Psyllid ID: psy2733
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 644 | ||||||
| 242021591 | 945 | ubiquitin ligase protein MIB2, putative | 0.736 | 0.501 | 0.356 | 2e-79 | |
| 391326093 | 942 | PREDICTED: E3 ubiquitin-protein ligase M | 0.731 | 0.5 | 0.332 | 1e-68 | |
| 242276482 | 996 | skeletrophin, putative [Ixodes scapulari | 0.690 | 0.446 | 0.334 | 5e-68 | |
| 183986655 | 951 | mindbomb E3 ubiquitin protein ligase 2 [ | 0.731 | 0.495 | 0.304 | 9e-63 | |
| 189217724 | 916 | uncharacterized protein LOC100158387 [Xe | 0.734 | 0.516 | 0.290 | 3e-61 | |
| 410899010 | 959 | PREDICTED: E3 ubiquitin-protein ligase M | 0.722 | 0.484 | 0.297 | 4e-61 | |
| 432864376 | 1049 | PREDICTED: E3 ubiquitin-protein ligase M | 0.725 | 0.445 | 0.296 | 4e-61 | |
| 326932344 | 744 | PREDICTED: e3 ubiquitin-protein ligase M | 0.729 | 0.631 | 0.290 | 3e-60 | |
| 57529411 | 954 | E3 ubiquitin-protein ligase MIB2 [Gallus | 0.731 | 0.493 | 0.287 | 2e-59 | |
| 449486907 | 954 | PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu | 0.734 | 0.495 | 0.283 | 2e-58 |
| >gi|242021591|ref|XP_002431228.1| ubiquitin ligase protein MIB2, putative [Pediculus humanus corporis] gi|212516477|gb|EEB18490.1| ubiquitin ligase protein MIB2, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 303 bits (775), Expect = 2e-79, Method: Compositional matrix adjust.
Identities = 188/527 (35%), Positives = 286/527 (54%), Gaps = 53/527 (10%)
Query: 1 KTLLHILAYQGCVEELNILLARGACVYYPDDAGDTALHYAAFGNKPDAIQIN-SHVSGAN 59
KT L + +QG E + L+ GA + D GDTALHY+AFG++ + + I H + N
Sbjct: 467 KTCLQVACHQGHKEIVQFLIESGADLLIADQDGDTALHYSAFGDQAEVMDILLRHGAEIN 526
Query: 60 RSRKHIYKERHRTVTTEKVQRPSNLPKVEPETPMLNMKFIPRMNEDMLDTPSAECSGILI 119
+ + H V + VQ +
Sbjct: 527 SLNRGLCSALHIAVNKQHVQ--------------------------------------CV 548
Query: 120 KQDFVLLRNGCNVNIQDNNQDTPMHDAVAKGFEEIQLLLLSHPEVNLYLENSKGFNILNY 179
++ LL+ CNVNIQD+ DT +HDA+ K EI LL S+ V+ L+N++GFN+L+
Sbjct: 549 RK---LLQYKCNVNIQDSYGDTALHDAIGKDNVEITDLLCSYQGVDFTLKNNRGFNVLHQ 605
Query: 180 AVLRGNMKVTEKILALNRNLATVPKTSDGFTPLHVACFNDHIEIVELLVEKYKVNINALD 239
A L+GN TEK+L+ R L V K DGF LH+AC N H + E L+ + + +IN +
Sbjct: 606 AALKGNNVATEKLLSKTRQLVDVKK-DDGFAALHLACLNGHKMVAETLLIQGQADINLQN 664
Query: 240 LKKRTPLMAAVGQGQTSVINYLMLRDVALDIQDIDGNGLLHFLFIKKNFYKTPITREKSV 299
+K+T L+ A QG+ S++ L+ + + D D LH + +K+ + I +S
Sbjct: 665 NRKQTSLLLAASQGRCSIVELLISMKADIHVVDEDKETALHLVLLKRGSINSEIVELESP 724
Query: 300 PIYEEYLSVGGPSNEHGILLAVFLFLVKHGAPLSLENNNRQKPLDLILEDTSLLNEIMEH 359
IY + + +EH I +A+ +LV G L+L+N+ + PLDL+ ED S+ I
Sbjct: 725 KIYGIHAQIVDLVSEHSIAIAIACYLVLEGCSLTLQNSRGKTPLDLV-EDKSVQVLI--- 780
Query: 360 AREYVT-DLTNENNKVVTAISQLALDEKLLARRSSCQN--VPVECAVCSELGVANVLLKP 416
+ YVT E+ ++ + ++ + +E + + +N PVEC+VCSE+ NVL +P
Sbjct: 781 -QSYVTLKKMREDAAILNSSTRNSSEESSNEQSNKNENHYSPVECSVCSEIADQNVLFEP 839
Query: 417 CNHAVACEECSSRMKKCIMCKTFIEMRVTTDGRMVPGIERCDKSKIERVNYLESKISEIE 476
C H +ACE+C+SR+KKC+ C I R++ DG+++P R + +R+ YLE+KI EIE
Sbjct: 840 CGHKIACEDCASRVKKCLKCGCLISKRISVDGKIIPCKSR--QPSADRLRYLETKIQEIE 897
Query: 477 EMNTCTICMERCRNTIFLCGHGTCDVCAKTLKFCHMCRKLIEQRINI 523
E CTICMER RN FLCGH TC+ C+ TLK C MCRK I ++IN+
Sbjct: 898 ESLDCTICMERNRNVAFLCGHRTCEECSLTLKVCPMCRKTITKKINL 944
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|391326093|ref|XP_003737559.1| PREDICTED: E3 ubiquitin-protein ligase MIB2-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|242276482|ref|XP_002404176.2| skeletrophin, putative [Ixodes scapularis] gi|215491507|gb|EEC01148.1| skeletrophin, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|183986655|ref|NP_001116916.1| mindbomb E3 ubiquitin protein ligase 2 [Xenopus (Silurana) tropicalis] gi|170284530|gb|AAI61083.1| mib2 protein [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|189217724|ref|NP_001121303.1| uncharacterized protein LOC100158387 [Xenopus laevis] gi|115528808|gb|AAI24958.1| LOC100158387 protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|410899010|ref|XP_003962990.1| PREDICTED: E3 ubiquitin-protein ligase MIB2-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|432864376|ref|XP_004070291.1| PREDICTED: E3 ubiquitin-protein ligase MIB2-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|326932344|ref|XP_003212279.1| PREDICTED: e3 ubiquitin-protein ligase MIB2-like [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
| >gi|57529411|ref|NP_001006301.1| E3 ubiquitin-protein ligase MIB2 [Gallus gallus] gi|68565462|sp|Q5ZIJ9.1|MIB2_CHICK RecName: Full=E3 ubiquitin-protein ligase MIB2; AltName: Full=Mind bomb homolog 2 gi|53135643|emb|CAG32444.1| hypothetical protein RCJMB04_25j24 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|449486907|ref|XP_004174809.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase MIB2 [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 644 | ||||||
| UNIPROTKB|F1NSA9 | 954 | MIB2 "E3 ubiquitin-protein lig | 0.638 | 0.430 | 0.298 | 8.4e-66 | |
| UNIPROTKB|Q5ZIJ9 | 954 | MIB2 "E3 ubiquitin-protein lig | 0.638 | 0.430 | 0.298 | 8.4e-66 | |
| UNIPROTKB|E1BU56 | 956 | MIB2 "E3 ubiquitin-protein lig | 0.638 | 0.429 | 0.298 | 8.6e-66 | |
| ZFIN|ZDB-GENE-050628-1 | 999 | mib2 "mind bomb 2" [Danio reri | 0.614 | 0.396 | 0.323 | 5.1e-58 | |
| FB|FBgn0086442 | 1049 | mib2 "mind bomb 2" [Drosophila | 0.330 | 0.203 | 0.344 | 3.6e-57 | |
| UNIPROTKB|D4A3U6 | 948 | LOC474147 "Protein LOC474147" | 0.616 | 0.418 | 0.319 | 3.1e-48 | |
| RGD|1359469 | 971 | Mib2 "mindbomb E3 ubiquitin pr | 0.616 | 0.408 | 0.319 | 3.4e-48 | |
| UNIPROTKB|Q68LP1 | 971 | Mib2 "E3 ubiquitin-protein lig | 0.616 | 0.408 | 0.319 | 3.4e-48 | |
| MGI|MGI:2679684 | 973 | Mib2 "mindbomb homolog 2 (Dros | 0.616 | 0.408 | 0.314 | 9.3e-48 | |
| UNIPROTKB|H0YAM8 | 829 | MIB2 "E3 ubiquitin-protein lig | 0.610 | 0.474 | 0.302 | 2.7e-47 |
| UNIPROTKB|F1NSA9 MIB2 "E3 ubiquitin-protein ligase MIB2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 578 (208.5 bits), Expect = 8.4e-66, Sum P(2) = 8.4e-66
Identities = 130/436 (29%), Positives = 233/436 (53%)
Query: 105 DMLDTPSAECSG--ILIKQDFV-----LLRNGCNVNIQDNNQDTPMHDAVAKGFEEIQLL 157
D+L+ +A+C+ + + Q F L C+VN+ D++ DTP+H A+ ++ I +
Sbjct: 525 DLLN--NAKCTALYVAVSQGFTEVVQALCELNCDVNLPDSHGDTPLHYAITADYKVIIEI 582
Query: 158 LLSHPEVNLYLENSKGFNILNYAVLRGNMKVTEKILALNRNLATVPKTSDGFTPLHVACF 217
L P ++ ++N +GFN+L+Y+ L+GN +KILA R L K DGFT LH+A
Sbjct: 583 LTEVPNIDFTVQNCQGFNLLHYSALKGNKLAIKKILARARQLVD-SKKEDGFTALHLAAL 641
Query: 218 NDHIEIVELLVEKYKVNINALDLKKRTPLMAAVGQGQTSVINYLMLRDVALDIQDIDGNG 277
N+H E+ E+L+++ + ++N + + +TPL A+ QG ++ L+ ++ +D DG+
Sbjct: 642 NNHKEVAEILIKEGRCDVNVKNNRNQTPLHLAIIQGHVGLVQLLVSEGSDVNAEDEDGDT 701
Query: 278 LLHFLFIKKNFYKTPITR---EKSVPIYEEYLSVGGPSN-EHGILLAVFLFLVKHGAPLS 333
+H ++ + + E ++ + + G N E + A+ +L + GA ++
Sbjct: 702 AMHIALERQQLMSVLMEKREGEMGSSLFSKLQASGFLGNVELNVGTAIACYLAQEGADIN 761
Query: 334 LENNNRQKPLDLILED--TSLLNEIMEHAREYVTDLTNENNKVVTAISQLALDEKLLARR 391
N+ + PLDLI + ++ + + RE ++++ + + ++ ++ +
Sbjct: 762 YANHRGKSPLDLITDGRIVQIIKDFSQKFREQ--QVSSDCSAITCSLRRVHTTPNTMTNL 819
Query: 392 S-SCQNVPVECAVCSELGVANVLLKPCNHAVACEECSSRMKKCIMCKTFIEMRVTTDGRM 450
S S VP EC VCSEL + + PC H++ CEECS RMKKCI C+ I ++ D
Sbjct: 820 SVSSVAVPTECLVCSELALL-IHFFPCQHSIVCEECSRRMKKCIKCQVTITKKLKQDSTE 878
Query: 451 V---PGIERCDKSKIERVNYLESKISEIEEMNTCTICMERCRNTIFLCGHGTCDVCAKTL 507
V P E D+ K+ + L+++ ++EE TC IC++ +F CGHG+C C+ L
Sbjct: 879 VECSPSSESTDQRKL--MEELQNRYRQMEERITCPICIDDQIKLVFQCGHGSCPDCSTAL 936
Query: 508 KFCHMCRKLIEQRINI 523
C +CR+ I +RI I
Sbjct: 937 TVCPICRQAIRERIQI 952
|
|
| UNIPROTKB|Q5ZIJ9 MIB2 "E3 ubiquitin-protein ligase MIB2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BU56 MIB2 "E3 ubiquitin-protein ligase MIB2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050628-1 mib2 "mind bomb 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0086442 mib2 "mind bomb 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A3U6 LOC474147 "Protein LOC474147" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1359469 Mib2 "mindbomb E3 ubiquitin protein ligase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q68LP1 Mib2 "E3 ubiquitin-protein ligase MIB2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2679684 Mib2 "mindbomb homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YAM8 MIB2 "E3 ubiquitin-protein ligase MIB2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 644 | |||
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 6e-21 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-20 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 7e-17 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-15 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-13 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 7e-10 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-09 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-09 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 4e-09 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-08 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-08 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 2e-08 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 3e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-07 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 8e-07 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 1e-06 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 3e-06 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 4e-06 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-05 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 1e-05 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-05 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 3e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 3e-05 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 5e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 8e-05 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 8e-05 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-04 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 2e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 2e-04 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-04 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 5e-04 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 7e-04 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 0.001 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 0.001 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 0.002 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 0.002 | |
| TIGR00870 | 743 | TIGR00870, trp, transient-receptor-potential calci | 0.003 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Score = 88.6 bits (220), Expect = 6e-21
Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 3/111 (2%)
Query: 170 NSKGFNILNYAVLRGNMKVTEKILALNRNLATVPKTSDGFTPLHVACFNDHIEIVELLVE 229
+ G L+ A G+++V + +L ++ K +DG TPLH+A N H+EIV+LL+E
Sbjct: 4 DEDGRTPLHLAASNGHLEVVKLLLENGADVNA--KDNDGRTPLHLAAKNGHLEIVKLLLE 61
Query: 230 KYKVNINALDLKKRTPLMAAVGQGQTSVINYLMLRDVALDIQDIDGNGLLH 280
K ++NA D TPL A G V+ L+ ++ +D DG LH
Sbjct: 62 K-GADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLH 111
|
The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 644 | |||
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| KOG0510|consensus | 929 | 100.0 | ||
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| KOG0510|consensus | 929 | 100.0 | ||
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 100.0 | |
| KOG4412|consensus | 226 | 100.0 | ||
| KOG4177|consensus | 1143 | 100.0 | ||
| PHA02798 | 489 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4412|consensus | 226 | 100.0 | ||
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| KOG4177|consensus | 1143 | 100.0 | ||
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.98 | |
| KOG0508|consensus | 615 | 99.98 | ||
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.97 | |
| KOG0509|consensus | 600 | 99.97 | ||
| KOG0509|consensus | 600 | 99.96 | ||
| KOG0508|consensus | 615 | 99.96 | ||
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.94 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.93 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.93 | |
| KOG4369|consensus | 2131 | 99.93 | ||
| KOG0502|consensus | 296 | 99.92 | ||
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.91 | |
| KOG0507|consensus | 854 | 99.91 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.91 | |
| KOG0502|consensus | 296 | 99.89 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.89 | |
| KOG0507|consensus | 854 | 99.88 | ||
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.88 | |
| KOG0505|consensus | 527 | 99.88 | ||
| KOG0514|consensus | 452 | 99.86 | ||
| KOG0514|consensus | 452 | 99.85 | ||
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.84 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.83 | |
| KOG4369|consensus | 2131 | 99.83 | ||
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.8 | |
| KOG0505|consensus | 527 | 99.79 | ||
| PHA02741 | 169 | hypothetical protein; Provisional | 99.79 | |
| KOG0512|consensus | 228 | 99.79 | ||
| PHA02741 | 169 | hypothetical protein; Provisional | 99.78 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.78 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.76 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.76 | |
| KOG0512|consensus | 228 | 99.75 | ||
| KOG0195|consensus | 448 | 99.69 | ||
| KOG0195|consensus | 448 | 99.68 | ||
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.67 | |
| KOG3676|consensus | 782 | 99.65 | ||
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.63 | |
| KOG3676|consensus | 782 | 99.59 | ||
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.58 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.57 | |
| KOG4214|consensus | 117 | 99.44 | ||
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.42 | |
| KOG4214|consensus | 117 | 99.41 | ||
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.4 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.34 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.33 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.31 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.3 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.27 | |
| KOG1710|consensus | 396 | 99.26 | ||
| KOG1710|consensus | 396 | 99.23 | ||
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.21 | |
| KOG4172|consensus | 62 | 99.11 | ||
| KOG0515|consensus | 752 | 99.11 | ||
| KOG0515|consensus | 752 | 99.11 | ||
| KOG4275|consensus | 350 | 98.96 | ||
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.85 | |
| KOG0783|consensus | 1267 | 98.68 | ||
| KOG0783|consensus | 1267 | 98.61 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.51 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.51 | |
| KOG0818|consensus | 669 | 98.49 | ||
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.49 | |
| KOG4265|consensus | 349 | 98.48 | ||
| KOG0506|consensus | 622 | 98.45 | ||
| KOG0818|consensus | 669 | 98.45 | ||
| KOG0320|consensus | 187 | 98.42 | ||
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.4 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.34 | |
| KOG1571|consensus | 355 | 98.31 | ||
| KOG0506|consensus | 622 | 98.31 | ||
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.24 | |
| KOG0782|consensus | 1004 | 98.21 | ||
| KOG0522|consensus | 560 | 98.2 | ||
| KOG0782|consensus | 1004 | 98.18 | ||
| KOG0705|consensus | 749 | 98.18 | ||
| KOG4172|consensus | 62 | 98.16 | ||
| KOG0705|consensus | 749 | 98.15 | ||
| KOG0522|consensus | 560 | 98.13 | ||
| KOG4265|consensus | 349 | 98.08 | ||
| KOG3609|consensus | 822 | 98.0 | ||
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.99 | |
| KOG0978|consensus | 698 | 97.96 | ||
| KOG2164|consensus | 513 | 97.95 | ||
| KOG1100|consensus | 207 | 97.95 | ||
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.95 | |
| KOG0521|consensus | 785 | 97.95 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.93 | |
| KOG3609|consensus | 822 | 97.93 | ||
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.85 | |
| KOG0521|consensus | 785 | 97.84 | ||
| KOG4275|consensus | 350 | 97.82 | ||
| KOG2384|consensus | 223 | 97.77 | ||
| KOG0823|consensus | 230 | 97.76 | ||
| KOG2384|consensus | 223 | 97.74 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.72 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 97.71 | |
| KOG0511|consensus | 516 | 97.71 | ||
| KOG1571|consensus | 355 | 97.63 | ||
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.6 | |
| KOG0317|consensus | 293 | 97.55 | ||
| KOG0520|consensus | 975 | 97.54 | ||
| KOG0511|consensus | 516 | 97.51 | ||
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.49 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.41 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.39 | |
| KOG0824|consensus | 324 | 97.37 | ||
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.31 | |
| KOG0520|consensus | 975 | 97.31 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.19 | |
| KOG1100|consensus | 207 | 97.17 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.15 | |
| KOG4692|consensus | 489 | 97.12 | ||
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.01 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 96.95 | |
| KOG0287|consensus | 442 | 96.93 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 96.72 | |
| KOG1785|consensus | 563 | 96.47 | ||
| KOG2505|consensus | 591 | 96.28 | ||
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.25 | |
| KOG2177|consensus | 386 | 96.18 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.17 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.17 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.08 | |
| KOG2505|consensus | 591 | 95.99 | ||
| KOG3002|consensus | 299 | 95.95 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 95.89 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 95.85 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 95.41 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 95.32 | |
| KOG0824|consensus | 324 | 95.25 | ||
| KOG0311|consensus | 381 | 95.0 | ||
| KOG4159|consensus | 398 | 94.9 | ||
| KOG1785|consensus | 563 | 94.76 | ||
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 94.71 | |
| KOG2879|consensus | 298 | 94.68 | ||
| KOG1039|consensus | 344 | 94.68 | ||
| KOG0320|consensus | 187 | 94.49 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 94.48 | |
| KOG1813|consensus | 313 | 94.41 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 94.19 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 94.17 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 94.01 | |
| KOG4692|consensus | 489 | 93.99 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 93.98 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 93.96 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 93.9 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.9 | |
| KOG4739|consensus | 233 | 93.86 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 93.71 | |
| KOG0802|consensus | 543 | 93.49 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 93.48 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 93.32 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 93.11 | |
| KOG2231|consensus | 669 | 93.08 | ||
| KOG0823|consensus | 230 | 92.51 | ||
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 92.36 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 92.27 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 92.2 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 91.72 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 91.51 | |
| KOG0317|consensus | 293 | 91.35 | ||
| KOG2113|consensus | 394 | 91.3 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 91.02 | |
| KOG0978|consensus | 698 | 90.71 | ||
| KOG1814|consensus | 445 | 89.8 | ||
| KOG4628|consensus | 348 | 89.62 | ||
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 88.7 | |
| KOG1001|consensus | 674 | 88.11 | ||
| KOG0297|consensus | 391 | 88.08 | ||
| KOG0804|consensus | 493 | 87.26 | ||
| KOG0287|consensus | 442 | 86.44 | ||
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 86.25 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 86.0 | |
| KOG2660|consensus | 331 | 85.93 | ||
| KOG2164|consensus | 513 | 85.42 | ||
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 85.31 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 85.29 | |
| KOG2879|consensus | 298 | 85.26 | ||
| KOG0804|consensus | 493 | 84.57 | ||
| KOG3039|consensus | 303 | 84.53 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 84.27 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 84.23 | |
| KOG1002|consensus | 791 | 83.83 | ||
| KOG4367|consensus | 699 | 83.5 | ||
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 83.45 | |
| KOG0828|consensus | 636 | 82.46 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 81.45 | |
| KOG2932|consensus | 389 | 80.66 | ||
| PF10217 | 92 | DUF2039: Uncharacterized conserved protein (DUF203 | 80.39 | |
| KOG1701|consensus | 468 | 80.14 |
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-40 Score=378.56 Aligned_cols=325 Identities=19% Similarity=0.176 Sum_probs=273.8
Q ss_pred cHHHHHHHcCCHHHHHHHHHCCCCCcccCCCCCcHHHHHHhcCCHHHHHHH-hhccCCCccchhhhhhhhhccccccccC
Q psy2733 2 TLLHILAYQGCVEELNILLARGACVYYPDDAGDTALHYAAFGNKPDAIQIN-SHVSGANRSRKHIYKERHRTVTTEKVQR 80 (644)
Q Consensus 2 TpLh~Aa~~G~~e~vk~LL~~Ga~~n~~d~~G~TpLh~Aa~~g~~eiv~lL-~~~a~~~~~~~~~~~~~~~~~~~~~~~~ 80 (644)
++|+.|+..|+.+++++|++.|+++|.+|..|+||||+|+..|+.++|++| .+|++++.....+.++++.+........
T Consensus 147 ~~l~~~i~~~~~~i~k~Ll~~Gadvn~~d~~G~TpLh~Aa~~G~~~iv~~LL~~Gad~n~~~~~g~t~L~~A~~~~~~~i 226 (682)
T PHA02876 147 KLIKERIQQDELLIAEMLLEGGADVNAKDIYCITPIHYAAERGNAKMVNLLLSYGADVNIIALDDLSVLECAVDSKNIDT 226 (682)
T ss_pred HHHHHHHHCCcHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCcCccCCCCCCHHHHHHHcCCHHH
Confidence 578889999999999999999999999999999999999999999999999 9999998887777777777665443322
Q ss_pred CCCCCCCCC--------------CCcccccccccccccCCCCCCcccchhhHHHH--------HHHHHhCCCCCCCCCCC
Q psy2733 81 PSNLPKVEP--------------ETPMLNMKFIPRMNEDMLDTPSAECSGILIKQ--------DFVLLRNGCNVNIQDNN 138 (644)
Q Consensus 81 ~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~t~L~~a~--------v~~Ll~~gad~n~~d~~ 138 (644)
...+..... ........++...+.+....+..|.||||+|+ +++|++.|++++..|.+
T Consensus 227 vk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn~~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~d~~ 306 (682)
T PHA02876 227 IKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLYDAGFSVNSIDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAKNIK 306 (682)
T ss_pred HHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCcCCC
Confidence 111110000 01111123445556667777888999999996 77899999999999999
Q ss_pred CCcHHHHHHHcC-CHHHHHHHhcCCCCCccccCCCCCcHHHHHHHc-CCHHHHHHHHHhcCCccCCcCCCCCchHHHHHH
Q psy2733 139 QDTPMHDAVAKG-FEEIQLLLLSHPEVNLYLENSKGFNILNYAVLR-GNMKVTEKILALNRNLATVPKTSDGFTPLHVAC 216 (644)
Q Consensus 139 G~TpL~~A~~~g-~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~A~~~-g~~~~v~~Ll~~~~~~~~~~~d~~g~T~Lh~A~ 216 (644)
|.||||+|+..| +.+++++|+. .|++++..+..|.||||+|+.. ++.++++.|++.++++.. .|..|+||||+|+
T Consensus 307 g~TpLh~Aa~~g~~~~~v~~Ll~-~gadin~~d~~g~TpLh~A~~~~~~~~iv~lLl~~gadin~--~d~~G~TpLh~Aa 383 (682)
T PHA02876 307 GETPLYLMAKNGYDTENIRTLIM-LGADVNAADRLYITPLHQASTLDRNKDIVITLLELGANVNA--RDYCDKTPIHYAA 383 (682)
T ss_pred CCCHHHHHHHhCCCHHHHHHHHH-cCCCCCCcccCCCcHHHHHHHhCCcHHHHHHHHHcCCCCcc--CCCCCCCHHHHHH
Confidence 999999999999 6999999999 7999999999999999999985 578899999999988766 5688999999999
Q ss_pred hcCcHHHHHHHHHhcCCCcccCCCCCCCHHHHHHHcCC-HHHHHHHHHCCCCCCcccCCCCcHHHHHHHcCCcccccccc
Q psy2733 217 FNDHIEIVELLVEKYKVNINALDLKKRTPLMAAVGQGQ-TSVINYLMLRDVALDIQDIDGNGLLHFLFIKKNFYKTPITR 295 (644)
Q Consensus 217 ~~g~~~~v~~Ll~~~g~~in~~d~~G~TpL~~Aa~~g~-~~iv~~Ll~~gadvn~~d~~G~T~Lh~A~~~~~~~~~~~~~ 295 (644)
..|+.+++++|++. |++++..+..|.||||+|+..++ ..++++|+++|+++|.+|..|+||||+|+..+.
T Consensus 384 ~~~~~~iv~~Ll~~-gad~~~~~~~g~T~Lh~A~~~~~~~~~vk~Ll~~gadin~~d~~G~TpLh~Aa~~~~-------- 454 (682)
T PHA02876 384 VRNNVVIINTLLDY-GADIEALSQKIGTALHFALCGTNPYMSVKTLIDRGANVNSKNKDLSTPLHYACKKNC-------- 454 (682)
T ss_pred HcCCHHHHHHHHHC-CCCccccCCCCCchHHHHHHcCCHHHHHHHHHhCCCCCCcCCCCCChHHHHHHHhCC--------
Confidence 99999999999998 89999999999999999998766 567999999999999999999999999998763
Q ss_pred cCCchhHHhhhhcCCCCCccchHHHHHHHHHHcCCCCCCCCCCCCCcchhhhcCCcHHHHHHHHh
Q psy2733 296 EKSVPIYEEYLSVGGPSNEHGILLAVFLFLVKHGAPLSLENNNRQKPLDLILEDTSLLNEIMEHA 360 (644)
Q Consensus 296 ~~~~~~~~~~~~~~~~~~~~~~~~~iv~~Ll~~Gadi~~~n~~G~TpL~~A~~~~~~~~~l~~~~ 360 (644)
..+++++|+++||+++.+|..|.|||++|+...++++.++...
T Consensus 455 ----------------------~~~iv~lLl~~Gad~n~~d~~g~tpl~~a~~~~~~v~~Ll~~~ 497 (682)
T PHA02876 455 ----------------------KLDVIEMLLDNGADVNAINIQNQYPLLIALEYHGIVNILLHYG 497 (682)
T ss_pred ----------------------cHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHhCCHHHHHHHCC
Confidence 1579999999999999999999999999998788777776544
|
|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2231|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >PF10217 DUF2039: Uncharacterized conserved protein (DUF2039); InterPro: IPR019351 This entry is a region of approximately 100 residues containing three pairs of cysteine residues | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 644 | ||||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-13 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-07 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-13 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-07 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-13 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 5e-13 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 1e-04 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 8e-13 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 3e-12 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 1e-04 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-12 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 6e-07 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 7e-12 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 1e-07 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 1e-11 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 2e-05 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-11 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 7e-06 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 3e-11 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 4e-06 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 6e-11 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 6e-05 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 1e-10 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 7e-06 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-10 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 3e-04 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-10 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-06 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 2e-10 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 1e-05 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 3e-10 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 4e-05 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 3e-10 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 2e-08 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 6e-10 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 3e-05 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 1e-09 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 2e-06 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 2e-09 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 6e-06 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 2e-09 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 7e-06 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 2e-09 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 1e-07 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 5e-09 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 1e-07 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 7e-09 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 6e-04 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 8e-07 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 9e-07 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 2e-06 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 9e-06 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 2e-06 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 3e-06 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 3e-06 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 4e-06 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 3e-06 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 4e-06 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 4e-06 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 8e-06 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 1e-05 | ||
| 4auq_B | 62 | Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 | 1e-05 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 1e-05 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 1e-05 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 1e-05 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 2e-05 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 2e-05 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 4e-05 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-05 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 5e-05 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 5e-05 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 5e-05 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 5e-05 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 6e-05 | ||
| 1ixv_A | 231 | Crystal Structure Analysis Of Homolog Of Oncoprotei | 2e-04 | ||
| 2dzn_A | 228 | Crystal Structure Analysis Of Yeast Nas6p Complexed | 2e-04 | ||
| 1wg0_A | 243 | Structural Comparison Of Nas6p Protein Structures I | 2e-04 | ||
| 3t6p_A | 345 | Iap Antagonist-Induced Conformational Change In Cia | 2e-04 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 2e-04 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 2e-04 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 3e-04 | ||
| 1ot8_A | 239 | Structure Of The Ankyrin Domain Of The Drosophila N | 3e-04 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 3e-04 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 4e-04 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 4e-04 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 4e-04 |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
|
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 | Back alignment and structure |
| >pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 | Back alignment and structure |
| >pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 | Back alignment and structure |
| >pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 644 | |||
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-30 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-30 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-28 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-27 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 8e-23 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-20 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-06 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-04 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-04 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-04 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-04 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-04 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-29 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-27 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 9e-18 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-15 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-28 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-26 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-23 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-15 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-10 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-28 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-25 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-21 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 8e-15 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 4e-08 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-05 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 4e-04 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 8e-28 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-22 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 9e-15 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-14 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-07 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-05 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-27 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-24 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-21 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-20 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-18 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-15 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-13 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-27 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 6e-27 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-21 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-12 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-06 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 6e-27 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-23 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-22 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 7e-21 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 7e-20 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-15 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 8e-09 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-06 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-04 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 7e-27 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-24 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-24 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 7e-23 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-26 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-20 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-19 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-17 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-04 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-26 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-21 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-17 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 7e-14 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-10 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-07 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-26 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-26 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-22 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-17 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-13 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-07 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-06 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-05 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-25 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-20 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-16 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 7e-14 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 8e-06 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-04 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-04 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 9e-04 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-25 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 8e-23 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-22 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-17 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-05 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-05 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-05 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-04 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-04 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 3e-25 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 8e-22 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-17 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-13 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 5e-05 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-04 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 5e-04 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-25 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-24 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-24 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 8e-20 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-16 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-08 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-05 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-04 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-24 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-23 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-17 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-16 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-05 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-24 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 6e-23 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 7e-22 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-20 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-04 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-04 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-24 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 8e-22 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-17 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 4e-05 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-04 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 5e-04 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 9e-04 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-23 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-23 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-23 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 6e-21 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 7e-21 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 8e-08 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-23 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-21 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-19 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-17 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-05 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-05 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-05 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 7e-05 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-04 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-23 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 7e-15 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 9e-14 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-05 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 4e-05 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-04 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-04 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-23 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 9e-18 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-17 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-05 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-05 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-04 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 6e-04 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 7e-23 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 4e-19 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-07 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 6e-05 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 9e-05 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-22 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-22 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-20 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-19 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-18 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-13 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-22 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-17 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-10 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-08 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-04 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-22 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-21 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 4e-21 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-18 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-09 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-05 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-04 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-22 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-20 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-17 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-14 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-13 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 5e-22 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-18 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 5e-17 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 6e-22 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-21 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-17 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 4e-06 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-21 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 5e-15 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-14 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-06 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 8e-21 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 7e-20 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 5e-09 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 5e-05 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-04 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-20 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-20 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-16 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 3e-11 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-19 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-17 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-06 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-05 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 3e-05 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 8e-04 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-19 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 4e-19 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-05 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-19 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-18 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 4e-14 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-11 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-06 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 5e-04 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-19 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-17 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 9e-13 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-12 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 5e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 6e-05 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-18 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 5e-18 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-16 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-05 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 6e-05 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-04 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-18 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-17 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-14 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-05 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 5e-04 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 5e-18 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-16 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 3e-15 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-10 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 7e-05 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-04 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-17 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 5e-16 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-15 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-12 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 8e-08 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-05 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 5e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-17 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 7e-17 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 3e-14 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 3e-12 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 4e-17 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 8e-16 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-14 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 5e-17 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-16 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-07 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-05 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 5e-05 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 3e-16 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 4e-15 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 2e-12 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 7e-12 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-15 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 8e-13 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 6e-11 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-05 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 7e-05 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 2e-15 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 3e-08 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-15 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-09 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 3e-04 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-15 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-07 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-05 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 5e-15 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 1e-08 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-14 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 5e-14 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-13 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 4e-05 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 8e-04 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 1e-11 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 5e-09 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 6e-10 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 8e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 6e-07 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 5e-04 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 5e-08 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 4e-05 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 6e-08 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 5e-07 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 6e-07 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 2e-05 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 1e-05 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 5e-04 |
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
Score = 123 bits (311), Expect = 2e-30
Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 4/157 (2%)
Query: 125 LLRNGCNVNIQDNNQDTPMHDAVAKGFEEIQLLLLSHPEVNLYLENSKGFNILNYAVLRG 184
LL+ G + N+ + +TP+H A G E+ LL + + + + L+ A G
Sbjct: 33 LLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAKAKDDQTPLHCAARIG 91
Query: 185 NMKVTEKILALNRNLATVPKTSDGFTPLHVACFNDHIEIVELLVEKYKVNINALDLKKRT 244
+ + + +L N N T+ G TPLH+A H+E V L+EK + + + K T
Sbjct: 92 HTNMVKLLLENNANPNL--ATTAGHTPLHIAAREGHVETVLALLEK-EASQACMTKKGFT 148
Query: 245 PLMAAVGQGQTSVINYLMLRDVALDIQDIDGNGLLHF 281
PL A G+ V L+ RD + +G LH
Sbjct: 149 PLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHV 185
|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 644 | |||
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 100.0 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 100.0 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.97 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.97 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.97 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.97 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.97 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.97 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.97 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.97 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.97 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.97 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.96 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.96 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.96 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.95 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.95 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.95 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.95 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.95 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.95 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.95 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.95 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.94 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.94 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.94 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.94 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.94 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.94 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.94 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.94 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.94 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.93 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.93 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.93 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.93 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.93 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.92 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.91 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.91 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.9 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.9 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.9 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.89 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.88 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.88 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.87 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.86 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.86 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.86 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.86 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.85 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.85 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.85 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.84 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.84 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.84 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.84 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.82 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.82 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.8 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.8 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.8 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.79 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.79 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.78 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.78 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.78 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.74 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.64 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.64 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.31 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.2 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.11 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.11 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.03 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.98 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.89 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.79 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.52 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.5 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.48 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.47 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.41 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.39 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.37 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.35 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.35 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.34 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.33 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.33 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.32 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.29 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.28 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.27 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.27 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.27 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.26 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.26 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.25 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.24 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.22 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.21 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.21 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.19 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.16 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.14 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.13 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.13 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.11 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.1 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.1 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.1 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.08 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.08 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.08 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.08 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.08 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.03 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.02 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.01 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.0 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.0 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 97.99 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.98 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.94 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 97.92 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.88 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 97.87 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 97.85 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.83 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.77 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.57 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.57 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.53 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.49 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.34 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.22 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.11 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.06 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 96.93 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 96.84 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 96.55 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 96.52 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 96.49 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 96.48 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 96.45 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 96.44 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 96.15 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 96.12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 96.1 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 96.07 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 96.04 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 96.01 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 95.96 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 95.92 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 95.91 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 95.86 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 95.6 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 95.58 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 95.44 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 95.38 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 95.37 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 95.34 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 95.34 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 95.31 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 95.28 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 95.27 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 95.22 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 95.19 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 95.18 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 95.12 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 95.08 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 95.07 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 95.0 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 94.98 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 94.78 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 94.69 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 94.66 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 94.63 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 94.42 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 94.3 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 93.99 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 93.84 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 93.8 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 93.56 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 93.48 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 93.34 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 93.22 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 92.55 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 91.98 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 91.22 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 89.93 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 89.87 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 89.45 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 87.6 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 87.16 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 86.47 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 86.34 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 84.77 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 84.69 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 84.04 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 83.84 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 82.46 | |
| 2zet_C | 153 | Melanophilin; complex, GTP-binding protein, GTPase | 80.61 |
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-45 Score=397.92 Aligned_cols=287 Identities=23% Similarity=0.245 Sum_probs=233.5
Q ss_pred CcHHHHHHHcCCHHHHHHHHHCCCCCcccCCCCCcHHHHHHhcCCHHHHHHH-hhccCCCccchhhhhhhhhcccccccc
Q psy2733 1 KTLLHILAYQGCVEELNILLARGACVYYPDDAGDTALHYAAFGNKPDAIQIN-SHVSGANRSRKHIYKERHRTVTTEKVQ 79 (644)
Q Consensus 1 ~TpLh~Aa~~G~~e~vk~LL~~Ga~~n~~d~~G~TpLh~Aa~~g~~eiv~lL-~~~a~~~~~~~~~~~~~~~~~~~~~~~ 79 (644)
+||||+||..|++++|++|+++|++++.+|..|.||||+|+..|+.+++++| ..+++++..+..+.++++.+.......
T Consensus 15 ~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~ 94 (437)
T 1n11_A 15 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN 94 (437)
T ss_dssp CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHH
T ss_pred CCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHH
Confidence 5888888888888888888888888888888888888888888888888888 888888887777777777666443221
Q ss_pred ---------CCCCCCCCCCCCcccc---------cccccccccCCCCCCcccchhhHHHH-------HHHHHhCCCCCCC
Q psy2733 80 ---------RPSNLPKVEPETPMLN---------MKFIPRMNEDMLDTPSAECSGILIKQ-------DFVLLRNGCNVNI 134 (644)
Q Consensus 80 ---------~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~t~L~~a~-------v~~Ll~~gad~n~ 134 (644)
...+.......+++.. +..+...+.+....+..|.||||+|+ +++|+++|++++.
T Consensus 95 ~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~ 174 (437)
T 1n11_A 95 MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNA 174 (437)
T ss_dssp HHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTC
T ss_pred HHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCC
Confidence 1222222333333332 23444555566667788899999985 8899999999999
Q ss_pred CCCCCCcHHHHHHHcCCHHHHHHHhcCCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHhcCCccCCcCCCCCchHHHH
Q psy2733 135 QDNNQDTPMHDAVAKGFEEIQLLLLSHPEVNLYLENSKGFNILNYAVLRGNMKVTEKILALNRNLATVPKTSDGFTPLHV 214 (644)
Q Consensus 135 ~d~~G~TpL~~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~d~~g~T~Lh~ 214 (644)
.+..|.||||+|+..|+.+++++|++ .+.+++..+..|.||||+|+..|+.++++.|++.+++... .+..|.||||+
T Consensus 175 ~~~~g~t~L~~A~~~~~~~~v~~Ll~-~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~--~~~~g~t~L~~ 251 (437)
T 1n11_A 175 AGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANA--ESVQGVTPLHL 251 (437)
T ss_dssp CCSSCCCHHHHHHHTTCHHHHHHHGG-GTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTC--CCTTCCCHHHH
T ss_pred CCCCCCCHHHHHHHcCCHHHHHHHHh-CCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCC--CCCCCCCHHHH
Confidence 99999999999999999999999998 6888888888899999999999999999999998887655 45788999999
Q ss_pred HHhcCcHHHHHHHHHhcCCCcccCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCcccCCCCcHHHHHHHcCCcccc
Q psy2733 215 ACFNDHIEIVELLVEKYKVNINALDLKKRTPLMAAVGQGQTSVINYLMLRDVALDIQDIDGNGLLHFLFIKKNFYKT 291 (644)
Q Consensus 215 A~~~g~~~~v~~Ll~~~g~~in~~d~~G~TpL~~Aa~~g~~~iv~~Ll~~gadvn~~d~~G~T~Lh~A~~~~~~~~~ 291 (644)
|+..|+.+++++|++. +++++..|..|.||||+|+..|+.+++++|+++|++++.+|..|+||||+|+..++.+++
T Consensus 252 A~~~g~~~~v~~Ll~~-~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v 327 (437)
T 1n11_A 252 AAQEGHAEMVALLLSK-QANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLV 327 (437)
T ss_dssp HHHTTCHHHHHHHHTT-TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHHH
T ss_pred HHHCCCHHHHHHHHhc-CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHcCcHHHH
Confidence 9999999999999987 788999999999999999999999999999999999999999999999999998885433
|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 644 | ||||
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-29 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-23 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-23 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 6e-06 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-18 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-09 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-16 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-09 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-05 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 7e-16 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 4e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-05 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-04 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-15 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-13 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 9e-11 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-14 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-08 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-06 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-14 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 4e-14 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-04 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 5e-14 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 2e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 5e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-13 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-11 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-04 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-13 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-11 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 1e-10 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 6e-07 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 7e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 1e-08 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 7e-05 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 9e-06 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 1e-04 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 0.001 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 1e-05 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 0.001 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-05 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 3e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 0.002 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 4e-04 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 0.002 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 0.002 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 0.003 |
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: RNase L, 2-5a-dependent ribonuclease species: Human (Homo sapiens) [TaxId: 9606]
Score = 114 bits (286), Expect = 5e-29
Identities = 57/278 (20%), Positives = 100/278 (35%), Gaps = 6/278 (2%)
Query: 2 TLLHILAYQGCVEELNILLARGACVYYPDD-AGDTALHYAAFGNKPDAIQINSHVSGANR 60
LL V+ + LL GA V + ++ G T LH A ++ D +++
Sbjct: 7 HLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGADPV 66
Query: 61 SRKHIYKERHRTVTTEKVQRPSNLPKVEPETPMLNMKFIPRMNEDMLDTPSAECSGILIK 120
RK + L + + + + L K
Sbjct: 67 LRKKNGATPFLLAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYK 126
Query: 121 QDF---VLLRNGCNVNIQDNNQDTPMHDAVAKGFEEIQLLLLSHPEVNLYLENSKGFNIL 177
+ + + + T + DA KG E+ +LL ++ ++ G N L
Sbjct: 127 RGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNAL 186
Query: 178 NYAVLRGNMKVTEKIL-ALNRNLATV-PKTSDGFTPLHVACFNDHIEIVELLVEKYKVNI 235
+A+L + E I L + A V + G TPL +A H+ +V+ L+E+ + I
Sbjct: 187 IHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEI 246
Query: 236 NALDLKKRTPLMAAVGQGQTSVINYLMLRDVALDIQDI 273
N D +T L+ AV + L R + D D+
Sbjct: 247 NDTDSDGKTALLLAVELKLKKIAELLCKRGASTDCGDL 284
|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 644 | |||
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 100.0 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.98 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.96 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.96 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.96 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.96 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.96 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.94 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.93 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.93 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.92 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.92 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.91 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.91 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.9 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.9 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.9 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.89 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.88 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.87 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.87 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.86 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.83 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.81 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.79 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.63 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.59 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.5 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.48 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.38 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.35 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.28 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.22 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.1 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.02 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.0 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 97.92 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.91 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.2 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.14 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.08 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.01 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 96.82 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 96.73 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 95.96 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 95.91 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 95.85 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 95.78 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 95.16 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 94.73 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 93.42 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 93.1 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 92.09 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 91.86 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 87.67 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 86.3 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 84.57 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 81.69 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 80.93 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.2e-41 Score=361.46 Aligned_cols=316 Identities=20% Similarity=0.237 Sum_probs=235.8
Q ss_pred CcHHHHHHHcCCHHHHHHHHHCCCCCcccCCCCCcHHHHHHhcCCHHHHHHH-hhccCCCccchhhhhhhhhcccccccc
Q psy2733 1 KTLLHILAYQGCVEELNILLARGACVYYPDDAGDTALHYAAFGNKPDAIQIN-SHVSGANRSRKHIYKERHRTVTTEKVQ 79 (644)
Q Consensus 1 ~TpLh~Aa~~G~~e~vk~LL~~Ga~~n~~d~~G~TpLh~Aa~~g~~eiv~lL-~~~a~~~~~~~~~~~~~~~~~~~~~~~ 79 (644)
-||||+||+.|+.++|++|+++|+++|.+|..|+||||+|+..|+.++|++| .+|++++..+..+.++++.++......
T Consensus 1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~ 80 (408)
T d1n11a_ 1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN 80 (408)
T ss_dssp CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHH
T ss_pred CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHH
Confidence 3999999999999999999999999999999999999999999999999999 999999998888887776655333221
Q ss_pred C-------CCCCC--CCCCCCcccc---------cccccccccCCCCCCcccchhhHHHH-------HHHHHhCCCCCCC
Q psy2733 80 R-------PSNLP--KVEPETPMLN---------MKFIPRMNEDMLDTPSAECSGILIKQ-------DFVLLRNGCNVNI 134 (644)
Q Consensus 80 ~-------~~~~~--~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~t~L~~a~-------v~~Ll~~gad~n~ 134 (644)
. ..... .......... ..............+..+.++++.+. ++.|+++|++++.
T Consensus 81 ~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~ 160 (408)
T d1n11a_ 81 MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNA 160 (408)
T ss_dssp HHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTC
T ss_pred HHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCCc
Confidence 1 00000 0000000000 01111222223334455555665553 5666666666666
Q ss_pred CCCCCCcHHHHHHHcCCHHHHHHHhcCCCCCccccC---------------------------------CCCCcHHHHHH
Q psy2733 135 QDNNQDTPMHDAVAKGFEEIQLLLLSHPEVNLYLEN---------------------------------SKGFNILNYAV 181 (644)
Q Consensus 135 ~d~~G~TpL~~A~~~g~~~iv~~Ll~~~~~~~~~~d---------------------------------~~g~tpL~~A~ 181 (644)
.+.+|.+|||+|+..|+.+++++|+. .|++++..+ ..|.|||++|+
T Consensus 161 ~~~~~~~~L~~A~~~~~~~~~~~Ll~-~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~ 239 (408)
T d1n11a_ 161 AGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA 239 (408)
T ss_dssp CCSSCCCHHHHHHHTTCHHHHHHHGG-GTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHH
T ss_pred CCCcCchHHHHHHHcCCHHHHHHHHh-cCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHH
Confidence 66666666666666666666666666 455554444 44556666666
Q ss_pred HcCCHHHHHHHHHhcCCccCCcCCCCCchHHHHHHhcCcHHHHHHHHHhcCCCcccCCCCCCCHHHHHHHcCCHHHHHHH
Q psy2733 182 LRGNMKVTEKILALNRNLATVPKTSDGFTPLHVACFNDHIEIVELLVEKYKVNINALDLKKRTPLMAAVGQGQTSVINYL 261 (644)
Q Consensus 182 ~~g~~~~v~~Ll~~~~~~~~~~~d~~g~T~Lh~A~~~g~~~~v~~Ll~~~g~~in~~d~~G~TpL~~Aa~~g~~~iv~~L 261 (644)
..++.++++.++..+..... .+..|.|||+.|+..++.+++++|++. |++++..+..+.||||.|+..++.++++++
T Consensus 240 ~~~~~~~~~~~~~~~~~~~~--~~~~g~~~l~~a~~~~~~~i~~~Ll~~-g~~~~~~~~~~~t~L~~~~~~~~~~~~~~l 316 (408)
T d1n11a_ 240 QEGHAEMVALLLSKQANGNL--GNKSGLTPLHLVAQEGHVPVADVLIKH-GVMVDATTRMGYTPLHVASHYGNIKLVKFL 316 (408)
T ss_dssp HTTCHHHHHHHHTTTCCTTC--CCTTCCCHHHHHHHHTCHHHHHHHHHH-TCCTTCCCSSCCCHHHHHHHSSCSHHHHHH
T ss_pred HhCcHhHhhhhhcccccccc--ccCCCCChhhhhhhcCcHHHHHHHHHC-CCccccccccccccchhhcccCcceeeeee
Confidence 66666667766666554443 456788899999999999999999987 789999998999999999999999999999
Q ss_pred HHCCCCCCcccCCCCcHHHHHHHcCCcccccccccCCchhHHhhhhcCCCCCccchHHHHHHHHHHcCCCCCCCCCCCCC
Q psy2733 262 MLRDVALDIQDIDGNGLLHFLFIKKNFYKTPITREKSVPIYEEYLSVGGPSNEHGILLAVFLFLVKHGAPLSLENNNRQK 341 (644)
Q Consensus 262 l~~gadvn~~d~~G~T~Lh~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~~Ll~~Gadi~~~n~~G~T 341 (644)
++.|+++|.+|.+|+||||+|++.++ .+++++|+++|||++.+|.+|+|
T Consensus 317 l~~g~~in~~d~~G~T~Lh~A~~~g~-------------------------------~~iv~~Ll~~GAd~n~~d~~G~t 365 (408)
T d1n11a_ 317 LQHQADVNAKTKLGYSPLHQAAQQGH-------------------------------TDIVTLLLKNGASPNEVSSDGTT 365 (408)
T ss_dssp HHTTCCTTCCCTTSCCHHHHHHHTTC-------------------------------HHHHHHHHHTTCCSCCCCSSSCC
T ss_pred ccccccccccCCCCCCHHHHHHHcCC-------------------------------HHHHHHHHHCCCCCCCCCCCCCC
Confidence 99999999999999999999999888 78999999999999999999999
Q ss_pred cchhhhcCCc
Q psy2733 342 PLDLILEDTS 351 (644)
Q Consensus 342 pL~~A~~~~~ 351 (644)
|||+|++.++
T Consensus 366 ~L~~A~~~~~ 375 (408)
T d1n11a_ 366 PLAIAKRLGY 375 (408)
T ss_dssp HHHHHHHTTC
T ss_pred HHHHHHHcCC
Confidence 9999997664
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|