Psyllid ID: psy2685

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990--
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIPPHRSYSGR
cccccccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEccccccccEEEEEccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEccccEEEEEEcccEEEEEEEcccccEEEEccccccEEEEcccccccEEEEEEcccccEEEEEccccccccccEEEEEEEEccccccEEEEccccccEEEEEEccccEEEEEEcccEEEEEEcccccEEEcccccccEEEEccccccccccEEEEEEcccEEEEEEEEcccHHHHHEEEEccccccEEEccHHHHHHccccHHHHHHHHHHccccccEEHHHHHccHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEcccccEEccccccccEEEEEEEccEEEEEEcccEEEEEEccccEEEEEEEEcEEEEcccccccEEEEccccEEEEEEccEEEEEEEccccEEEEEEEccEEEEEEcccccEEEEEEccEEEEEccccccEEEEEEEcccccEEEEccccccEEEEccccccccEEEEEcccccEEEEEEcccHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHccccHHHccccccccccEEHHHHccccccccccccc
cccHEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEEcccccEEEEEEccccccEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccccccccEEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEEEcccccEEEEEcccccEEEEEEccccEEEccEcccccccEEccccccEEEEHHHHHHHHHccEEEEEEcccccccEEEEEHccccccccccccHHHHHHcccccccEHEcccccEEEccccHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHHHcccccccccEEEccccccccHEEEEccccccccHHHccccccccccccccccccccccccccccccEccccccccHHHEccccccccHHHHcccccccEEHccccEEEEEEHHcccEEEEEEEEEEEEEEEcccccccEEEEEEcccccEEcHHccHHEEHHHHHHHHHHHHHHHccccEEEEccEEEccccccEEEEcccccEEEEEHHcccEEEEEEEEEEEEEEEccccHHHHHHHHHEEEEEccHHccccEEEEccHccHHHHHHccEEEccccccccccccEEEEEcccccccEEEEccccEHEEHHHHHccHHHHHHHHHccHHHHHHHHHHHHHccccEEEEEEEcccccHHHEHHHccccccccccccc
MLTKFETKSArvkglsfhpkrpwilssLHNGVIQLWDYRMNTLLEkfdehegpvrgicfhnqqpifvsggddykIKVWNYKQRKCIFTLLGHLDYIRttffhheypwilsasddqTIRIWNWQSRNcicvltghnhyvmcaqfhptddivvsasldQTIRVWDIsglrkknvapgmgaddrQIKLWRMNDSKAWEVDIFRghynnvscvlfhpksevivsnaedksirlwdmtkrTCLNTFRREQERFWSEVIVSNaedksirlwdmtkRTCLNTFRREQERFWVLVahptlnlfaaghdAGMVVFKfererpaytvhnnVMYYVKERFLhrldltnskdSVVMQLrgggripahsisynateHSILVTTrnannfenstydlymipkeeserkevadgkrsTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRmgndrqesalcgwpgtgypevalHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESnlrtadpnatlptvhpeaqllrppapvaeaetnwpllTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCrhvvwspdmthlALLSKHTLHICNrkmegaglmksdVINNidsslaatevdvqgwgddadlgnqvyyldrecsphvlridpteFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQqkgypevalHFVKDDRTRLTLALecgnipphrsysgr
mltkfetksarvkglsfhpkrpwilsSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDisglrkknvapgmgaddrqikLWRMNDSKAWEVDIFRGHYNNVSCVLFHpksevivsnaedksirlwdmtkRTCLNTfrreqerfwsevivsnaedksirlwdmtKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEeserkevadgkrstgisavwvarnrfavldrnhtILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHvvtkkmssvgcEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLalecgnipphrsysgr
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAAlllgrmgrgffllhyfsffffaflrlaflylITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGlseeaaelesNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIPPHRSYSGR
**************LSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMI****************TGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHG***************************************AETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNI*********
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELE*************************APVAEAETNWPLLTVTK****************ALLCREADHVILFDVQQKR********************VGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIP********
*************GLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEE************TGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIPPHRSYSGR
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIPP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNRKMEGAGLMKSDVINNIDSSLAATEVDVQGWGDDADLGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIPPHRSYSGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query992 2.2.26 [Sep-21-2011]
P53621 1224 Coatomer subunit alpha OS yes N/A 0.399 0.323 0.636 0.0
Q27954 1224 Coatomer subunit alpha OS yes N/A 0.399 0.323 0.634 0.0
Q8CIE6 1224 Coatomer subunit alpha OS yes N/A 0.399 0.323 0.634 0.0
Q94A40 1216 Coatomer subunit alpha-1 yes N/A 0.395 0.322 0.549 1e-155
Q9AUR8 1218 Coatomer subunit alpha-1 yes N/A 0.396 0.322 0.540 1e-153
Q9SJT9 1218 Coatomer subunit alpha-2 no N/A 0.395 0.321 0.545 1e-153
Q9AUR7 1218 Coatomer subunit alpha-2 yes N/A 0.396 0.322 0.536 1e-152
Q0J3D9 1218 Coatomer subunit alpha-3 yes N/A 0.396 0.322 0.536 1e-152
Q96WV5 1207 Putative coatomer subunit yes N/A 0.395 0.324 0.484 1e-133
Q55FR9 1221 Coatomer subunit alpha OS yes N/A 0.391 0.317 0.479 1e-128
>sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 Back     alignment and function desciption
 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/479 (63%), Positives = 357/479 (74%), Gaps = 83/479 (17%)

Query: 1   MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFH 60
           MLTKFETKSARVKGLSFHPKRPWIL+SLHNGVIQLWDYRM TL++KFDEH+GPVRGI FH
Sbjct: 1   MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH 60

Query: 61  NQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW 120
            QQP+FVSGGDDYKIKVWNYK R+C+FTLLGHLDYIRTTFFHHEYPWILSASDDQTIR+W
Sbjct: 61  KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW 120

Query: 121 NWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGM---- 176
           NWQSR C+CVLTGHNHYVMCAQFHPT+D+VVSASLDQT+RVWDISGLRKKN++PG     
Sbjct: 121 NWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD 180

Query: 177 ------------------------------------------GADDRQIKLWRMNDSKAW 194
                                                     GADDRQ+K+WRMN+SKAW
Sbjct: 181 VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW 240

Query: 195 EVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEVIV 254
           EVD  RGHYNNVSC +FHP+ E+I+SN+EDKSIR+WDM+KRT + TFRR+ +R       
Sbjct: 241 EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR------- 293

Query: 255 SNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERERPA 314
                                       FWVL AHP LNLFAAGHD GM+VFK ERERPA
Sbjct: 294 ----------------------------FWVLAAHPNLNLFAAGHDGGMIVFKLERERPA 325

Query: 315 YTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNAN 374
           Y VH N+++YVK+RFL +LD  +SKD  VMQLR G + P  ++SYN  E+++L+ TR A+
Sbjct: 326 YAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTR-AS 384

Query: 375 NFENSTYDLYMIPKE-ESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNE 432
           N ENSTYDLY IPK+ +S+  +  +GKRS+G++AVWVARNRFAVLDR H++LIKNLKNE
Sbjct: 385 NLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNE 443
Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.
Homo sapiens (taxid: 9606)
>sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 Back     alignment and function description
>sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 Back     alignment and function description
>sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=1 SV=2 Back     alignment and function description
>sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 Back     alignment and function description
>sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 Back     alignment and function description
>sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 Back     alignment and function description
>sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query992
322780808 1209 hypothetical protein SINV_04529 [Solenop 0.399 0.327 0.662 0.0
307188017 1208 Coatomer subunit alpha [Camponotus flori 0.399 0.327 0.664 0.0
332026185 1209 Coatomer subunit alpha [Acromyrmex echin 0.399 0.327 0.660 0.0
380014926 1214 PREDICTED: LOW QUALITY PROTEIN: coatomer 0.399 0.326 0.660 0.0
66504662 1214 PREDICTED: coatomer subunit alpha isofor 0.399 0.326 0.660 0.0
383850572 1214 PREDICTED: coatomer subunit alpha [Megac 0.399 0.326 0.654 0.0
242015300 1222 coatomer alpha subunit, putative [Pedicu 0.399 0.324 0.659 0.0
193627199 1230 PREDICTED: coatomer subunit alpha-like [ 0.400 0.322 0.661 0.0
443694451 1232 hypothetical protein CAPTEDRAFT_156336 [ 0.399 0.321 0.647 0.0
345488489 1146 PREDICTED: coatomer subunit alpha-like [ 0.398 0.344 0.654 0.0
>gi|322780808|gb|EFZ10037.1| hypothetical protein SINV_04529 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/480 (66%), Positives = 365/480 (76%), Gaps = 84/480 (17%)

Query: 1   MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFH 60
           MLTKFETKSARVKGLSFHPKRPW+L+SLHNGVIQLWDYRM  LL+KFDEH+GPVRGICFH
Sbjct: 1   MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCALLDKFDEHDGPVRGICFH 60

Query: 61  NQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW 120
           NQQP+FVSGGDDYKIKVWNYKQR+CIFTLLGHLDYIRTT FHHEYPWILSASDDQTIRIW
Sbjct: 61  NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTMFHHEYPWILSASDDQTIRIW 120

Query: 121 NWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPG----- 175
           NWQSR CICVLTGHNHYVMCAQFHPT+DI+VSASLDQT+RVWDISGLRKKNVAPG     
Sbjct: 121 NWQSRTCICVLTGHNHYVMCAQFHPTEDIIVSASLDQTVRVWDISGLRKKNVAPGPGGLE 180

Query: 176 -------------------------------------------MGADDRQIKLWRMNDSK 192
                                                       GADDRQIK+WRMND+K
Sbjct: 181 DHLKNPGATDLFGQADAVVKYVLEGHDRGVNWACFHGTLPLIVSGADDRQIKMWRMNDAK 240

Query: 193 AWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWSEV 252
           AWEVD  RGHYNNVSCVLFHP+ ++I+SN+EDKSIR+WDMTKRTCL+TFRRE ER     
Sbjct: 241 AWEVDTCRGHYNNVSCVLFHPRQDLILSNSEDKSIRVWDMTKRTCLHTFRREHER----- 295

Query: 253 IVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVFKFERER 312
                                         FWVL AHPTLNLFAAGHD+GM++FK ERER
Sbjct: 296 ------------------------------FWVLAAHPTLNLFAAGHDSGMIIFKLERER 325

Query: 313 PAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRN 372
           PAY V+ N++YYVK+RFL +LD T SKD+ VMQ+RGGG+ P +S+SYN  E+S+L+ TR+
Sbjct: 326 PAYAVYGNLLYYVKDRFLRKLDFTTSKDTSVMQIRGGGKTPPYSMSYNQAENSVLICTRS 385

Query: 373 ANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNE 432
            +N ENSTYDLYMIP+E     + AD KR++G++A+WVARNRFAVLDR ++++IKNLKNE
Sbjct: 386 PSNIENSTYDLYMIPREGDSNTD-ADTKRASGVTAIWVARNRFAVLDRAYSLVIKNLKNE 444

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307188017|gb|EFN72866.1| Coatomer subunit alpha [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332026185|gb|EGI66327.1| Coatomer subunit alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380014926|ref|XP_003691465.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-like [Apis florea] Back     alignment and taxonomy information
>gi|66504662|ref|XP_623198.1| PREDICTED: coatomer subunit alpha isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383850572|ref|XP_003700869.1| PREDICTED: coatomer subunit alpha [Megachile rotundata] Back     alignment and taxonomy information
>gi|242015300|ref|XP_002428302.1| coatomer alpha subunit, putative [Pediculus humanus corporis] gi|212512887|gb|EEB15564.1| coatomer alpha subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193627199|ref|XP_001950394.1| PREDICTED: coatomer subunit alpha-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|443694451|gb|ELT95580.1| hypothetical protein CAPTEDRAFT_156336 [Capitella teleta] Back     alignment and taxonomy information
>gi|345488489|ref|XP_001601104.2| PREDICTED: coatomer subunit alpha-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query992
UNIPROTKB|H9KZL3 1169 LOC100859596 "Uncharacterized 0.434 0.368 0.664 3.3e-224
UNIPROTKB|H9L3L2 1134 LOC100859596 "Uncharacterized 0.434 0.380 0.664 3.3e-224
UNIPROTKB|P53621 1224 COPA "Coatomer subunit alpha" 0.434 0.352 0.662 2.3e-223
UNIPROTKB|G3V6T1 1224 Copa "Protein Copa" [Rattus no 0.434 0.352 0.659 6.2e-223
MGI|MGI:1334462 1224 Copa "coatomer protein complex 0.434 0.352 0.659 6.2e-223
UNIPROTKB|F1RJX8 1224 COPA "Uncharacterized protein" 0.434 0.352 0.659 7.9e-223
UNIPROTKB|Q27954 1224 COPA "Coatomer subunit alpha" 0.434 0.352 0.659 7.9e-223
ZFIN|ZDB-GENE-020905-2 1226 copa "coatomer protein complex 0.452 0.366 0.646 4.4e-220
FB|FBgn0025725 1234 alphaCop "alpha-coatomer prote 0.432 0.347 0.661 1.3e-216
UNIPROTKB|F1PU93 1214 COPA "Coatomer subunit alpha" 0.423 0.345 0.639 2.5e-213
UNIPROTKB|H9KZL3 LOC100859596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1594 (566.2 bits), Expect = 3.3e-224, Sum P(3) = 3.3e-224
 Identities = 295/444 (66%), Positives = 356/444 (80%)

Query:     1 MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFH 60
             MLTKFETKSARVKGLSFHPKRPWIL+SLHNGVIQLWDYRM TL++KFDEH+GPVRGI FH
Sbjct:     1 MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH 60

Query:    61 NQQPIFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW 120
              QQP+FVSGGDDYKIKVWNYK R+C+FTLLGHLDYIRTTFFHHEYPWILSASDDQTIR+W
Sbjct:    61 KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW 120

Query:   121 NWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPG-MGAD 179
             NWQSR C+CVLTGHNHYVMCAQFHP++D+VVSASLDQT+RVWDISGLRKKN++PG + +D
Sbjct:   121 NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD 180

Query:   180 DRQIK-LWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKR--- 235
              R I  +     + A    +  GH   V+   FHP   +IVS A+D+ +++W M +    
Sbjct:   181 VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW 240

Query:   236 ---TCLNTFRREQERFW---SEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAH 289
                TC   +       +    E+I+SN+EDKSIR+WDM+KRT + TFRR+ +RFWVL AH
Sbjct:   241 EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH 300

Query:   290 PTLNLFAAGHDAGMVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGG 349
             P LNLFAAGHD GM+VFK ERERPAY VH N++YYVK+RFL +LD  +SKD  VMQLR G
Sbjct:   301 PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLYYVKDRFLRQLDFNSSKDVAVMQLRSG 360

Query:   350 GRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKE-ESERKEVADGKRSTGISAV 408
              + P  ++SYN  E+++L+ TR A+N ENSTYDLY IPK+ +S+  +  +GKRS+G++AV
Sbjct:   361 SKFPVFNMSYNPAENAVLLCTR-ASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAV 419

Query:   409 WVARNRFAVLDRNHTILIKNLKNE 432
             WVARNRFAVLDR H+ILIKNLKNE
Sbjct:   420 WVARNRFAVLDRMHSILIKNLKNE 443
GO:0005198 "structural molecule activity" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0030126 "COPI vesicle coat" evidence=IEA
GO:0005615 "extracellular space" evidence=IEA
GO:0030157 "pancreatic juice secretion" evidence=IEA
UNIPROTKB|H9L3L2 LOC100859596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P53621 COPA "Coatomer subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6T1 Copa "Protein Copa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1334462 Copa "coatomer protein complex subunit alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJX8 COPA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q27954 COPA "Coatomer subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020905-2 copa "coatomer protein complex, subunit alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0025725 alphaCop "alpha-coatomer protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PU93 COPA "Coatomer subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-66
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-54
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-52
pfam04053429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 8e-48
pfam04053429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 5e-44
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-40
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-38
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-33
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-33
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-29
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-13
pfam04053429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 9e-13
smart0032040 smart00320, WD40, WD40 repeats 1e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 6e-09
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 2e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-06
smart0032040 smart00320, WD40, WD40 repeats 3e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
smart0032040 smart00320, WD40, WD40 repeats 4e-06
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 5e-04
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 7e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score =  223 bits (571), Expect = 4e-66
 Identities = 79/300 (26%), Positives = 130/300 (43%), Gaps = 34/300 (11%)

Query: 9   SARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVS 68
           +  V  ++F P    + +   +G I++WD     LL     H GPVR +          S
Sbjct: 9   TGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLAS 68

Query: 69  GGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCI 128
           G  D  I++W+ +  +C+ TL GH  Y+ +  F  +   + S+S D+TI++W+ ++  C+
Sbjct: 69  GSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCL 128

Query: 129 CVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRM 188
             L GH  +V    F P    V S+S D TI++WD+   +                    
Sbjct: 129 TTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGK-------------------- 168

Query: 189 NDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERF 248
                  V    GH   V+ V F P  E ++S++ D +I+LWD++   CL T R  +   
Sbjct: 169 ------CVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGV 222

Query: 249 WS-------EVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLN-LFAAGHD 300
            S        ++ S +ED +IR+WD+    C+ T          L   P    L +   D
Sbjct: 223 NSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSAD 282

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information
>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 992
KOG0292|consensus 1202 100.0
KOG0292|consensus1202 100.0
KOG0276|consensus794 100.0
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 100.0
KOG0271|consensus480 100.0
KOG0276|consensus 794 100.0
KOG1538|consensus1081 100.0
KOG0319|consensus775 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0318|consensus603 100.0
KOG0286|consensus343 100.0
KOG1524|consensus737 100.0
KOG0319|consensus775 100.0
KOG0272|consensus459 100.0
KOG0318|consensus603 100.0
KOG0291|consensus893 100.0
KOG0279|consensus315 100.0
KOG0291|consensus893 100.0
KOG0284|consensus464 100.0
KOG0273|consensus524 100.0
KOG0645|consensus312 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0296|consensus399 100.0
KOG0265|consensus338 100.0
KOG0285|consensus460 100.0
KOG0295|consensus406 100.0
KOG0316|consensus307 100.0
KOG0286|consensus343 100.0
KOG0306|consensus888 100.0
KOG0266|consensus456 99.98
KOG0263|consensus707 99.98
KOG0279|consensus315 99.98
KOG2041|consensus1189 99.98
KOG0273|consensus524 99.98
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 99.97
KOG0284|consensus464 99.97
KOG0315|consensus311 99.97
KOG0285|consensus460 99.97
KOG3617|consensus1416 99.97
KOG0295|consensus406 99.97
KOG0263|consensus707 99.97
KOG0293|consensus519 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0645|consensus312 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0281|consensus499 99.96
KOG0282|consensus503 99.96
KOG0296|consensus399 99.96
KOG0315|consensus311 99.96
KOG0275|consensus508 99.96
KOG0265|consensus338 99.95
KOG1539|consensus910 99.95
KOG0643|consensus327 99.95
KOG0266|consensus456 99.95
KOG1407|consensus313 99.95
KOG1408|consensus1080 99.95
KOG0306|consensus888 99.95
KOG0274|consensus537 99.95
KOG2048|consensus691 99.95
KOG0281|consensus499 99.95
KOG0278|consensus334 99.95
KOG0313|consensus423 99.95
KOG0310|consensus487 99.94
KOG0275|consensus508 99.94
KOG0282|consensus503 99.94
KOG0316|consensus307 99.94
KOG1446|consensus311 99.94
KOG0640|consensus430 99.94
PTZ00421493 coronin; Provisional 99.94
KOG0283|consensus712 99.93
KOG0300|consensus481 99.93
KOG1539|consensus910 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.93
PTZ00421493 coronin; Provisional 99.93
KOG0973|consensus942 99.93
KOG0274|consensus537 99.93
KOG0643|consensus327 99.93
PTZ00420568 coronin; Provisional 99.93
KOG0288|consensus459 99.93
KOG0305|consensus484 99.93
KOG0299|consensus479 99.93
KOG0278|consensus334 99.93
KOG0772|consensus641 99.92
KOG0308|consensus735 99.92
KOG0293|consensus519 99.92
KOG0289|consensus506 99.92
KOG1063|consensus764 99.92
KOG0301|consensus745 99.92
KOG0294|consensus362 99.92
KOG0277|consensus311 99.92
KOG0283|consensus712 99.92
KOG2106|consensus626 99.91
KOG0313|consensus423 99.91
PTZ00420568 coronin; Provisional 99.91
KOG0277|consensus311 99.91
KOG0640|consensus430 99.91
KOG0647|consensus347 99.91
KOG0268|consensus433 99.9
KOG0305|consensus484 99.9
KOG4283|consensus397 99.9
KOG0310|consensus487 99.9
KOG2096|consensus420 99.9
KOG0641|consensus350 99.9
KOG0294|consensus362 99.89
KOG1036|consensus323 99.89
KOG0264|consensus422 99.89
KOG0289|consensus506 99.89
KOG0973|consensus942 99.89
KOG0299|consensus479 99.89
KOG1446|consensus311 99.89
KOG2048|consensus691 99.89
KOG0772|consensus641 99.89
KOG1408|consensus1080 99.89
KOG2106|consensus626 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG1538|consensus1081 99.89
KOG1063|consensus764 99.89
KOG1445|consensus1012 99.88
KOG0301|consensus745 99.88
KOG0288|consensus459 99.88
KOG1407|consensus313 99.88
KOG0308|consensus735 99.88
KOG0641|consensus350 99.88
KOG2055|consensus514 99.88
KOG1332|consensus299 99.87
KOG0268|consensus433 99.87
KOG0300|consensus481 99.87
KOG4328|consensus498 99.86
KOG0269|consensus839 99.86
KOG0267|consensus825 99.86
KOG1274|consensus933 99.86
KOG0646|consensus476 99.85
KOG0264|consensus422 99.85
KOG0269|consensus839 99.85
KOG0647|consensus347 99.85
KOG1332|consensus299 99.84
KOG0646|consensus476 99.84
KOG0307|consensus1049 99.83
KOG0302|consensus440 99.83
KOG1036|consensus323 99.83
KOG0321|consensus720 99.83
KOG1273|consensus405 99.83
KOG0650|consensus733 99.82
KOG1034|consensus385 99.82
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.82
KOG0267|consensus825 99.82
KOG0639|consensus705 99.82
KOG2445|consensus361 99.82
KOG1524|consensus737 99.82
KOG2445|consensus361 99.81
COG2319466 FOG: WD40 repeat [General function prediction only 99.8
KOG0639|consensus705 99.8
KOG1274|consensus933 99.8
KOG2096|consensus420 99.8
KOG4283|consensus397 99.8
KOG1009|consensus434 99.8
KOG2919|consensus406 99.79
KOG1273|consensus405 99.78
KOG0302|consensus440 99.78
KOG0270|consensus463 99.77
KOG2055|consensus514 99.76
COG2319466 FOG: WD40 repeat [General function prediction only 99.76
KOG1445|consensus1012 99.76
KOG0321|consensus720 99.75
KOG4378|consensus673 99.73
KOG1963|consensus792 99.73
KOG0270|consensus463 99.73
KOG4378|consensus673 99.72
KOG1034|consensus385 99.72
KOG0303|consensus472 99.72
KOG1009|consensus434 99.71
KOG1188|consensus376 99.71
KOG1007|consensus370 99.69
KOG0642|consensus577 99.69
KOG0650|consensus733 99.68
KOG0644|consensus1113 99.68
KOG2041|consensus1189 99.68
KOG4227|consensus609 99.68
KOG4328|consensus498 99.67
KOG1517|consensus1387 99.65
KOG0649|consensus325 99.65
KOG0644|consensus1113 99.65
KOG3616|consensus 1636 99.64
KOG1310|consensus758 99.64
KOG1007|consensus370 99.64
KOG1523|consensus361 99.64
KOG0642|consensus577 99.64
KOG0322|consensus323 99.63
KOG4497|consensus447 99.63
KOG1963|consensus792 99.63
KOG1587|consensus555 99.61
KOG2110|consensus391 99.61
KOG0307|consensus1049 99.6
PRK11028330 6-phosphogluconolactonase; Provisional 99.6
KOG2139|consensus445 99.6
KOG2919|consensus406 99.6
KOG0303|consensus472 99.59
KOG1188|consensus376 99.59
KOG0290|consensus364 99.59
KOG1587|consensus555 99.56
PRK01742429 tolB translocation protein TolB; Provisional 99.56
KOG1272|consensus545 99.55
KOG1912|consensus1062 99.55
KOG0771|consensus398 99.55
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.54
KOG4227|consensus609 99.54
KOG0649|consensus325 99.53
KOG1517|consensus1387 99.52
PRK11028330 6-phosphogluconolactonase; Provisional 99.51
KOG1240|consensus1431 99.51
KOG1523|consensus361 99.5
KOG2110|consensus391 99.5
KOG1334|consensus559 99.49
PRK01742429 tolB translocation protein TolB; Provisional 99.48
KOG1310|consensus758 99.48
KOG2111|consensus346 99.46
PRK03629429 tolB translocation protein TolB; Provisional 99.43
KOG1354|consensus433 99.43
KOG0771|consensus398 99.43
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.41
KOG1240|consensus1431 99.4
KOG2139|consensus445 99.4
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.39
PRK02889427 tolB translocation protein TolB; Provisional 99.37
KOG3617|consensus1416 99.36
PRK05137435 tolB translocation protein TolB; Provisional 99.36
PRK04922433 tolB translocation protein TolB; Provisional 99.36
KOG2394|consensus636 99.36
KOG0290|consensus364 99.36
PRK03629429 tolB translocation protein TolB; Provisional 99.36
PRK05137435 tolB translocation protein TolB; Provisional 99.35
KOG4497|consensus447 99.35
KOG0322|consensus323 99.35
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.35
PRK04922433 tolB translocation protein TolB; Provisional 99.34
KOG2321|consensus703 99.34
KOG2314|consensus698 99.32
KOG2394|consensus636 99.32
PRK02889427 tolB translocation protein TolB; Provisional 99.31
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.3
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.3
KOG3881|consensus412 99.27
KOG1409|consensus404 99.26
KOG1334|consensus559 99.26
KOG2111|consensus346 99.24
KOG3881|consensus412 99.24
KOG1272|consensus545 99.24
KOG2315|consensus566 99.24
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.23
KOG0974|consensus967 99.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.2
KOG4547|consensus541 99.19
KOG0974|consensus967 99.19
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.18
PRK00178430 tolB translocation protein TolB; Provisional 99.18
KOG2114|consensus933 99.18
KOG1912|consensus1062 99.15
PRK04792448 tolB translocation protein TolB; Provisional 99.13
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.13
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.12
KOG1920|consensus 1265 99.1
PRK00178430 tolB translocation protein TolB; Provisional 99.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.09
PRK01029428 tolB translocation protein TolB; Provisional 99.08
PRK04792448 tolB translocation protein TolB; Provisional 99.06
KOG2315|consensus566 99.06
KOG1409|consensus404 99.06
PRK01029428 tolB translocation protein TolB; Provisional 99.05
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.03
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.02
COG4946668 Uncharacterized protein related to the periplasmic 99.01
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.0
KOG1064|consensus2439 98.99
KOG2321|consensus703 98.97
KOG1064|consensus2439 98.97
KOG4547|consensus541 98.96
KOG0280|consensus339 98.93
KOG1354|consensus433 98.91
KOG2314|consensus698 98.89
KOG0280|consensus339 98.86
KOG2066|consensus846 98.86
COG4946668 Uncharacterized protein related to the periplasmic 98.86
KOG4190|consensus1034 98.85
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.74
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.74
KOG4190|consensus1034 98.74
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.71
KOG0309|consensus1081 98.71
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.7
PRK04043419 tolB translocation protein TolB; Provisional 98.69
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.68
KOG4532|consensus344 98.68
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.68
KOG3914|consensus390 98.67
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.65
KOG3914|consensus390 98.64
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.63
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.62
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.6
KOG0309|consensus1081 98.55
KOG4714|consensus319 98.54
KOG4649|consensus354 98.51
PRK04043419 tolB translocation protein TolB; Provisional 98.51
KOG4714|consensus319 98.51
KOG1832|consensus1516 98.47
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.44
KOG2695|consensus425 98.43
KOG0882|consensus558 98.42
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.4
KOG4532|consensus344 98.38
KOG2066|consensus846 98.35
KOG1275|consensus1118 98.34
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.3
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.28
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.23
KOG2114|consensus933 98.21
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.2
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.17
KOG1920|consensus 1265 98.16
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.15
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.14
KOG1832|consensus1516 98.11
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.1
KOG4649|consensus354 98.09
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.08
KOG1645|consensus463 98.06
KOG2695|consensus425 98.06
KOG3621|consensus726 98.03
KOG3616|consensus 1636 98.02
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.97
KOG0882|consensus558 97.94
KOG1275|consensus1118 97.92
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.89
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.83
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.69
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.69
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.68
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.67
KOG1008|consensus783 97.65
PRK02888635 nitrous-oxide reductase; Validated 97.55
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.54
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.42
KOG3621|consensus726 97.37
KOG1645|consensus463 97.37
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.37
KOG4640|consensus665 97.29
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.27
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.27
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.19
PRK02888635 nitrous-oxide reductase; Validated 97.19
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.18
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.13
COG3391381 Uncharacterized conserved protein [Function unknow 97.05
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.98
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.96
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.95
COG3391381 Uncharacterized conserved protein [Function unknow 96.92
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.91
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.89
KOG4640|consensus665 96.81
KOG2247|consensus615 96.76
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.74
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.7
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.67
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.59
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.55
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.53
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.5
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.49
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.46
KOG1897|consensus1096 96.4
PRK13616591 lipoprotein LpqB; Provisional 96.36
KOG2079|consensus 1206 96.27
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.24
KOG1008|consensus783 96.22
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.12
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.03
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.0
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.96
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.94
KOG2395|consensus644 95.82
PRK10115686 protease 2; Provisional 95.8
KOG2079|consensus 1206 95.78
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.65
PRK13616591 lipoprotein LpqB; Provisional 95.63
PHA02713557 hypothetical protein; Provisional 95.63
KOG4441|consensus571 95.58
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.49
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.38
KOG1897|consensus1096 95.34
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.34
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.33
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.26
PHA02713557 hypothetical protein; Provisional 95.2
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.01
KOG2280|consensus829 94.94
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.76
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.64
KOG4441|consensus571 94.6
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.46
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.24
PF14727418 PHTB1_N: PTHB1 N-terminus 94.23
KOG2444|consensus238 94.2
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.2
PHA03098534 kelch-like protein; Provisional 94.1
KOG2280|consensus829 94.02
KOG2444|consensus238 94.0
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.99
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.87
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.66
KOG1916|consensus 1283 93.55
KOG4499|consensus310 93.54
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.48
KOG2395|consensus644 93.33
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.16
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.09
KOG0985|consensus1666 92.88
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.72
PHA02790480 Kelch-like protein; Provisional 92.64
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.46
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 92.3
PRK13684334 Ycf48-like protein; Provisional 92.28
KOG3630|consensus 1405 92.05
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 91.44
PRK13684334 Ycf48-like protein; Provisional 91.25
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.09
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 90.98
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 90.56
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.71
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 89.12
KOG1898|consensus1205 88.69
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 88.34
PRK1545085 signal transduction protein PmrD; Provisional 88.25
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 87.3
KOG3630|consensus 1405 87.28
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 87.18
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 87.11
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 87.04
PHA03098534 kelch-like protein; Provisional 87.04
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 87.0
KOG0985|consensus1666 86.81
COG5167776 VID27 Protein involved in vacuole import and degra 86.4
KOG2377|consensus657 85.98
KOG1916|consensus1283 85.9
PRK10370198 formate-dependent nitrite reductase complex subuni 85.6
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 85.37
PHA02790480 Kelch-like protein; Provisional 85.28
PLN032181060 maturation of RBCL 1; Provisional 85.03
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 84.99
COG3292671 Predicted periplasmic ligand-binding sensor domain 84.93
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 84.45
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 84.43
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 84.41
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 84.29
PRK11788389 tetratricopeptide repeat protein; Provisional 84.09
KOG4460|consensus741 83.78
KOG4460|consensus741 83.76
COG5167776 VID27 Protein involved in vacuole import and degra 83.62
KOG4499|consensus310 83.44
PRK11788389 tetratricopeptide repeat protein; Provisional 83.32
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 83.08
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 82.67
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 82.46
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 81.97
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 81.87
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 81.56
PLN03077857 Protein ECB2; Provisional 81.56
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 81.45
PRK12370553 invasion protein regulator; Provisional 80.71
PLN032181060 maturation of RBCL 1; Provisional 80.63
KOG2377|consensus657 80.55
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 80.5
PF1118382 PmrD: Polymyxin resistance protein PmrD; InterPro: 80.37
KOG4659|consensus 1899 80.01
>KOG0292|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.6e-134  Score=1134.46  Aligned_cols=622  Identities=57%  Similarity=0.985  Sum_probs=562.7

Q ss_pred             CcEEeecCCCCEEEEEEcCCCCEEEEEEcCCeEEEEEcCCCeEEEEeccCCCCEEEEEEecCCCEEEEEECCCeEEEEEc
Q psy2685           1 MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNY   80 (992)
Q Consensus         1 ml~~l~~H~~~V~~iafspdg~~Lasg~~dg~I~IWd~~~g~~~~~~~~h~~~V~~l~fspdg~~Lasgs~Dg~I~VWd~   80 (992)
                      |+++|+..+++|.+++|||..+|++++.++|.|++||++.+.++.+|..|+++|++++|||++++++||++|..|+||++
T Consensus         1 mltkfEskSsRvKglsFHP~rPwILtslHsG~IQlWDYRM~tli~rFdeHdGpVRgv~FH~~qplFVSGGDDykIkVWnY   80 (1202)
T KOG0292|consen    1 MLTKFESKSSRVKGLSFHPKRPWILTSLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVDFHPTQPLFVSGGDDYKIKVWNY   80 (1202)
T ss_pred             CcchhhcccccccceecCCCCCEEEEeecCceeeeehhhhhhHHhhhhccCCccceeeecCCCCeEEecCCccEEEEEec
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeEEEEEccCCCCEEEEEEecCCCEEEEEECCCeEEEEECCCCeeEEEEecCCCCeEEEEEecCCCEEEEEECCCeEE
Q psy2685          81 KQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIR  160 (992)
Q Consensus        81 ~t~~~~~~l~~h~~~V~~i~fspd~~~L~sgs~Dg~I~vwdl~t~~~i~~l~~h~~~V~sl~fspdg~~L~sgs~Dg~I~  160 (992)
                      ++.+++.++.+|.+.|+.+.||+..++++|+|+|.+|+|||+++++++.++.||.++|+|..|||....++++|.|++|+
T Consensus        81 k~rrclftL~GHlDYVRt~~FHheyPWIlSASDDQTIrIWNwqsr~~iavltGHnHYVMcAqFhptEDlIVSaSLDQTVR  160 (1202)
T KOG0292|consen   81 KTRRCLFTLLGHLDYVRTVFFHHEYPWILSASDDQTIRIWNWQSRKCIAVLTGHNHYVMCAQFHPTEDLIVSASLDQTVR  160 (1202)
T ss_pred             ccceehhhhccccceeEEeeccCCCceEEEccCCCeEEEEeccCCceEEEEecCceEEEeeccCCccceEEEecccceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEECCCCccccccCCccc-----CCCeEEEEEccCCcceEEEEEeccCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCC
Q psy2685         161 VWDISGLRKKNVAPGMGA-----DDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKR  235 (992)
Q Consensus       161 iwd~~~~~~~~~~~~~~~-----~d~~I~iwd~~~~~~~~i~~l~~h~~~V~~v~fspdg~~L~s~s~Dg~I~vwdl~~~  235 (992)
                      +||+.+.+++...++...     ..+...++  ..........+.||...|+.++|||.-.+|+||+.|..|++|.++..
T Consensus       161 VWDisGLRkk~~~pg~~e~~~~~~~~~~dLf--g~~DaVVK~VLEGHDRGVNwaAfhpTlpliVSG~DDRqVKlWrmnet  238 (1202)
T KOG0292|consen  161 VWDISGLRKKNKAPGSLEDQMRGQQGNSDLF--GQTDAVVKHVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNET  238 (1202)
T ss_pred             EEeecchhccCCCCCCchhhhhccccchhhc--CCcCeeeeeeecccccccceEEecCCcceEEecCCcceeeEEEeccc
Confidence            999999988877776110     00111111  11122355678999999999999999999999999999999998764


Q ss_pred             e--eeeEeeccCccccc-------CEEEEEeCCCeEEEEECCCCeEEEEeecCCCCEEEEEEeCCCCEEEEEECCCEEEE
Q psy2685         236 T--CLNTFRREQERFWS-------EVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDAGMVVF  306 (992)
Q Consensus       236 ~--~l~~~~~~~~~~~s-------~~l~sgs~Dg~I~vwd~~t~~~v~~l~~h~~~V~~la~spdg~~Lasgsddgiivw  306 (992)
                      +  .+.+.++|...+.+       .++++.+.|++|+|||+...+.+++++...++.|.++.||..+++|+|+|+|+++|
T Consensus       239 KaWEvDtcrgH~nnVssvlfhp~q~lIlSnsEDksirVwDm~kRt~v~tfrrendRFW~laahP~lNLfAAgHDsGm~VF  318 (1202)
T KOG0292|consen  239 KAWEVDTCRGHYNNVSSVLFHPHQDLILSNSEDKSIRVWDMTKRTSVQTFRRENDRFWILAAHPELNLFAAGHDSGMIVF  318 (1202)
T ss_pred             cceeehhhhcccCCcceEEecCccceeEecCCCccEEEEecccccceeeeeccCCeEEEEEecCCcceeeeecCCceEEE
Confidence            4  45566777766543       78999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCcceEEeeccEEEEEeCCeEEEEEeeCCCceEEEEeecC--CCccceeEEEccCCCEEEEEecCCccccCCeEEEE
Q psy2685         307 KFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGG--GRIPAHSISYNATEHSILVTTRNANNFENSTYDLY  384 (992)
Q Consensus       307 ~l~~~~~~~~~~~~~v~~~~~~~i~i~dl~~~~~~~v~~l~~~--~~~~I~~lafspdg~~lav~~~~~~~~~~g~i~i~  384 (992)
                      ++++++|++.++++.++++.++.|+.+|+.+.++.++..++..  ...++.++++||....+++++.    .++|.+.++
T Consensus       319 kleRErpa~~v~~n~LfYvkd~~i~~~d~~t~~d~~v~~lr~~g~~~~~~~smsYNpae~~vlics~----~~n~~y~L~  394 (1202)
T KOG0292|consen  319 KLERERPAYAVNGNGLFYVKDRFIRSYDLRTQKDTAVASLRRPGTLWQPPRSLSYNPAENAVLICSN----LDNGEYELV  394 (1202)
T ss_pred             EEcccCceEEEcCCEEEEEccceEEeeeccccccceeEeccCCCcccCCcceeeeccccCeEEEEec----cCCCeEEEE
Confidence            9999999999999999999999999999999999999998754  3578899999999998888863    445555555


Q ss_pred             EeCCCccccceeccCccccceEEEEecCCeEEEEEcCCeEEEEEcCCccccccccchhhccccccccCCccceecccccc
Q psy2685         385 MIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEYLWRMGNDRQESALCGWPGTGYPEVALHFVKD  464 (992)
Q Consensus       385 ~l~~~~~~~~~~~~~~~~~~~s~~w~~~~~~av~~~~g~I~i~dl~~~~~W~~~~~~l~~ll~gL~~~g~~~~al~~~~d  464 (992)
                      .+++...                                                                         
T Consensus       395 ~ipk~~~-------------------------------------------------------------------------  401 (1202)
T KOG0292|consen  395 QIPKDSD-------------------------------------------------------------------------  401 (1202)
T ss_pred             EecCccc-------------------------------------------------------------------------
Confidence            5443211                                                                         


Q ss_pred             ccceeeceeccCCHHHHHHHHHhcCChHHHHHHHHHHHHcCCHHHHHHHHHHccCcchHHHHHHHhCCHHHHHHHHHHHH
Q psy2685         465 DRTRLTLALECGNIDIALEAARVLEDKSVWERLGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAE  544 (992)
Q Consensus       465 ~~~~F~~aL~~g~ldeA~~~a~~i~~~~~W~~LA~~AL~~~~l~iAe~aY~~~~d~~~l~~L~~i~~~~ek~~~la~ia~  544 (992)
                                                                                                      
T Consensus       402 --------------------------------------------------------------------------------  401 (1202)
T KOG0292|consen  402 --------------------------------------------------------------------------------  401 (1202)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHhhchHHHHHHHHHhcCCcccccccchhhhHHHHHHHHHHHhccchHHHHHHHHHHHHhcchhhHHHHhhhcCCHHHH
Q psy2685         545 IRRDISGQYQAALLLGRMGRGFFLLHYFSFFFFAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGER  624 (992)
Q Consensus       545 i~~~~~~~~eaa~l~~~~g~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~r~d~~~~~~~al~lg~~~ea  624 (992)
                                                                                                      
T Consensus       402 --------------------------------------------------------------------------------  401 (1202)
T KOG0292|consen  402 --------------------------------------------------------------------------------  401 (1202)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHcCCcHHHHHHHHhcCChHHHHHHHhhcCCCCCCCCCCCCCCCccccCCCccccccCCCCCcccccchhhhhHHH
Q psy2685         625 IKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVTKKMSSVGCE  704 (992)
Q Consensus       625 i~i~~~~~~~~~A~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  704 (992)
                                                                        -..++               +..+.+.|..
T Consensus       402 --------------------------------------------------~~~~~---------------~~~~k~tG~~  416 (1202)
T KOG0292|consen  402 --------------------------------------------------GVSDG---------------KDVKKGTGEG  416 (1202)
T ss_pred             --------------------------------------------------ccCCc---------------hhhhcCCCCc
Confidence                                                              00000               1134457999


Q ss_pred             hhhhcCccee-eeeccCceeeehHHHHHHHhHhhhheeeeeeeeccccccceeeeeccccccccccccceehhhHHHHHH
Q psy2685         705 EIFYAGTGAL-LCREADHVILFDVQQKRALAQVKVAKCRHVVTKKMSSVGCEEIFYAGTGALLCREADHVILFDVQQKRA  783 (992)
Q Consensus       705 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  783 (992)
                      |+|+|||||| +.+.++++.|+|+.              |++|||++                                 
T Consensus       417 a~fvarNrfavl~k~~~~v~ik~l~--------------N~vtkkl~---------------------------------  449 (1202)
T KOG0292|consen  417 ALFVARNRFAVLDKSNEQVVIKNLK--------------NKVTKKLL---------------------------------  449 (1202)
T ss_pred             eEEEEecceEEEEecCcceEEeccc--------------chhhhccc---------------------------------
Confidence            9999999999 67779999999996              99999988                                 


Q ss_pred             HhHhhhheeccccccccceeEeeccceeEeeecCeeEEEeehhhhhhceeeeceeEEEEECCCcceeeecccceEEEecc
Q psy2685         784 LAQVKVAKCRHVLYNKGEEIFYAGTGALLCREADHVILFDVQQKRALAQVKVAKCRHVVWSPDMTHLALLSKHTLHICNR  863 (992)
Q Consensus       784 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  863 (992)
                              .+.    ++++|||||||+|||+++++|+||||||+++++++++++||||+||+||++|||||||+|+||+|
T Consensus       450 --------~~~----~~~~IF~ag~g~lll~~~~~v~lfdvQq~~~~~si~~s~vkyvvws~dm~~vAll~Kh~i~i~~k  517 (1202)
T KOG0292|consen  450 --------LPE----STDDIFYAGTGNLLLRSPDSVTLFDVQQKKKVGSIKVSKVKYVVWSNDMSRVALLSKHTITIADK  517 (1202)
T ss_pred             --------Ccc----cccceeeccCccEEEEcCCeEEEEEeecceEEEEEecCceeEEEEcCccchhhhcccceEEEEec
Confidence                    333    78999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceecc------ccc-----------cccceeeeecccc------cceeeeeeecccCCeEEEEcCCCCceEEEeCCc
Q psy2685         864 KMEGAGLM------KSD-----------VINNIDSSLAATE------VDVQGWGDDADLGNQVYYLDRECSPHVLRIDPT  920 (992)
Q Consensus       864 ~~~~~~~~------~~~-----------~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  920 (992)
                      |||.+|++      ||+           |+|||||+|.|||      ||.|+|| ++++||+||||||||+|++++||||
T Consensus       518 kL~l~~sihEtiriksgawde~gVfiYtT~nHikYal~~GD~GIikTLd~~iyi-tkv~gn~V~cl~rd~~~~~~~IDpt  596 (1202)
T KOG0292|consen  518 KLELLCSIHETIRIKSGAWDEDGVFIYTTLNHIKYALENGDSGIIKTLDKPIYI-TKVKGNKVFCLNRDGEIECLTIDPT  596 (1202)
T ss_pred             chhheecchheeEeeeceeccCceEEEEehhhhhhhhccCCcceEEecccceEE-EEeeCCEEEEEecCCCeEEEeechH
Confidence            99999987      887           9999999999999      9999999 9999999999999999999999999


Q ss_pred             chhhhhhhhhchhHHHHHhhhccccchhhHHHHHHhcCCceEEEeeeccccceEEeeeecCCcCcc
Q psy2685         921 EFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQKGYPEVALHFVKDDRTRLTLALECGNIPPH  986 (992)
Q Consensus       921 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  986 (992)
                      ||+|||||+|+||||||||||||+||||||||||||||||||||||||||+|||+|||||||||+-
T Consensus       597 Ey~FKlALi~k~ydeVl~lI~ns~LvGqaiIaYLqKkgypeiAL~FVkD~~tRF~LaLe~gnle~a  662 (1202)
T KOG0292|consen  597 EYRFKLALLNKKYDEVLHLIKNSNLVGQAIIAYLQKKGYPEIALHFVKDERTRFELALECGNLEVA  662 (1202)
T ss_pred             HHHHHHHHHhhhhHHHHHHHHhcCcccHHHHHHHHhcCCcceeeeeecCcchheeeehhcCCHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999874

>KOG0292|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15450 signal transduction protein PmrD; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF11183 PmrD: Polymyxin resistance protein PmrD; InterPro: IPR020146 The Salmonella PmrA/PmrB two-component system is required for resistance to the cationic peptide antibiotic olymyxin B, resistance to Fe(3+)-mediated killing, growth in soil, virulence in mice, and infection of chicken macrophages Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 3e-42
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 4e-42
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 2e-40
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 2e-40
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 1e-30
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 9e-26
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-25
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-25
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-06
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 3e-25
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-06
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 3e-25
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-06
2g9a_A311 Structural Basis For The Specific Recognition Of Me 3e-25
2g9a_A311 Structural Basis For The Specific Recognition Of Me 5e-06
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 3e-25
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-06
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 4e-25
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-06
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 4e-25
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-06
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 4e-25
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 6e-06
2h9l_A329 Wdr5delta23 Length = 329 4e-25
2h9l_A329 Wdr5delta23 Length = 329 6e-06
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 4e-25
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 6e-06
2g99_A308 Structural Basis For The Specific Recognition Of Me 4e-25
2g99_A308 Structural Basis For The Specific Recognition Of Me 6e-06
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 4e-25
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 6e-06
2gnq_A336 Structure Of Wdr5 Length = 336 5e-25
2gnq_A336 Structure Of Wdr5 Length = 336 7e-18
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-25
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-06
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-25
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 8e-18
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 9e-25
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 5e-06
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 9e-25
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 2e-22
3mkq_B177 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 1e-21
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-18
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-17
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-17
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-17
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-16
3zey_7318 High-resolution Cryo-electron Microscopy Structure 1e-06
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 5e-13
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-08
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 6e-13
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-08
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-13
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-08
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 7e-13
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-08
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 7e-13
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-08
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 2e-12
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 8e-08
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 5e-11
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 4e-08
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-10
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-10
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-10
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 3e-10
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 3e-09
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 9e-06
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 1e-09
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 2e-09
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 3e-09
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 1e-07
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 7e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 4e-09
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 4e-09
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 5e-09
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 7e-09
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 2e-06
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 9e-09
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 1e-08
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-08
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 2e-08
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 8e-07
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-07
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 9e-06
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 2e-07
1r5m_A425 Crystal Structure Of The C-Terminal Wd40 Domain Of 3e-07
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 3e-07
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 3e-07
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 3e-07
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 2e-06
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-06
3jpx_A402 Eed: A Novel Histone Trimethyllysine Binder Within 7e-06
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 7e-06
3jzn_A366 Structure Of Eed In Apo Form Length = 366 9e-06
2qxv_A361 Structural Basis Of Ezh2 Recognition By Eed Length 9e-06
3iiw_A365 Crystal Structure Of Eed In Complex With A Trimethy 1e-05
3iiy_A365 Crystal Structure Of Eed In Complex With A Trimethy 1e-05
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 3e-05
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 3e-05
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 8e-04
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure 
Iteration: 1

 Score =  170 bits (431), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 158/326 (48%), Gaps = 38/326 (11%)
Query: 5   FETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQP 64
           F  +S RVKG+ FHP  PW+L++L++G +++W+Y     +      E PVR   F  ++ 
Sbjct: 9   FSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKN 68
Query: 65  IFVSGGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQS 124
             + G DD++I+V+NY   + +     H DYIR+   H   P++LS SDD T+++WNW++
Sbjct: 69  WIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWEN 128
Query: 125 RNCI-CVLTGHNHYVMCAQFHPTD-DIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQ 182
              +     GH H+VMC  F+P D     S  LD+T++VW + G    N     G +   
Sbjct: 129 NWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL-GQSTPNFTLTTGQE--- 184
Query: 183 IKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPKSE--VIVSNAEDKSIRLWDMTKRTCLNT 240
                            RG    V+ V ++P  +   +++ ++D +I++WD   ++C+ T
Sbjct: 185 -----------------RG----VNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVAT 223
Query: 241 FRREQERFWSEV-------IVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPT-- 291
                      V       I+S +ED ++++W+ +      T     ER W +  HPT  
Sbjct: 224 LEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGR 283
Query: 292 LNLFAAGHDAGMVVFKFERERPAYTV 317
            N  A+G D G  V     + P  ++
Sbjct: 284 KNYIASGFDNGFTVLSLGNDEPTLSL 309
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3MKQ|B Chain B, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 177 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|1R5M|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Sif2 Length = 425 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query992
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.98
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.98
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.98
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3jro_A753 Fusion protein of protein transport protein SEC13 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.94
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.94
3jro_A753 Fusion protein of protein transport protein SEC13 99.94
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.94
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.93
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.92
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.9
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.88
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.88
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.88
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.86
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.85
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.84
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.84
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.82
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.81
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.81
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.81
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.81
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.79
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.79
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.78
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.78
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.78
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.77
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.77
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.75
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.75
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.75
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.72
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.72
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.72
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.68
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.68
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.68
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.67
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.66
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.66
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.64
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.64
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.63
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.6
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.59
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.59
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.58
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.58
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.57
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.57
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.54
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.53
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.51
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.5
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.47
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.46
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.46
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.46
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.43
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.41
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.41
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.41
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.41
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.4
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.38
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.35
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.35
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.33
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.29
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.29
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.29
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.28
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.26
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.25
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.25
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.25
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.25
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.23
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.22
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.2
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.13
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.13
2qe8_A343 Uncharacterized protein; structural genomics, join 99.12
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.12
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.1
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.09
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.03
4a2l_A795 BT_4663, two-component system sensor histidine kin 99.03
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.02
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.0
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.94
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.89
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.89
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.87
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.87
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.87
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.85
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.85
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.85
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.85
2ece_A462 462AA long hypothetical selenium-binding protein; 98.84
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.83
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.82
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.82
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.8
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.77
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.77
2qe8_A343 Uncharacterized protein; structural genomics, join 98.72
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.71
2ece_A462 462AA long hypothetical selenium-binding protein; 98.67
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.67
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.6
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.58
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.5
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.5
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.48
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.48
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.39
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.39
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.39
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.37
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.34
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.34
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.29
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.28
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.27
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.26
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.25
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.23
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.21
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.2
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.18
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.16
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.15
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.12
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.09
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.08
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.06
3v65_B386 Low-density lipoprotein receptor-related protein; 98.05
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.05
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.05
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.02
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.01
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.01
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.95
3v65_B386 Low-density lipoprotein receptor-related protein; 97.93
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.93
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.92
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.86
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.79
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.78
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.75
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.72
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.7
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.66
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.64
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.62
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.56
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.54
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.52
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.48
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.45
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.41
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.37
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.3
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.27
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.26
3kya_A496 Putative phosphatase; structural genomics, joint c 97.21
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.19
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.17
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.93
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.92
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.83
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.77
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.7
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.69
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.68
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.6
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.55
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.55
3kya_A496 Putative phosphatase; structural genomics, joint c 96.52
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.06
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 95.98
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 95.97
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.88
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.75
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.6
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.55
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.45
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.41
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 95.29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.2
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.16
3ott_A758 Two-component system sensor histidine kinase; beta 94.88
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.79
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.53
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.28
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.04
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 93.95
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 93.94
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 93.93
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 93.88
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.68
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.6
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 93.45
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.44
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.23
3ott_A758 Two-component system sensor histidine kinase; beta 92.85
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 92.51
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 91.95
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 91.67
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 91.41
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 91.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 91.33
3u4t_A272 TPR repeat-containing protein; structural genomics 91.31
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 91.09
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 90.94
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 90.85
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 90.69
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 90.67
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 90.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 90.36
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 90.3
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 90.19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 90.17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 90.14
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.02
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 89.81
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 89.75
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 89.67
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 89.45
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 89.36
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 89.16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 89.15
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 88.98
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 88.83
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 88.76
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 88.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 88.67
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 88.53
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 88.52
2jso_A88 Polymyxin resistance protein PMRD; antibiotic resi 88.52
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 88.47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 88.4
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 88.26
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 88.24
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 88.04
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 87.74
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 87.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 87.71
2rqx_A89 PMRD, polymyxin B resistance protein; signaling pr 87.47
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 87.46
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 87.42
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 87.35
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 87.09
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 87.04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 86.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 86.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 86.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 86.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 86.7
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 86.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 86.56
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 86.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 86.25
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 86.03
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 85.97
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 85.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 85.78
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 85.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 85.53
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 85.46
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 85.0
3u4t_A272 TPR repeat-containing protein; structural genomics 84.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 84.76
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 84.61
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 84.57
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 84.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 84.37
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 84.22
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 84.04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 83.92
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 83.86
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 83.74
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 83.7
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 83.65
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 83.59
4i17_A228 Hypothetical protein; TPR repeats protein, structu 83.41
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 83.35
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 83.12
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 82.61
3q15_A378 PSP28, response regulator aspartate phosphatase H; 82.39
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 82.23
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 82.15
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 81.57
4i17_A228 Hypothetical protein; TPR repeats protein, structu 81.39
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 80.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 80.02
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
Probab=100.00  E-value=1.2e-57  Score=573.36  Aligned_cols=549  Identities=23%  Similarity=0.454  Sum_probs=440.0

Q ss_pred             cEEeecCCCCEEEEEEcCCCCEEEEEEcCCeEEEEEcCCCeEEEEeccCCCCEEEEEEecCCCEEEEEECCCeEEEEEcC
Q psy2685           2 LTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYK   81 (992)
Q Consensus         2 l~~l~~H~~~V~~iafspdg~~Lasg~~dg~I~IWd~~~g~~~~~~~~h~~~V~~l~fspdg~~Lasgs~Dg~I~VWd~~   81 (992)
                      .++|++|+++|++++|||++++|++|+.+|.|++||+.+++.+..+..|.++|++++|+|++++|++|+.||.|++||+.
T Consensus         6 ~~~~~~h~~~v~~i~~sp~~~~la~~~~~g~v~iwd~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~vw~~~   85 (814)
T 3mkq_A            6 KKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYN   85 (814)
T ss_dssp             EEEEEEECSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEEETT
T ss_pred             ceeeecCCCceEEEEECCCCCEEEEEeCCCEEEEEECCCCceEEEEecCCCcEEEEEEeCCCCEEEEEeCCCeEEEEECC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEEccCCCCEEEEEEecCCCEEEEEECCCeEEEEECCCC-eeEEEEecCCCCeEEEEEec-CCCEEEEEECCCeE
Q psy2685          82 QRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSR-NCICVLTGHNHYVMCAQFHP-TDDIVVSASLDQTI  159 (992)
Q Consensus        82 t~~~~~~l~~h~~~V~~i~fspd~~~L~sgs~Dg~I~vwdl~t~-~~i~~l~~h~~~V~sl~fsp-dg~~L~sgs~Dg~I  159 (992)
                      +++.+..+.+|.+.|++++|+|++++|++|+.||.|++||++++ .....+.+|..+|++++|+| +++.+++++.||+|
T Consensus        86 ~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~vw~~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~~~~dg~v  165 (814)
T 3mkq_A           86 TGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTV  165 (814)
T ss_dssp             TCCEEEEEECCSSCEEEEEECSSSSEEEEEETTSEEEEEEGGGTSEEEEEEECCSSCEEEEEEETTEEEEEEEEETTSEE
T ss_pred             CCcEEEEEecCCCCEEEEEEeCCCCEEEEEcCCCEEEEEECCCCceEEEEEcCCCCcEEEEEEEcCCCCEEEEEeCCCeE
Confidence            99999999999999999999999999999999999999999986 77888899999999999999 78999999999999


Q ss_pred             EEEECCCCccccccCCcccCCCeEEEEEccCCcceEEEEEeccCCCeEEEEEcC--CCCEEEEEeCCCeEEEEECCCCee
Q psy2685         160 RVWDISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHP--KSEVIVSNAEDKSIRLWDMTKRTC  237 (992)
Q Consensus       160 ~iwd~~~~~~~~~~~~~~~~d~~I~iwd~~~~~~~~i~~l~~h~~~V~~v~fsp--dg~~L~s~s~Dg~I~vwdl~~~~~  237 (992)
                      ++||+.+...                         .......|...+.+++|+|  ++.++++++.||.|++||+.+++.
T Consensus       166 ~vwd~~~~~~-------------------------~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~dg~i~~~d~~~~~~  220 (814)
T 3mkq_A          166 KVWSLGQSTP-------------------------NFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSC  220 (814)
T ss_dssp             EEEETTCSSC-------------------------SEEEECCCTTCCCEEEECCSTTCCEEEEECTTSEEEEEETTTTEE
T ss_pred             EEEECCCCcc-------------------------eeEEecCCCCCEEEEEEEECCCCCEEEEEeCCCEEEEEECCCCcE
Confidence            9999875431                         1222234558899999999  999999999999999999999999


Q ss_pred             eeEeeccCcccc-------cCEEEEEeCCCeEEEEECCCCeEEEEeecCCCCEEEEEEeCCCC--EEEEEECCCEEEEEe
Q psy2685         238 LNTFRREQERFW-------SEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLN--LFAAGHDAGMVVFKF  308 (992)
Q Consensus       238 l~~~~~~~~~~~-------s~~l~sgs~Dg~I~vwd~~t~~~v~~l~~h~~~V~~la~spdg~--~Lasgsddgiivw~l  308 (992)
                      +..+..+...+.       +..+++++.||.|++||+.+++.+..+..+...+++++|+|++.  ++++|+++++.+|++
T Consensus       221 ~~~~~~~~~~v~~~~~~~~~~~l~~~~~dg~v~vwd~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~  300 (814)
T 3mkq_A          221 VATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL  300 (814)
T ss_dssp             EEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEETTTCSEEEEECCSSSSEEEEEECTTCGGGEEEEEETTEEEEEEC
T ss_pred             EEEEcCCCCCEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEeecCCCcEEEEEEccCCCceEEEEEeCCCEEEEEc
Confidence            999887766543       37899999999999999999999999999999999999999987  799999999999987


Q ss_pred             cCCcceEEee---------------------------------------------------------ccEEEEEeCCeEE
Q psy2685         309 ERERPAYTVH---------------------------------------------------------NNVMYYVKERFLH  331 (992)
Q Consensus       309 ~~~~~~~~~~---------------------------------------------------------~~~v~~~~~~~i~  331 (992)
                      ....+.....                                                         +..+....++.+.
T Consensus       301 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~spdg~~la~~~~~~~~  380 (814)
T 3mkq_A          301 GNDEPTLSLDPVGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEPLSLQTKELGSVDVFPQSLAHSPNGRFVTVVGDGEYV  380 (814)
T ss_dssp             SCCSCCEEECSSSEEEEECCTTSCTTCEEEEECCSCCCCCSSSCBCCCCEEECCCSSCCSEEEECTTSSEEEEEETTEEE
T ss_pred             CCCCceeEECCCCCEEEECcccccceeeeeeecccccccccCccceeeeecCCCCccCCceeEECCCCCEEEEecCCEEE
Confidence            6654443332                                                         2233444455566


Q ss_pred             EEEeeCCCceEEEEeecCCCccceeEEEccCCCEEEEEecCCccccCCeEEEEEeCCCcc-----------c----c---
Q psy2685         332 RLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEES-----------E----R---  393 (992)
Q Consensus       332 i~dl~~~~~~~v~~l~~~~~~~I~~lafspdg~~lav~~~~~~~~~~g~i~i~~l~~~~~-----------~----~---  393 (992)
                      +|++.....        .+...+.+++|+|+|+.+++++.+      |.+++|.......           +    .   
T Consensus       381 i~~~~~~~~--------~~~~~i~~~~~spdg~~la~~~~~------g~v~l~~~~~~~~~~v~~~~~s~dg~~~~~l~~  446 (814)
T 3mkq_A          381 IYTALAWRN--------KAFGKCQDFVWGPDSNSYALIDET------GQIKYYKNFKEVTSWSVPMHSAIDRLFSGALLG  446 (814)
T ss_dssp             EEETTTTEE--------EEEEECSEEEECTTSSCEEEECTT------CCEEEEETTEECTTCCCCCSSCCCEEECSSSEE
T ss_pred             EEECccccc--------cCCCceEEEEEeCCCCeEEEEeCC------CcEEEEECCCCccceEEcCCcCccceecceEEE
Confidence            666432111        112345667777777776666543      5566664211100           0    0   


Q ss_pred             --------------ceeccCccccceEEEEecCCeEEEEE------c-CCeEEEEEcC----------------------
Q psy2685         394 --------------KEVADGKRSTGISAVWVARNRFAVLD------R-NHTILIKNLK----------------------  430 (992)
Q Consensus       394 --------------~~~~~~~~~~~~s~~w~~~~~~av~~------~-~g~I~i~dl~----------------------  430 (992)
                                    .............+.|++++++++..      . ++.+.+|.-.                      
T Consensus       447 ~~~d~~v~~~d~~~~~~~~~~~~~~~~v~~s~dg~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  526 (814)
T 3mkq_A          447 VKSDGFVYFFDWDNGTLVRRIDVNAKDVIWSDNGELVMIVNTNSNGDEASGYTLLFNKDAYLEAANNGNIDDSEGVDEAF  526 (814)
T ss_dssp             EEETTEEEEECTTTCCEEEEESSCEEEEEECTTSSEEEEEECCCSSCSCSEEEEEECHHHHHHHHHHTCCBTTTBCTTTE
T ss_pred             EecCCEEEEEECCcCcEEEEEecCCCEEEEcCCCCEEEEEEcCcccCCceEEEEEechHHhhhhhhccCCccccchhhhe
Confidence                          00000001111256788777665555      3 2333332100                      


Q ss_pred             -------Ccc---cccc-------c-------------------------------------------------------
Q psy2685         431 -------NEY---LWRM-------G-------------------------------------------------------  438 (992)
Q Consensus       431 -------~~~---~W~~-------~-------------------------------------------------------  438 (992)
                             ...   .|+.       .                                                       
T Consensus       527 ~~~~~~~~~i~s~~w~~~~~i~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~~~~~~~l~~~~~~~  606 (814)
T 3mkq_A          527 DVLYELSESITSGKWVGDVFIFTTATNRLNYFVGGKTYNLAHYTKEMYLLGYLARDNKVYLADREVHVYGYEISLEVLEF  606 (814)
T ss_dssp             EEEEEECSCCSEEEEETTEEEEECTTSEEEEEETTEEEEEEECSSCCEEEEEEGGGTEEEEECTTCCEEEEECCHHHHHH
T ss_pred             eeeeEeccEEEeeEEeCCEEEEEcCCCeEEEEeCCeeEEEEECCccEEEEEEEecCCEEEEEcCCCCEEEEEECcHHHHH
Confidence                   000   0210       0                                                       


Q ss_pred             -----cchhhc----cc---c----------ccccCCccceeccccccccceeeceeccCCHHHHHHHHHhcCChHHHHH
Q psy2685         439 -----NDRQES----AL---C----------GWPGTGYPEVALHFVKDDRTRLTLALECGNIDIALEAARVLEDKSVWER  496 (992)
Q Consensus       439 -----~~~l~~----ll---~----------gL~~~g~~~~al~~~~d~~~~F~~aL~~g~ldeA~~~a~~i~~~~~W~~  496 (992)
                           +.+++.    ++   .          +++++++++.++++++++..+|++++++|+|++|+++++.++++++|++
T Consensus       607 ~~~~~~~~~~~a~~~~l~~i~~~~~~~~~~~~l~~~~~~~~a~~~~~~~~~~f~~~l~~~~~~~A~~~~~~~~~~~~W~~  686 (814)
T 3mkq_A          607 QTLTLRGEIEEAIENVLPNVEGKDSLTKIARFLEGQEYYEEALNISPDQDQKFELALKVGQLTLARDLLTDESAEMKWRA  686 (814)
T ss_dssp             HHHHHTTCHHHHHHHTGGGCCCHHHHHHHHHHHHHTTCHHHHHHHCCCHHHHHHHHHHHTCHHHHHHHHTTCCCHHHHHH
T ss_pred             hHHHHhCCHHHHHHHHHhcCCchHHHHHHHHHHHhCCChHHheecCCCcchheehhhhcCCHHHHHHHHHhhCcHhHHHH
Confidence                 000000    11   0          1345566677788888899999999999999999999999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHccCcchHHHHHHHhCCHHHHHHHHHHHHHHHhhchHHHHHHHHHhcCCcccccccchhhh
Q psy2685         497 LGHAALMQGNHQIVEMCYQRTKNFDKLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGRMGRGFFLLHYFSFFF  576 (992)
Q Consensus       497 LA~~AL~~~~l~iAe~aY~~~~d~~~l~~L~~i~~~~ek~~~la~ia~i~~~~~~~~eaa~l~~~~g~~~~al~~~~~~~  576 (992)
                      ||++|++++++++|++||++++|++++.+||.+.++.+++.++++++                                 
T Consensus       687 la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~~~~~~~~~~~~~a---------------------------------  733 (814)
T 3mkq_A          687 LGDASLQRFNFKLAIEAFTNAHDLESLFLLHSSFNNKEGLVTLAKDA---------------------------------  733 (814)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHH---------------------------------
T ss_pred             HHHHHHHcCCHHHHHHHHHHccChhhhHHHHHHcCCHHHHHHHHHHH---------------------------------
Confidence            99999999999999999999999999999999999999999998888                                 


Q ss_pred             HHHHHHHHHHHhccchHHHHHHHHHHHHhcchhhHHHHhhhcCCHHHHHHHHHHcCCcHHHHHHHHhcCChH
Q psy2685         577 FAFLRLAFLYLITGNLEKLKKMMKIAEIRRDISGQYQAALLLGEVGERIKILKSCGQTSLAYLTAATHGLSE  648 (992)
Q Consensus       577 ~~~~~~~~~~~~~~~~~~~~~~~~~~e~r~d~~~~~~~al~lg~~~eai~i~~~~~~~~~A~~~A~~~~~~~  648 (992)
                                                +.++++..++++++++|++++|+++|.++++|++|+.+|++|++++
T Consensus       734 --------------------------~~~~~~~~A~~~~~~~g~~~~a~~~~~~~~~~~~A~~lA~~~~~~~  779 (814)
T 3mkq_A          734 --------------------------ETTGKFNLAFNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGD  779 (814)
T ss_dssp             --------------------------HHTTCHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHTTCCH
T ss_pred             --------------------------HHcCchHHHHHHHHHcCCHHHHHHHHHHcCChHHHHHHHHHhCCCh
Confidence                                      7788888899999999999999999999999999999999999888
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2jso_A Polymyxin resistance protein PMRD; antibiotic resistance, transcription, signaling Pro; NMR {Escherichia coli} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2rqx_A PMRD, polymyxin B resistance protein; signaling protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 992
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-40
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-31
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-29
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-27
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-23
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-25
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-24
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-20
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-25
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-11
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-22
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-22
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-21
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-15
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-12
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-20
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-18
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-16
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-13
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 9e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-17
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-17
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-15
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-16
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-15
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-16
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-15
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-10
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-14
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-12
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-14
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-12
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-13
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 9e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-12
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-11
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-10
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-08
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-10
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-04
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.004
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-09
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-06
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.003
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-09
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 6e-07
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 1e-06
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 2e-05
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  149 bits (376), Expect = 2e-40
 Identities = 71/305 (23%), Positives = 123/305 (40%), Gaps = 13/305 (4%)

Query: 9   SARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVS 68
            + V  + FHP    ++S+  +  I++WDY           H   V+ I F +   +  S
Sbjct: 17  RSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLAS 76

Query: 69  GGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCI 128
              D  IK+W+++  +CI T+ GH   + +         I+SAS D+TI++W  Q+  C+
Sbjct: 77  CSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCV 136

Query: 129 CVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGADDRQIKLWRM 188
              TGH  +V   + +    ++ S S DQT+RVW ++    K            I     
Sbjct: 137 KTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPE 196

Query: 189 NDSKAWEVDIFRGHYNNVSCVLFHPKSEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERF 248
           +   +                        ++S + DK+I++WD++   CL T        
Sbjct: 197 SSYSSI------SEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWV 250

Query: 249 WS-------EVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLFAAGHDA 301
                    + I+S A+DK++R+WD   + C+ T    +     L  H T      G   
Sbjct: 251 RGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVD 310

Query: 302 GMVVF 306
             V  
Sbjct: 311 QTVKV 315
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query992
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.98
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.98
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.9
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.89
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.87
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.83
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.82
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.78
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.77
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.77
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.7
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.69
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.63
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.61
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.53
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.53
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.36
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.25
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.24
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.19
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.96
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.85
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.85
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.82
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.77
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.75
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.69
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.67
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.64
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.62
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.53
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.52
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.42
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.37
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.26
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.22
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.08
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.04
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.61
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.6
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.57
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.34
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.12
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.04
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.0
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.98
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.9
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.73
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.69
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.57
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.43
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.2
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.03
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.94
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.84
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.28
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.61
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.61
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 94.31
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.13
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.42
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 91.91
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 91.8
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.31
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.17
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 89.96
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.34
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 89.07
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 88.99
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 87.8
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 87.6
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 85.56
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 84.12
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 84.11
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 83.85
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 83.68
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 83.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 83.44
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 82.09
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 81.67
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 80.05
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=3.8e-35  Score=317.36  Aligned_cols=279  Identities=27%  Similarity=0.523  Sum_probs=256.9

Q ss_pred             EEeecCCCCEEEEEEcCCCCEEEEEEcCCeEEEEEcCCCeEEEEeccCCCCEEEEEEecCCCEEEEEECCCeEEEEEcCC
Q psy2685           3 TKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGDDYKIKVWNYKQ   82 (992)
Q Consensus         3 ~~l~~H~~~V~~iafspdg~~Lasg~~dg~I~IWd~~~g~~~~~~~~h~~~V~~l~fspdg~~Lasgs~Dg~I~VWd~~t   82 (992)
                      .+|+||+++|++++|+|++++|++|+.||+|+|||+++++.+.++.+|.+.|.+++|+|++..+++++.++.+.+|+...
T Consensus        11 ~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~   90 (317)
T d1vyhc1          11 YALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG   90 (317)
T ss_dssp             CEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETTS
T ss_pred             EEEcCCCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeecccccccccccccccccccccc
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEEEEEccCCCCEEEEEEecCCCEEEEEECCCeEEEEECCCCeeEEEEecCCCCeEEEEEecCCCEEEEEECCCeEEEE
Q psy2685          83 RKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVW  162 (992)
Q Consensus        83 ~~~~~~l~~h~~~V~~i~fspd~~~L~sgs~Dg~I~vwdl~t~~~i~~l~~h~~~V~sl~fspdg~~L~sgs~Dg~I~iw  162 (992)
                      .+....+.+|...+.++.|+|+++.+++++.|+.+++||+++++.+..+.+|...+.+++|+|+++++++++.|+.|++|
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~d~~v~~~  170 (317)
T d1vyhc1          91 FECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVW  170 (317)
T ss_dssp             SCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEEEE
T ss_pred             cccccccccccccceeeeccCCCceEEeeccCcceeEeecccceeeeEEccCCCcceeeecccCCCEEEEEeCCCeEEEE
Confidence            99888889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ECCCCccccccCCcccCCCeEEEEEccCCcceEEEEEeccCCCeEEEEEcCC--------------------CCEEEEEe
Q psy2685         163 DISGLRKKNVAPGMGADDRQIKLWRMNDSKAWEVDIFRGHYNNVSCVLFHPK--------------------SEVIVSNA  222 (992)
Q Consensus       163 d~~~~~~~~~~~~~~~~d~~I~iwd~~~~~~~~i~~l~~h~~~V~~v~fspd--------------------g~~L~s~s  222 (992)
                      +.....                          ....+.+|...+.++.|+|+                    +.++++++
T Consensus       171 ~~~~~~--------------------------~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  224 (317)
T d1vyhc1         171 VVATKE--------------------------CKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGS  224 (317)
T ss_dssp             ETTTCC--------------------------EEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEE
T ss_pred             eeccce--------------------------eeEEEecCCCCceEEEEeeccccceeeccccceeeeeccCCceeEecc
Confidence            987643                          44556677777888887764                    35789999


Q ss_pred             CCCeEEEEECCCCeeeeEeeccCcccc-------cCEEEEEeCCCeEEEEECCCCeEEEEeecCCCCEEEEEEeCCCCEE
Q psy2685         223 EDKSIRLWDMTKRTCLNTFRREQERFW-------SEVIVSNAEDKSIRLWDMTKRTCLNTFRREQERFWVLVAHPTLNLF  295 (992)
Q Consensus       223 ~Dg~I~vwdl~~~~~l~~~~~~~~~~~-------s~~l~sgs~Dg~I~vwd~~t~~~v~~l~~h~~~V~~la~spdg~~L  295 (992)
                      .|+.|++||..+++++.++..|...+.       +.++++++.||.|++||+.+++++.++.+|.+.|++++|+|++++|
T Consensus       225 ~d~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~~~~l  304 (317)
T d1vyhc1         225 RDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYV  304 (317)
T ss_dssp             TTSEEEEEETTTTEEEEEEECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSSCE
T ss_pred             CCCEEEEEECCCCcEEEEEeCCCCCEEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEcCCCCCEEEEEEcCCCCEE
Confidence            999999999999999999988876653       3789999999999999999999999999999999999999999999


Q ss_pred             EEEECCCEE-EEE
Q psy2685         296 AAGHDAGMV-VFK  307 (992)
Q Consensus       296 asgsddgii-vw~  307 (992)
                      ++|+.|+.+ +|+
T Consensus       305 ~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         305 VTGSVDQTVKVWE  317 (317)
T ss_dssp             EEEETTSEEEEEC
T ss_pred             EEEeCCCeEEEeC
Confidence            999988754 563
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure