_consen  319 QIIIPQSQVGRKSDIYVLQLSSSTGVCPKGQYIAYVSTTVETSNPEEELEPALELLGPIEEKFVSVSDLYEPTDDGTDDN  398 (438)
T ss_dssp             EEEE-GGGCTSSS-EEEEEEEGGGTSS-TT-EEEEEEEEE-SS-HHHHTHHHHHTT-SESEEEEEEEEEEEESSSSTTTS
T ss_pred             EEecCCcccCCCCCeEEEEECCCccccCCCcEEEEEEeccCCCCcHHHHHHHHHhhccHHHHhcchhhcccccCCCccCc
Confidence            88899988888889999999999999999999999999888889999999999999999999999999999999999999


Q ss_pred             eeeccCCCCCCChHhHHHHHHHHHhhccCCccccccchh
Q psy2620         398 IFISTSYDATTHFETVCTDVVNLFKRGTGEDFDFSKIKL  436 (441)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~  436 (441)
                      ||+++++|++.|||..+++|+++++|++|++|||.|.+.
T Consensus       399 i~is~~~dat~hfe~~~~dv~~~~~~~~g~~~~~~~~~~  437 (438)
T PF00996_consen  399 IFISKSYDATSHFETTCEDVLDIYKRITGKDLDLSKRKH  437 (438)
T ss_dssp             EEE-----S-SBSHHHHHHHHHHHHHHHSS---------
T ss_pred             eEEcCCCCcccchHHHHHHHHHHHHHhhCCccccccCCC
Confidence            999999999999999999999999999999999999764

This post-translational modification is catalysed by Rab geranylgeranyl transferase (Rab-GGTase), a multi-subunit enzyme that contains a catalytic heterodimer and an accessory component, termed Rab escort protein (REP)-1 []. REP-1 presents newly- synthesised Rab proteins to the catalytic component, and forms a stable complex with the prenylated proteins following the transfer reaction. The mechanism of REP-1-mediated membrane association of Rab5 is similar to that mediated by Rab GDP dissociation inhibitor (GDI). REP-1 and Rab GDI also share other functional properties, including the ability to inhibit the release of GDP and to remove Rab proteins from membranes. The crystal structure of the bovine alpha-isoform of Rab GDI has been determined to a resolution of 1.81A []. The protein is composed of two main structural units: a large complex multi-sheet domain I, and a smaller alpha-helical domain II. The structural organisation of domain I is closely related to FAD-containing monooxygenases and oxidases []. Conserved regions common to GDI and the choroideraemia gene product, which delivers Rab to catalytic subunits of Rab geranylgeranyltransferase II, are clustered on one face of the domain []. The two most conserved regions form a compact structure at the apex of the molecule; site-directed mutagenesis has shown these regions to play a critical role in the binding of Rab proteins [].; PDB: 1VG9_C 1VG0_A 1LTX_R 3P1W_A 3CPH_H 3CPJ_G 3CPI_H 1UKV_G 2BCG_G 1GND_A ....
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF03853 YjeF_N: YjeF-related protein N-terminus; InterPro: IPR004443 The YjeF N-terminal domains occur either as single proteins or fusions with other domains and are commonly associated with enzymes Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>COG0062 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN03050 pyridoxine (pyridoxamine) 5'-phosphate oxidase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query441
1lv0_A449 Crystal Structure Of The Rab Effector Guanine Nucle 1e-178
1gnd_A447 Guanine Nucleotide Dissociation Inhibitor, Alpha-Is 1e-178
1d5t_A433 Guanine Nucleotide Dissociation Inhibitor, Alpha-Is 1e-177
3cph_G451 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 1e-133
1ukv_G453 Structure Of Rabgdp-Dissociation Inhibitor In Compl 1e-133
3p1w_A475 Crystal Structure Of Rab Gdi From Plasmodium Falcip 1e-120
1ltx_R650 Structure Of Rab Escort Protein-1 In Complex With R 9e-29
1vg0_A650 The Crystal Structures Of The Rep-1 Protein In Comp 9e-29
>pdb|1LV0|A Chain A, Crystal Structure Of The Rab Effector Guanine Nucleotide Dissociation Inhibitor (Gdi) In Complex With A Geranylgeranyl (Gg) Peptide Length = 449 Back     alignment and structure 
Iteration: 1

 Score =  622 bits (1603), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 292/438 (66%), Positives = 355/438 (81%)
Query: 1   MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTL 60
           MDEEYD IVLGTGL ECILSG++SV+GKKVLH+DRN YYGGES+SITPLEEL+ +F    
Sbjct: 3   MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE 62
Query: 61  PDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVP 120
               T GRGRDWNVDLIPKFLMANG LVK+L++T VTRYL+FK VEGS+V+KGGKI KVP
Sbjct: 63  GPPETMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP 122
Query: 121 VDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPN 180
             + EALAS+LMG+FEKRRFR FLV++  F E DPKT++ ++PQ+ +   +Y KF L  +
Sbjct: 123 STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQD 182
Query: 181 TKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFAR 240
             DFTGHALALYR D+Y++   + TI RIKLYS+SLARYGKSPYLYP+YGLGELPQ FAR
Sbjct: 183 VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR 242
Query: 241 LSAIYGGTYMLDKPVDEIVIENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKLNQVIRC 300
           LSAIYGGTYML+KPVD+I++ENGKVVGV+S  E+ARCKQ+ CDPSYV DRV+K  QVIR 
Sbjct: 243 LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAGQVIRI 302
Query: 301 ICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETD 360
           IC++ HPI NT DA SCQIIIPQ QVNRKSDIYV ++SY H V+A+G +IA+ STTVET 
Sbjct: 303 ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETT 362
Query: 361 NPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETVCTDVVNL 420
           +PE E++P L+LL    +KFV +SD YEP D G+ESQ+F S SYDATTHFET C D+ ++
Sbjct: 363 DPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDI 422
Query: 421 FKRGTGEDFDFSKIKLEE 438
           +KR  G  FDF  +K ++
Sbjct: 423 YKRMAGSAFDFENMKRKQ 440
>pdb|1GND|A Chain A, Guanine Nucleotide Dissociation Inhibitor, Alpha-Isoform Length = 447 Back     alignment and structure
>pdb|1D5T|A Chain A, Guanine Nucleotide Dissociation Inhibitor, Alpha-Isoform Length = 433 Back     alignment and structure
>pdb|3CPH|G Chain G, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 451 Back     alignment and structure
>pdb|1UKV|G Chain G, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 453 Back     alignment and structure
>pdb|3P1W|A Chain A, Crystal Structure Of Rab Gdi From Plasmodium Falciparum, Pfl2060c Length = 475 Back     alignment and structure
>pdb|1LTX|R Chain R, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 650 Back     alignment and structure
>pdb|1VG0|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 650 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query441
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 1e-173
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 1e-172
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 1e-162
1vg0_A650 RAB proteins geranylgeranyltransferase component A 1e-124
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 6e-26
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 2e-10
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 Back     alignment and structure
 Score =  492 bits (1268), Expect = e-173
 Identities = 231/446 (51%), Positives = 318/446 (71%), Gaps = 8/446 (1%)

Query: 1   MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFG--- 57
           +D +YD IVLGTG+ ECILSG+LSV GKKVLHID+  +YGGE+AS+T L +L+ KF    
Sbjct: 8   IDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVT-LSQLYEKFKQNP 66

Query: 58  -STLPDEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKI 116
            S    E  FG+ RDWNVDLIPKFLMANG L  +LIHT VTRY++FK V GSYVFK GKI
Sbjct: 67  ISKEERESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKI 126

Query: 117 SKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFG 176
            KVP ++ EA++S LMG+FEKRR + FL +I  + E D  T + ++    T  ++Y KFG
Sbjct: 127 YKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVYYKFG 186

Query: 177 LDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQ 236
           L  +TK+F GHA+AL+ +D+Y+   A  +  RI LY  S+ARYGKSPYLYPMYGLGELPQ
Sbjct: 187 LGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLGELPQ 246

Query: 237 SFARLSAIYGGTYMLDKPVDEIVI--ENGKVVGVRSGTEIARCKQVYCDPSYVQDRVKKL 294
            FARLSAIYGGTYMLD P+DE++   + GK  GV++     +   V  DP+Y  ++ K  
Sbjct: 247 GFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIADPTYFPEKCKST 306

Query: 295 -NQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMV 353
             +VIR IC+++HP+PNT +A S QIIIPQ Q+ RKSDIYV++VS  H V +KG ++A++
Sbjct: 307 GQRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHYLAII 366

Query: 354 STTVETDNPELEIKPGLDLLGSYKKKFVTVSDYYEPTDLGTESQIFISTSYDATTHFETV 413
           ST +ETD P +E++P   LLG  ++KF+ +++ +EP + G++  I++S SYDA++HFE++
Sbjct: 367 STIIETDKPHIELEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYLSRSYDASSHFESM 426

Query: 414 CTDVVNLFKRGTGEDFDFSKIKLEEE 439
             DV +++ R TG      + + +E+
Sbjct: 427 TDDVKDIYFRVTGHPLVLKQRQEQEK 452
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Length = 650 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Length = 650 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query441
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 100.0
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 100.0
1vg0_A650 RAB proteins geranylgeranyltransferase component A 100.0
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 100.0
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 100.0
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.93
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.93
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.87
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.86
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.84
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.83
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.83
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.82
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.81
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.81
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.8
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.73
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.73
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.71
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.67
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.65
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.64
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.61
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.57
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.54
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.53
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.51
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.48
3dme_A369 Conserved exported protein; structural genomics, P 99.47
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.45
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.4
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.35
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.34
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.31
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.3
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.28
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.28
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.27
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 99.25
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.24
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.24
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.22
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 99.22
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.21
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.2
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.2
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.19
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.17
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.17
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.17
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.16
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.14
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.13
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.13
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 99.12
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.11
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.1
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.09
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.08
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 99.05
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.02
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.0
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.98
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.97
3atr_A 453 Conserved archaeal protein; saturating double bond 98.97
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.97
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.94
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.89
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.88
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.88
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.86
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.86
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.84
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.83
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.82
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.82
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.77
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.77
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.76
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.74
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.73
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.71
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.7
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.69
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.68
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.66
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.65
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.65
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 98.64
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.63
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.63
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.63
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.63
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.62
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.61
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.6
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.58
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.58
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.54
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.51
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.5
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.49
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.48
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.46
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.46
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.45
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.43
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.43
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.4
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.38
4dna_A463 Probable glutathione reductase; structural genomic 98.36
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.36
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.36
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.35
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.35
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.34
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.33
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.33
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.33
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.33
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.32
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.31
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.3
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.3
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.29
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.29
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.28
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.28
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.27
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.27
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.26
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.25
2cul_A232 Glucose-inhibited division protein A-related PROT 98.24
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.24
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.24
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.23
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.22
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.22
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.21
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.2
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.2
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.2
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.19
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.19
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.19
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.17
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.16
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.16
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.16
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.15
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.15
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.14
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.13
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.13
2bry_A497 NEDD9 interacting protein with calponin homology a 98.13
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.13
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.12
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.12
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.12
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.12
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.09
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.09
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.09
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.07
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.07
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.06
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.06
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.06
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.05
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.03
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.03
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.02
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.01
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.01
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.01
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.0
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.99
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.99
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.98
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.98
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.97
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.97
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.93
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.92
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.91
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.89
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.89
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.89
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.84
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.81
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.79
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.79
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.77
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.76
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.69
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.68
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.67
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.66
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.62
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.6
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.56
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.55
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 97.55
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.51
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.49
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.18
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.13
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.04
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.02
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 96.99
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.93
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.78
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.69
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.69
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.58
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.56
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.47
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.46
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.4
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.21
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.19
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.18
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.12
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 95.08
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.08
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 95.07
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 95.04
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 94.98
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.74
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.71
2cul_A232 Glucose-inhibited division protein A-related PROT 94.69
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.61
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.47
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 94.39
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 94.33
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.21
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 94.17
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.12
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.1
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 94.06
1ojt_A482 Surface protein; redox-active center, glycolysis, 94.06
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.05
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 94.04
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 94.03
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 93.99
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 93.98
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 93.86
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 93.84
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 93.69
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.67
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 93.65
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 93.63
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 93.62
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.59
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 93.57
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.57
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 93.54
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.49
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 93.49
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 93.48
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 93.47
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 93.35
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.33
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.33
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 93.32
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.31
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 93.28
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 93.21
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 93.2
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 93.15
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 93.08
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.07
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 93.07
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 93.07
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 93.03
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 93.03
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 93.03
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 93.0
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.96
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 92.93
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.88
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.87
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.87
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.84
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.8
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.78
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 92.76
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 92.69
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.64
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.63
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 92.6
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 92.58
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.58
2ywl_A180 Thioredoxin reductase related protein; uncharacter 92.57
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.55
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 92.54
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.53
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 92.52
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 92.48
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 92.43
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 92.36
1fec_A490 Trypanothione reductase; redox-active center, oxid 92.34
4dna_A463 Probable glutathione reductase; structural genomic 92.33
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 92.32
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 92.28
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.27
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 92.2
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.17
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 92.15
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 92.12
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 92.1
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 92.04
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 92.02
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 91.99
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 91.94
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.94
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 91.87
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 91.85
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 91.8
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 91.78
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 91.72
3tl2_A315 Malate dehydrogenase; center for structural genomi 91.7
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.68
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 91.51
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 91.51
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 91.46
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 91.44
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.41
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 91.41
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 91.39
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 91.36
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 91.16
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 91.15
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 91.12
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 91.09
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 91.06
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.06
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 91.01
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 91.01
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 90.94
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 90.92
3r9u_A315 Thioredoxin reductase; structural genomics, center 90.87
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 90.86
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 90.85
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 90.78
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 90.78
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.75
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 90.71
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 90.71
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.7
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 90.7
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 90.67
3l6d_A306 Putative oxidoreductase; structural genomics, prot 90.66
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 90.64
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.61
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 90.55
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.54
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.53
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 90.52
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 90.51
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 90.45
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 90.4
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 90.32
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 90.31
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 90.11
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 90.01
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 89.97
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 89.96
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.89
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 89.86
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 89.82
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 89.76
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 89.73
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 89.62
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 89.57
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 89.56
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 89.49
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 89.41
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 89.41
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 89.33
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 89.32
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 89.31
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.29
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 89.04
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.0
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.0
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 88.95
4ezb_A317 Uncharacterized conserved protein; structural geno 88.95
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 88.94
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 88.93
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 88.84
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 88.78
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 88.77
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 88.73
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 88.56
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 88.46
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 88.45
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 88.42
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 88.34
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 88.32
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 88.19
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 88.17
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 88.13
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 88.12
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 87.91
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 87.91
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 87.9
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 87.87
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 87.86
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 87.8
1vpd_A299 Tartronate semialdehyde reductase; structural geno 87.78
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 87.76
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 87.73
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 87.67
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 87.6
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 87.59
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 87.51
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 87.44
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 87.42
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 87.39
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 87.35
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 87.33
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 87.3
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 87.26
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 87.26
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 87.15
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 87.09
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 87.08
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 87.03
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 87.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 86.98
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 86.94
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 86.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 86.87
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 86.77
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 86.66
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 86.65
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 86.65
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 86.64
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 86.63
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 86.58
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 86.37
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 86.31
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 86.27
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 86.26
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 85.94
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 85.83
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 85.71
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 85.61
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 85.41
2rir_A300 Dipicolinate synthase, A chain; structural genomic 85.36
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 85.27
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 85.26
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 85.09
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 84.99
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 84.95
1lnq_A336 MTHK channels, potassium channel related protein; 84.86
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 84.83
3d3k_A259 Enhancer of mRNA-decapping protein 3; HEDC3, phosp 84.81
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 84.77
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 84.75
4gx0_A565 TRKA domain protein; membrane protein, ION channel 84.74
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 84.72
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 84.72
1yb4_A295 Tartronic semialdehyde reductase; structural genom 84.65
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 84.6
1jzt_A246 Hypothetical 27.5 kDa protein in SPX19-GCR2 inter 84.6
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 84.56
3d3j_A306 Enhancer of mRNA-decapping protein 3; HEDC3, phosp 84.51
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 84.48
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 84.43
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 84.37
2o8n_A265 APOA-I binding protein; rossmann fold, protein bin 84.33
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 84.31
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 84.28
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 84.19
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 84.16
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 84.01
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 83.97
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 83.85
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 83.83
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 83.72
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 83.7
2bry_A 497 NEDD9 interacting protein with calponin homology a 83.59
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 83.54
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 83.52
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 83.28
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 83.25
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 83.19
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 83.14
2wm3_A299 NMRA-like family domain containing protein 1; unkn 83.05
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 82.99
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 82.96
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 82.94
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 82.94
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 82.9
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 82.76
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 82.72
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
Probab=100.00  E-value=4e-68  Score=529.46  Aligned_cols=438  Identities=50%  Similarity=0.903  Sum_probs=388.8

Q ss_pred             CCCcccEEEECCChhHHHHHhhhccCCCeEEEEcCCCCCCCcccccCchHHHhhhhCCCC-CCccccCCCCceeeecccc
Q psy2620           1 MDEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTL-PDEVTFGRGRDWNVDLIPK   79 (441)
Q Consensus         1 m~~~~DVvIIGaG~~Gl~aA~~La~~G~~V~vlE~~~~~GG~~~t~~~~~~~~~g~~~d~-p~~~~~g~~~~~~idl~p~   79 (441)
                      |++.|||||||+|++|+++|+.|+++|++|+|+|+++++||.+++++ ..+++.+|.... |.. .+|..++|++|++|+
T Consensus        17 ~~~~~dv~iiG~G~~g~~~a~~l~~~g~~v~~~e~~~~~Gg~~~s~~-~~~l~~~~~~g~~~~~-~~g~~R~y~iDL~P~   94 (475)
T 3p1w_A           17 QGEHYDVIILGTGLKECILSGLLSHYGKKILVLDRNPYYGGETASLN-LTNLYNTFKPKENIPS-KYGENRHWNVDLIPK   94 (475)
T ss_dssp             CCCEEEEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEEC-HHHHHHHHCTTSCCCG-GGCCGGGCCEESSCC
T ss_pred             ccccCCEEEECCCHHHHHHHHHHHHCCCcEEEEeccCCCCCCccccc-hhhhhhhcccCCCccc-ccccccceEEeecCe
Confidence            66789999999999999999999999999999999999999999999 888777775332 222 467788999999999


Q ss_pred             eeecCchHHHHHHHhCCcceeEEEEecceEEEe---------CCeEEeCCCChHHHhhhccCChHHHHHHHHHHHHHHhh
Q psy2620          80 FLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFK---------GGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEF  150 (441)
Q Consensus        80 ~l~~~~~~~~~l~~~~~~~~l~~~~~~~~~~~~---------~g~~~~~p~~~~~~~~~~~~~~~~k~~l~~~~~~~~~~  150 (441)
                      ++++.++++++|.++++.+|++|+.+++.|.+.         +|+++++|.+..+.|.+.++++.+|+.+++|+..+.++
T Consensus        95 ~l~~~g~L~~lL~~~gv~~ylef~~~~~~y~~~~~~~~~~~~~g~~~~VPss~~e~~~~~lLs~~eK~~l~kFL~~l~~~  174 (475)
T 3p1w_A           95 FILVGGNLVKILKKTRVTNYLEWLVVEGSYVYQHQKKGFLTSEKFIHKVPATDMEALVSPLLSLMEKNRCKNFYQYVSEW  174 (475)
T ss_dssp             BEETTSHHHHHHHHTTCGGGSCEEECSEEEEEEEECCCSSSCCEEEEECCCSHHHHHTCTTSCHHHHHHHHHHHHHHHHC
T ss_pred             EeecCcHHHHHHHHCCchheeEEEecCcceEEecCccccccCCCceEeCCCCHHHHhhccCCCHHHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999998775         67899999998899999999999999999999999888


Q ss_pred             cccCcccccccCCCCCcHHHHHHHhCCCcchhHHHHHHhhcccCccccchhHHHHHHHHHHHHHHhhhhCCCCeeeecCC
Q psy2620         151 SEADPKTWKDINPQSATTAQLYDKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYG  230 (441)
Q Consensus       151 ~~~~~~~~~~~~~~~~s~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~s~~~~G~~~~~~~~gG  230 (441)
                      .+..+..|+.++....++.+|++++++++.+++++.+++++...+.+...|+...+.++..|+.++++||.+++.||+||
T Consensus       175 ~~~~~~~~~~~~l~~~s~~e~l~~~gls~~l~~fl~~alaL~~~~~~~~~~a~~~l~ri~~y~~Sl~~yg~s~~~yp~gG  254 (475)
T 3p1w_A          175 DANKRNTWDNLDPYKLTMLEIYKHFNLCQLTIDFLGHAVALYLNDDYLKQPAYLTLERIKLYMQSISAFGKSPFIYPLYG  254 (475)
T ss_dssp             CTTCGGGSTTCCTTTSBHHHHHHHTTCCHHHHHHHHHHTSCCSSSGGGGSBHHHHHHHHHHHHHHHHHHSSCSEEEETTC
T ss_pred             hhccchhhhcccccCCCHHHHHHHcCCCHHHHHHHHHHHHhhcCCCcccCCHHHHHHHHHHHHHHHhhcCCCceEEECCC
Confidence            76656566655556789999999999999999999888888776666666888899999999999999998899999999


Q ss_pred             cchHHHHHHHHHHHcCcEEEcccceeEEEE-eCCEEEEEEe-CCeEEEcCEEEECCCCC---ccccccccceEEEEEEec
Q psy2620         231 LGELPQSFARLSAIYGGTYMLDKPVDEIVI-ENGKVVGVRS-GTEIARCKQVYCDPSYV---QDRVKKLNQVIRCICLMD  305 (441)
Q Consensus       231 ~~~l~~~l~~~~~~~G~~i~~~~~V~~i~~-~~~~~~~v~~-~g~~~~a~~vI~~~~~~---~~~~~~~~~~~~~~~~~~  305 (441)
                      +++|+++|++.++++|++|+++++|++|.. +++++++|++ +|++++||+||++++++   |..++..+.+.|.+++++
T Consensus       255 ~~~L~~aL~r~~~~~Gg~i~l~t~V~~I~~d~~g~v~gV~~~~G~~i~Ad~VI~a~~~~~~~p~~~~~~~~v~R~i~I~~  334 (475)
T 3p1w_A          255 LGGIPEGFSRMCAINGGTFMLNKNVVDFVFDDDNKVCGIKSSDGEIAYCDKVICDPSYVMHLKNKIKKIGQVIRCICILS  334 (475)
T ss_dssp             TTHHHHHHHHHHHHC--CEESSCCEEEEEECTTSCEEEEEETTSCEEEEEEEEECGGGCTTSTTSEEEEEEEEEEEEEES
T ss_pred             HHHHHHHHHHHHHHcCCEEEeCCeEEEEEEecCCeEEEEEECCCcEEECCEEEECCCccccCcccccccceEEEEEEEEe
Confidence            999999999999999999999999999998 7889999998 56889999999999998   877666788999999999


Q ss_pred             CCCCCCCCCCeeEEEecCCCCCCCCcEEEEEecCCccccCCCeEEEEEEeeccCCChhhchHHHHhhcccccceeeeeee
Q psy2620         306 HPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVSYTHQVSAKGWFIAMVSTTVETDNPELEIKPGLDLLGSYKKKFVTVSD  385 (441)
Q Consensus       306 ~~~~~~~~~~~~~~~~p~~~~~~~~~i~~~~~~~~~~~~p~g~~~~~i~t~~~~~d~~~~l~~~l~~l~p~~~~~~~~~~  385 (441)
                      +|+..+....+.++++|+.+.++.++||+.+++.+++.||+|+++++++|..++.||+++|+++++.|.|..+.|+++..
T Consensus       335 ~pi~~~~~~~~~~i~~P~~~~~~~~~iy~~~~s~~~~~cp~G~~i~~~st~~e~~~~~~~l~~~l~~l~~~~~~~~~~~~  414 (475)
T 3p1w_A          335 NPIPETNQTNSCQIIIPQNQLNRKSDIYINLVSFQHGVTLKGKYIAIVSATVETNNPIKEIEKPLELLGTIEEKFVKISD  414 (475)
T ss_dssp             SCCTTSTTCSSEEEEECGGGGTSSSCEEEEEEEGGGTSSCTTCEEEEEEEECCSSCHHHHTHHHHHTTCSEEEEEEEEEE
T ss_pred             ccCcccCCCceEEEEeCCcccCCCCCEEEEEECCCcCcCCCCcEEEEEEeecCCCCHHHHHHHHHHHhcchhheeccchh
Confidence            99877666678899999988888899999999999999999999999999888889999999999999999999999999


Q ss_pred             ccccCCCCCCCceeeccCCCCCCChHhHHHHHHHHHhhccCCccccccchhhhhc
Q psy2620         386 YYEPTDLGTESQIFISTSYDATTHFETVCTDVVNLFKRGTGEDFDFSKIKLEEEA  440 (441)
Q Consensus       386 ~~~p~~~g~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~  440 (441)
                      .|+|.++|.++|||+++++|+++|||..+++|+++|++++|+++||.+....++.
T Consensus       415 ~~~~~~~~~~~~~~~~~~~d~~~~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~  469 (475)
T 3p1w_A          415 LYVSTSKKPADNIFVTSSYDATSHFETATNDLLQIWENLWGQKLNFDDLNTNADG  469 (475)
T ss_dssp             EEEESCSSCTTCEEECCCCCSCSBSHHHHHHHHHHHHHHHSSCCCC---------
T ss_pred             eeeecccCCCCCEEEeCCCCCccchHHHHHHHHHHHHHHhCCcceecCCCccccc
Confidence            9999999999999999999999999999999999999999999999988776653
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3d3k_A Enhancer of mRNA-decapping protein 3; HEDC3, phosphoprotein, protein binding; 2.20A {Homo sapiens} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1jzt_A Hypothetical 27.5 kDa protein in SPX19-GCR2 inter region; yeast hypothetical protein, structural genomics, selenomethi PSI; 1.94A {Saccharomyces cerevisiae} SCOP: c.104.1.1 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3d3j_A Enhancer of mRNA-decapping protein 3; HEDC3, phosphoprotein, protein binding; 2.80A {Homo sapiens} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2o8n_A APOA-I binding protein; rossmann fold, protein binding; 2.00A {Mus musculus} PDB: 2dg2_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 441
d1vg0a1491 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 { 1e-110
d1vg0a1491 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 { 2e-19
d1d5ta297 d.16.1.6 (A:292-388) Guanine nucleotide dissociati 2e-55
d2bcgg398 d.16.1.6 (G:302-399) Guanine nucleotide dissociati 3e-55
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 1e-54
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-46
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 3e-12
d1vg0a2113 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Ra 6e-30
d2bcgg247 c.3.1.3 (G:400-446) Guanine nucleotide dissociatio 1e-18
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 6e-05
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 5e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 8e-04
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 0.003
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Rab escort protein 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  330 bits (848), Expect = e-110
 Identities = 74/280 (26%), Positives = 122/280 (43%), Gaps = 20/280 (7%)

Query: 62  DEVTFGRGRDWNVDLIPKFLMANGSLVKLLIHTGVTRYLEFKSVEGSYVFKGGKISKVPV 121
                  GR +N+DL+ K L + G L+ LLI + V+RY EFK++     F+ G + +VP 
Sbjct: 212 YSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSNVSRYAEFKNITRILAFREGTVEQVPC 271

Query: 122 DQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLYDKFGLDPNT 181
            + +   S  + + EKR    FL +  E+ E  P  ++       T ++      L PN 
Sbjct: 272 SRADVFNSKQLTMVEKRMLMKFLTFCVEYEE-HPDEYRAYEGT--TFSEYLKTQKLTPNL 328

Query: 182 KDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARL 241
           + F  H++A+  +        +  ++  K +   L RYG +P+L+P+YG GELPQ F R+
Sbjct: 329 QYFVLHSIAMTSETTS---CTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRM 385

Query: 242 SAIYGGTYMLDKPVDEIVI--ENGKVVGVR-SGTEIARCKQVYCDPSYVQDRVKKLNQVI 298
            A++GG Y L   V  +V+  E+ K   V     +    K    + SY+ +        +
Sbjct: 386 CAVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTC---SRV 442

Query: 299 RCICLMDHPIPNTKDALSCQIIIPQKQVNRKSDIYVSLVS 338
              C  D P        S   +         +D  V    
Sbjct: 443 SRDCYNDLP--------SNVYVCSGPDSGLGNDNAVKQAE 474
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491 Back     information, alignment and structure
>d1d5ta2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 97 Back     information, alignment and structure
>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 98 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1vg0a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 113 Back     information, alignment and structure
>d2bcgg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query441
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 100.0
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 100.0
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.97
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.81
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.76
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.72
d1d5ta297 Guanine nucleotide dissociation inhibitor, GDI {Co 99.68
d2bcgg398 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.68
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.62
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.61
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.57
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.55
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.53
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.44
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.37
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.34
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.29
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.29
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.26
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.18
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.15
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.09
d1vg0a2113 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 99.06
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.05
d2bcgg247 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.04
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.97
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.95
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.87
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.83
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.81
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.79
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.78
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.78
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.77
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.77
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.76
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.76
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.75
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.71
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.69
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.61
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.56
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.56
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.52
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.52
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.51
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.49
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.47
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.47
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.46
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.46
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.45
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.45
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.44
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.43
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.42
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.41
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.4
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.38
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.38
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.37
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.35
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.35
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.33
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.32
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.23
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.17
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.82
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.73
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.71
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.62
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.62
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.61
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.61
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.6
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.58
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.56
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.43
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.42
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.41
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.22
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.2
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.08
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.06
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.05
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.05
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.01
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.95
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.9
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.74
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.69
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.68
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.6
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.6
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.49
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.48
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.46
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.45
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.43
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.4
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.36
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.34
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.26
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.12
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.11
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.1
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.99
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.82
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.63
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.57
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.57
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.55
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 95.49
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.36
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.34
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.2
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.78
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.59
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.55
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.36
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.35
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.11
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.03
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.97
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.76
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.65
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.64
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.61
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.41
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.34
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.13
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.92
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.89
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.84
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.72
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.68
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.45
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.42
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.36
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.29
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.28
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 92.16
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 92.0
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 91.97
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.95
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.89
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.87
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.37
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.3
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.27
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.21
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.87
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.54
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.44
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.42
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.35
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 90.28
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.85
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.82
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 89.75
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.56
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 89.37
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 89.13
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.11
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 88.75
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.67
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 88.51
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 88.21
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 88.03
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.81
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 87.78
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 87.69
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.52
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 87.13
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 86.65
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 85.85
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 85.28
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 85.17
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 85.02
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 84.93
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.84
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 84.84
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.76
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.68
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 84.58
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 84.58
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 84.12
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.9
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 83.84
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.62
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 83.43
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 83.14
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.09
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 82.75
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 82.74
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 82.7
d2ax3a2211 Hypothetical protein TM0922, N-terminal domain {Th 81.82
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 81.18
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 81.16
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 81.13
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 81.09
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 81.03
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.88
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 80.48
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Rab escort protein 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.2e-48  Score=380.03  Aligned_cols=314  Identities=32%  Similarity=0.589  Sum_probs=263.5

Q ss_pred             CCcccEEEECCChhHHHHHhhhccCCCeEEEEcCCCCCCCcccccCchHHHhhhhCCCC---------------------
Q psy2620           2 DEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFSKFGSTL---------------------   60 (441)
Q Consensus         2 ~~~~DVvIIGaG~~Gl~aA~~La~~G~~V~vlE~~~~~GG~~~t~~~~~~~~~g~~~d~---------------------   60 (441)
                      +++|||||+|+|+..++.|++|++.|++|+++|+|++|||.++|++ +.++.+|+....                     
T Consensus         4 P~e~DVII~GTGL~ESILAaAlSr~GkkVLHiD~N~yYGg~~aSl~-~~~L~~w~~~~~~~~~~~~~~~~~~~~~~e~e~   82 (491)
T d1vg0a1           4 PSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFS-FSGLLSWLKEYQENNDVVTENSMWQEQILENEE   82 (491)
T ss_dssp             CSBCSEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEEC-HHHHHHHHHHTC----------CGGGGCCTTEE
T ss_pred             CCccCEEEECCChHHHHHHHHHHhcCCEEEEecCCCcCCCccccee-HHHHHHHHHhhhcccccccccccccccccccch
Confidence            5789999999999999999999999999999999999999999999 888876542000                     


Q ss_pred             ------------------------------------------------------------------------CCc-----
Q psy2620          61 ------------------------------------------------------------------------PDE-----   63 (441)
Q Consensus        61 ------------------------------------------------------------------------p~~-----   63 (441)
                                                                                              |.+     
T Consensus        83 ~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~  162 (491)
T d1vg0a1          83 AIPLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNHASVTSAQSAEAAEAAETSCLPTAVEPLSMGSCEIPAEQSQCP  162 (491)
T ss_dssp             EEEBCSSCCCEEEEEEEECSCC----------------------------------------------------------
T ss_pred             hcccccccccccccceeecccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                                                                                    000     


Q ss_pred             -----------------------------------------------c----ccCCCCceeeecccceeecCchHHHHHH
Q psy2620          64 -----------------------------------------------V----TFGRGRDWNVDLIPKFLMANGSLVKLLI   92 (441)
Q Consensus        64 -----------------------------------------------~----~~g~~~~~~idl~p~~l~~~~~~~~~l~   92 (441)
                                                                     +    .++.+++|++||.|+++++.|.++++|+
T Consensus       163 ~~e~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~r~~niDL~Pk~l~a~g~lv~~Li  242 (491)
T d1vg0a1         163 GPESSPEVNDAEATGKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLI  242 (491)
T ss_dssp             ----------------------------------------------CCCHHHHHHTGGGCCEESSCCCEESSSHHHHHHH
T ss_pred             CcccccccccccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccchheecccHHHHHHH
Confidence                                                           0    0234699999999999999999999999


Q ss_pred             HhCCcceeEEEEecceEEEeCCeEEeCCCChHHHhhhccCChHHHHHHHHHHHHHHhhcccCcccccccCCCCCcHHHHH
Q psy2620          93 HTGVTRYLEFKSVEGSYVFKGGKISKVPVDQKEALASDLMGLFEKRRFRNFLVYIQEFSEADPKTWKDINPQSATTAQLY  172 (441)
Q Consensus        93 ~~~~~~~l~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~k~~l~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l  172 (441)
                      ++++.+|+||+.+++.|++.+|+++++|+++.++|.++++++++||.+|+|+.++..+. .++..++.++  ..++.+|+
T Consensus       243 ~S~v~rYlEFk~v~~~~v~~~g~~~~VP~sr~eif~s~~l~l~eKR~lmkFl~~v~~~~-~~~~~~~~~~--~~~~~e~l  319 (491)
T d1vg0a1         243 KSNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYE-EHPDEYRAYE--GTTFSEYL  319 (491)
T ss_dssp             HHTGGGGCCEEECCEEEEESSSSEEECCCSHHHHHHCSSSCHHHHHHHHHHHHHHHTGG-GCHHHHHTTT--TSBHHHHH
T ss_pred             HcChhhheeEEEeceEEEecCCeEEECCCCHHHHhcCCCCCHHHHHHHHHHHHHHhhcc-CCcccccccc--CCcHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999887 4566666554  68999999


Q ss_pred             HHhCCCcchhHHHHHHhhcccCccccchhHHHHHHHHHHHHHHhhhhCCCCeeeecCCcchHHHHHHHHHHHcCcEEEcc
Q psy2620         173 DKFGLDPNTKDFTGHALALYRDDEYINDLAIHTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQSFARLSAIYGGTYMLD  252 (441)
Q Consensus       173 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~s~~~~G~~~~~~~~gG~~~l~~~l~~~~~~~G~~i~~~  252 (441)
                      +++++++.+.+++.++++++..+.+   ++..++.++..|+.|+++||.+||+||.||.++|+|+|||.++.+||+++|+
T Consensus       320 ~~~~l~~~~~~~i~~aial~~~~~~---~~~~~l~ri~~yl~Slg~yG~spflyp~YG~gEipQ~FcR~~AV~Gg~Y~L~  396 (491)
T d1vg0a1         320 KTQKLTPNLQYFVLHSIAMTSETTS---CTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLR  396 (491)
T ss_dssp             TTSSSCHHHHHHHHHHTTC--CCSC---BHHHHHHHHHHHHHHTTSSSSSSEEEETTCTTHHHHHHHHHHHHTTCEEESS
T ss_pred             HHcCCChHHHHHHHhheeccCCCCc---cHHHHHHHHHHHHHHHHhhCCCCeEeecCCcchHHHHHHHHHHhcCcEEEcC
Confidence            9999999999999999999765443   5667899999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEE--eCCEEEEEEe-CCeEEEcCEEEECCCCCccccccccceEEEEEEecCCCCCCCCCCeeEEEecCCCCCCC
Q psy2620         253 KPVDEIVI--ENGKVVGVRS-GTEIARCKQVYCDPSYVQDRVKKLNQVIRCICLMDHPIPNTKDALSCQIIIPQKQVNRK  329 (441)
Q Consensus       253 ~~V~~i~~--~~~~~~~v~~-~g~~~~a~~vI~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~  329 (441)
                      ++|++|..  +++++.+|.. +|++++|++||++++++|.+.  .+.+.|. ++++.        .+.++++|+.+..+.
T Consensus       397 ~~i~~i~~d~e~~~~~~v~~~~g~~i~~k~vI~~psy~p~~~--~~~v~r~-c~~~~--------~s~~~i~~~p~~~~~  465 (491)
T d1vg0a1         397 HSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENT--CSRVSRD-CYNDL--------PSNVYVCSGPDSGLG  465 (491)
T ss_dssp             CCEEEEEEETTTCCEEEEEETTSCEEECSEEEEEGGGBCTTT--TTTCCGG-GSSSC--------CTTEEEECCCCSSSS
T ss_pred             CccceEEEecCCCeEEEEEccCCcEEecCeEEECHHhCCccc--cceeeeh-hhcCC--------CceEEEECCCCcCCc
Confidence            99999988  4778888886 589999999999999998754  2233331 11211        245666666555444


Q ss_pred             CcEE
Q psy2620         330 SDIY  333 (441)
Q Consensus       330 ~~i~  333 (441)
                      +.++
T Consensus       466 ~d~~  469 (491)
T d1vg0a1         466 NDNA  469 (491)
T ss_dssp             SHHH
T ss_pred             cchh
Confidence            4433
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1d5ta2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1vg0a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2bcgg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure