Psyllid ID: psy2760
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 333 | ||||||
| 170034314 | 1216 | antiviral helicase SKI2 [Culex quinquefa | 0.351 | 0.096 | 0.769 | 6e-46 | |
| 270010333 | 1500 | hypothetical protein TcasGA2_TC009717, p | 0.528 | 0.117 | 0.554 | 7e-45 | |
| 312385895 | 1749 | hypothetical protein AND_00228 [Anophele | 0.369 | 0.070 | 0.691 | 2e-44 | |
| 347969420 | 1223 | AGAP003182-PA [Anopheles gambiae str. PE | 0.351 | 0.095 | 0.743 | 2e-44 | |
| 242017221 | 1184 | Helicase, putative [Pediculus humanus co | 0.519 | 0.146 | 0.573 | 5e-43 | |
| 91086489 | 1177 | PREDICTED: similar to antiviral helicase | 0.465 | 0.131 | 0.590 | 2e-42 | |
| 357617976 | 1252 | hypothetical protein KGM_14675 [Danaus p | 0.471 | 0.125 | 0.569 | 5e-40 | |
| 345491941 | 1153 | PREDICTED: helicase SKI2W-like [Nasonia | 0.645 | 0.186 | 0.403 | 8e-40 | |
| 307177450 | 1136 | Helicase SKI2W [Camponotus floridanus] | 0.378 | 0.110 | 0.629 | 2e-39 | |
| 427793717 | 1160 | Putative nuclear exosomal rna helicase m | 0.351 | 0.100 | 0.683 | 3e-39 |
| >gi|170034314|ref|XP_001845019.1| antiviral helicase SKI2 [Culex quinquefasciatus] gi|167875652|gb|EDS39035.1| antiviral helicase SKI2 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 190 bits (483), Expect = 6e-46, Method: Compositional matrix adjust.
Identities = 90/117 (76%), Positives = 101/117 (86%)
Query: 151 ILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHN 210
+LKI+NT V EWAE+LDVSKPV DF K+P MAH +PFELD+FQKQAIIKLEEHN
Sbjct: 224 VLKIANTGTNGVKTAEWAEILDVSKPVTDFHTKIPEMAHRYPFELDIFQKQAIIKLEEHN 283
Query: 211 HVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLI 267
HVFV AHTSAGKTV+AEYAIALS+ H T+TIYTSPIKALSNQKYRDF+ TF+DVGLI
Sbjct: 284 HVFVAAHTSAGKTVVAEYAIALSKKHMTKTIYTSPIKALSNQKYRDFKSTFEDVGLI 340
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270010333|gb|EFA06781.1| hypothetical protein TcasGA2_TC009717, partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|312385895|gb|EFR30287.1| hypothetical protein AND_00228 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|347969420|ref|XP_312880.4| AGAP003182-PA [Anopheles gambiae str. PEST] gi|333468516|gb|EAA08476.4| AGAP003182-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|242017221|ref|XP_002429090.1| Helicase, putative [Pediculus humanus corporis] gi|212513954|gb|EEB16352.1| Helicase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91086489|ref|XP_970674.1| PREDICTED: similar to antiviral helicase SKI2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357617976|gb|EHJ71092.1| hypothetical protein KGM_14675 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|345491941|ref|XP_001599855.2| PREDICTED: helicase SKI2W-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307177450|gb|EFN66577.1| Helicase SKI2W [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|427793717|gb|JAA62310.1| Putative nuclear exosomal rna helicase mtr4 dead-box superfamily, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 333 | ||||||
| FB|FBgn0039117 | 1197 | tst "twister" [Drosophila mela | 0.459 | 0.127 | 0.543 | 3.1e-37 | |
| UNIPROTKB|E2RSD6 | 1246 | SKIV2L "Uncharacterized protei | 0.369 | 0.098 | 0.626 | 1.8e-36 | |
| RGD|1303059 | 1241 | Skiv2l "superkiller viralicidi | 0.603 | 0.161 | 0.446 | 4.6e-36 | |
| UNIPROTKB|F1RQW4 | 1246 | SKIV2L "Uncharacterized protei | 0.369 | 0.098 | 0.626 | 6.1e-36 | |
| UNIPROTKB|E1BMS0 | 1246 | LOC100139548 "Uncharacterized | 0.369 | 0.098 | 0.617 | 2.1e-35 | |
| UNIPROTKB|F1LP39 | 1206 | Skiv2l "Protein Skiv2l" [Rattu | 0.567 | 0.156 | 0.453 | 2.3e-35 | |
| ZFIN|ZDB-GENE-010430-5 | 1249 | skiv2l "superkiller viralicidi | 0.306 | 0.081 | 0.696 | 5.5e-35 | |
| UNIPROTKB|Q15477 | 1246 | SKIV2L "Helicase SKI2W" [Homo | 0.369 | 0.098 | 0.601 | 7.1e-35 | |
| UNIPROTKB|F8VNU1 | 1088 | SKIV2L "Helicase SKI2W" [Homo | 0.369 | 0.113 | 0.601 | 2.4e-34 | |
| UNIPROTKB|B4DM01 | 1088 | SKIV2L "cDNA FLJ57529, highly | 0.369 | 0.113 | 0.601 | 3e-34 |
| FB|FBgn0039117 tst "twister" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 412 (150.1 bits), Expect = 3.1e-37, P = 3.1e-37
Identities = 87/160 (54%), Positives = 115/160 (71%)
Query: 112 LWESHEVIS-GDAKEEQEKATVFPSNE---EENNVIPQEVDIPILKISNTLPKHVTQTEW 167
L S E S G K ++ PS E +++++ ++ P+L IS T +++W
Sbjct: 179 LTRSEETSSTGTPKSPKQSNVQLPSEEFRDVDDHIMKADLK-PVLNISTTTKNF--KSDW 235
Query: 168 AEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAE 227
AEM+D+S+P+ +F ++P A +PFELDVFQKQAI+KLE+ +VFV AHTSAGKTV+AE
Sbjct: 236 AEMVDISQPINNFKEQIPCPAMDFPFELDVFQKQAILKLEQRQYVFVAAHTSAGKTVVAE 295
Query: 228 YAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLI 267
YAIALS+ TRTIYTSPIKALSNQKYRDFR+TF+DVGLI
Sbjct: 296 YAIALSKRDLTRTIYTSPIKALSNQKYRDFRKTFKDVGLI 335
|
|
| UNIPROTKB|E2RSD6 SKIV2L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1303059 Skiv2l "superkiller viralicidic activity 2-like (S. cerevisiae )" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQW4 SKIV2L "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BMS0 LOC100139548 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LP39 Skiv2l "Protein Skiv2l" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010430-5 skiv2l "superkiller viralicidic activity 2 (S. cerevisiae homolog)-like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15477 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8VNU1 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DM01 SKIV2L "cDNA FLJ57529, highly similar to Helicase SKI2W (EC 3.6.1.-)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 333 | |||
| COG4581 | 1041 | COG4581, COG4581, Superfamily II RNA helicase [DNA | 6e-32 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 7e-10 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-07 | |
| COG1202 | 830 | COG1202, COG1202, Superfamily II helicase, archaea | 4e-07 | |
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 1e-06 | |
| PRK01172 | 674 | PRK01172, PRK01172, ski2-like helicase; Provisiona | 1e-05 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 3e-05 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 3e-04 | |
| pfam04851 | 100 | pfam04851, ResIII, Type III restriction enzyme, re | 7e-04 | |
| TIGR04121 | 803 | TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA | 0.002 | |
| PRK00254 | 720 | PRK00254, PRK00254, ski2-like helicase; Provisiona | 0.003 |
| >gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 125 bits (317), Expect = 6e-32
Identities = 51/89 (57%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
Query: 180 FDAKVPI----MAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQN 235
DA+ P A +PFELD FQ++AI LE V V A TS+GKTV+AEYAIAL+
Sbjct: 101 PDAESPFDLAPPAREYPFELDPFQQEAIAILERGESVLVCAPTSSGKTVVAEYAIALALR 160
Query: 236 HKTRTIYTSPIKALSNQKYRDFRETFQDV 264
R IYTSPIKALSNQKYRD F DV
Sbjct: 161 DGQRVIYTSPIKALSNQKYRDLLAKFGDV 189
|
Length = 1041 |
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated | Back alignment and domain information |
|---|
| >gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 333 | |||
| KOG0947|consensus | 1248 | 99.93 | ||
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.87 | |
| KOG0948|consensus | 1041 | 99.85 | ||
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.81 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.79 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.79 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.76 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.72 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.72 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.71 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.71 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.71 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.71 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.69 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.69 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.69 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.69 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.69 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.69 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.68 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.67 | |
| PTZ00110 | 545 | helicase; Provisional | 99.67 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.67 | |
| KOG0952|consensus | 1230 | 99.66 | ||
| PTZ00424 | 401 | helicase 45; Provisional | 99.66 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.65 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.62 | |
| KOG0338|consensus | 691 | 99.62 | ||
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.61 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.6 | |
| KOG0331|consensus | 519 | 99.58 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.58 | |
| KOG0330|consensus | 476 | 99.57 | ||
| KOG0345|consensus | 567 | 99.56 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.55 | |
| KOG0348|consensus | 708 | 99.55 | ||
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.54 | |
| KOG0347|consensus | 731 | 99.54 | ||
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.54 | |
| KOG0343|consensus | 758 | 99.51 | ||
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.5 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.49 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.48 | |
| KOG0342|consensus | 543 | 99.47 | ||
| KOG0340|consensus | 442 | 99.46 | ||
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.45 | |
| KOG0350|consensus | 620 | 99.44 | ||
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.44 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.43 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.42 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.41 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.4 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 99.4 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.4 | |
| KOG0335|consensus | 482 | 99.37 | ||
| KOG0346|consensus | 569 | 99.36 | ||
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.36 | |
| KOG0333|consensus | 673 | 99.33 | ||
| KOG0334|consensus | 997 | 99.31 | ||
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.27 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.26 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.25 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.24 | |
| KOG0354|consensus | 746 | 99.23 | ||
| KOG0336|consensus | 629 | 99.14 | ||
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.13 | |
| KOG0337|consensus | 529 | 99.12 | ||
| KOG0344|consensus | 593 | 99.12 | ||
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.11 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.1 | |
| KOG0953|consensus | 700 | 99.09 | ||
| KOG0339|consensus | 731 | 99.08 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.06 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.06 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.05 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.03 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.0 | |
| KOG0951|consensus | 1674 | 98.98 | ||
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 98.97 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 98.97 | |
| KOG0341|consensus | 610 | 98.96 | ||
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 98.96 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 98.95 | |
| KOG0326|consensus | 459 | 98.94 | ||
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 98.92 | |
| KOG4284|consensus | 980 | 98.9 | ||
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 98.86 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 98.86 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 98.85 | |
| KOG0328|consensus | 400 | 98.77 | ||
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.76 | |
| KOG0949|consensus | 1330 | 98.76 | ||
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.75 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.75 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 98.7 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.68 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.66 | |
| KOG0352|consensus | 641 | 98.65 | ||
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.63 | |
| KOG0951|consensus | 1674 | 98.62 | ||
| KOG0332|consensus | 477 | 98.61 | ||
| KOG0327|consensus | 397 | 98.56 | ||
| KOG0950|consensus | 1008 | 98.52 | ||
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 98.41 | |
| KOG0329|consensus | 387 | 98.41 | ||
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.4 | |
| KOG0351|consensus | 941 | 98.39 | ||
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.38 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 98.36 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.33 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 98.33 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 98.28 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.2 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 98.18 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 98.18 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 98.06 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 98.05 | |
| KOG0353|consensus | 695 | 98.05 | ||
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 98.05 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.03 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 98.03 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.02 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 98.0 | |
| KOG0952|consensus | 1230 | 97.97 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 97.94 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.94 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 97.8 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.68 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 97.57 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 97.57 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 97.53 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 97.42 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 97.36 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.25 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 97.15 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 97.1 | |
| KOG1123|consensus | 776 | 97.09 | ||
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 97.06 | |
| KOG1803|consensus | 649 | 97.03 | ||
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 96.84 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 96.72 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 96.62 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.56 | |
| KOG0920|consensus | 924 | 96.49 | ||
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 96.44 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 96.39 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 96.37 | |
| KOG0387|consensus | 923 | 96.34 | ||
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 96.28 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.26 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 96.17 | |
| PRK06526 | 254 | transposase; Provisional | 96.17 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 96.15 | |
| KOG1802|consensus | 935 | 96.15 | ||
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 96.11 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 96.06 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 95.97 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 95.76 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 95.72 | |
| KOG0926|consensus | 1172 | 95.59 | ||
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 95.55 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 95.5 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.48 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 95.47 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.47 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 95.45 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.43 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.42 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 95.36 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 95.35 | |
| KOG0349|consensus | 725 | 95.25 | ||
| PRK08727 | 233 | hypothetical protein; Validated | 95.25 | |
| PRK08181 | 269 | transposase; Validated | 95.24 | |
| KOG0922|consensus | 674 | 95.23 | ||
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.23 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.14 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.06 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 95.02 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 94.86 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.85 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.75 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.62 | |
| KOG0390|consensus | 776 | 94.61 | ||
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.57 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 94.45 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.44 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 94.43 | |
| KOG1000|consensus | 689 | 94.4 | ||
| PF12846 | 304 | AAA_10: AAA-like domain | 94.34 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 94.31 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 94.25 | |
| KOG1132|consensus | 945 | 94.21 | ||
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.11 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.03 | |
| KOG1133|consensus | 821 | 94.02 | ||
| KOG4439|consensus | 901 | 93.96 | ||
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 93.93 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.89 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 93.85 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 93.7 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 93.64 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 93.58 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 93.55 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 93.53 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 93.53 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 93.47 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 93.42 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.34 | |
| COG4626 | 546 | Phage terminase-like protein, large subunit [Gener | 93.3 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.26 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 93.25 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 93.25 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 93.19 | |
| KOG4150|consensus | 1034 | 93.17 | ||
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 93.13 | |
| KOG0389|consensus | 941 | 93.1 | ||
| PRK04296 | 190 | thymidine kinase; Provisional | 93.09 | |
| KOG0924|consensus | 1042 | 92.96 | ||
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 92.95 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 92.94 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 92.85 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 92.67 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 92.64 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 92.6 | |
| PRK08116 | 268 | hypothetical protein; Validated | 92.56 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 92.56 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 92.5 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 92.47 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 92.41 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 92.39 | |
| PRK12377 | 248 | putative replication protein; Provisional | 92.38 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.13 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 92.07 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 92.04 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 92.01 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 91.88 | |
| KOG1131|consensus | 755 | 91.84 | ||
| KOG0923|consensus | 902 | 91.82 | ||
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 91.81 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 91.79 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 91.76 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 91.69 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 91.69 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 91.67 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 91.65 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 91.65 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 91.63 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 91.59 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 91.59 | |
| KOG1002|consensus | 791 | 91.55 | ||
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.54 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 91.52 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 91.48 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 91.44 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.41 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 91.33 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 91.31 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 91.28 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 91.27 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 91.11 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 91.1 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 91.08 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.04 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 90.98 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 90.83 | |
| KOG0385|consensus | 971 | 90.71 | ||
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 90.59 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 90.46 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 90.35 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.3 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 90.21 | |
| KOG0925|consensus | 699 | 90.18 | ||
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 90.16 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 89.96 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 89.94 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 89.93 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 89.93 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 89.77 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 89.32 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 89.32 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 89.28 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 89.2 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 89.14 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 89.06 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 89.06 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 88.94 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 88.79 | |
| TIGR02746 | 797 | TraC-F-type type-IV secretion system protein TraC. | 88.71 | |
| TIGR02759 | 566 | TraD_Ftype type IV conjugative transfer system cou | 88.4 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 88.35 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 88.33 | |
| PRK13764 | 602 | ATPase; Provisional | 88.24 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 88.18 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 88.11 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 88.03 | |
| PF03354 | 477 | Terminase_1: Phage Terminase ; InterPro: IPR005021 | 88.02 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 87.82 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 87.81 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 87.74 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 87.72 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 87.71 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 87.55 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 87.55 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 87.42 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 87.41 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 87.38 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 87.16 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 87.08 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 87.07 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 86.96 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 86.8 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 86.64 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 86.47 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 86.39 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 86.21 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 86.17 | |
| TIGR03744 | 893 | traC_PFL_4706 conjugative transfer ATPase, PFL_470 | 86.07 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 86.05 | |
| KOG2028|consensus | 554 | 85.98 | ||
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 85.97 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 85.95 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 85.74 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 85.56 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 85.48 | |
| PRK13880 | 636 | conjugal transfer coupling protein TraG; Provision | 85.45 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 85.32 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 85.31 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 85.31 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 85.3 | |
| TIGR03783 | 829 | Bac_Flav_CT_G Bacteroides conjugation system ATPas | 85.25 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 85.24 | |
| COG3451 | 796 | VirB4 Type IV secretory pathway, VirB4 components | 85.22 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 85.22 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 85.16 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 85.11 | |
| PF05729 | 166 | NACHT: NACHT domain | 85.0 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 84.98 | |
| PRK13700 | 732 | conjugal transfer protein TraD; Provisional | 84.93 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 84.8 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 84.78 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 84.67 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 84.5 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 84.44 | |
| PRK13876 | 663 | conjugal transfer coupling protein TraG; Provision | 84.26 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 84.25 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 84.22 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 84.17 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 83.98 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 83.98 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 83.87 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 83.83 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 83.82 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 83.8 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 83.76 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 83.75 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 83.52 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 83.44 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 83.33 | |
| TIGR00929 | 785 | VirB4_CagE type IV secretion/conjugal transfer ATP | 83.29 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 83.25 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 83.24 | |
| PRK13721 | 844 | conjugal transfer ATP-binding protein TraC; Provis | 83.21 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 83.07 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 83.06 | |
| KOG1805|consensus | 1100 | 83.02 | ||
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 82.83 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 82.74 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 82.58 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 82.58 | |
| TIGR02767 | 623 | TraG-Ti Ti-type conjugative transfer system protie | 82.53 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 82.5 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 82.26 | |
| KOG1806|consensus | 1320 | 82.1 | ||
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 81.96 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 81.96 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 81.83 | |
| PRK13891 | 852 | conjugal transfer protein TrbE; Provisional | 81.81 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 81.79 | |
| PHA02244 | 383 | ATPase-like protein | 81.76 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 81.74 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 81.66 | |
| PRK13822 | 641 | conjugal transfer coupling protein TraG; Provision | 81.65 | |
| PRK13768 | 253 | GTPase; Provisional | 81.62 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 81.59 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 81.57 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 81.49 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 81.41 | |
| PHA00350 | 399 | putative assembly protein | 81.4 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 81.36 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 81.32 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 81.31 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 81.23 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 81.11 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 81.07 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 81.02 | |
| KOG0060|consensus | 659 | 81.0 | ||
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 80.97 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 80.95 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 80.86 | |
| KOG0745|consensus | 564 | 80.56 | ||
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 80.54 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 80.5 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 80.4 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 80.39 | |
| PF02456 | 369 | Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR | 80.37 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 80.36 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 80.35 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 80.34 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 80.21 |
| >KOG0947|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=7.4e-26 Score=236.33 Aligned_cols=164 Identities=46% Similarity=0.615 Sum_probs=150.8
Q ss_pred CCCCCcccchhhccCChhhhhhhhccccccccCCCCCCHHHHHHHHHHHcCCcEEEEcCCCCcHHHHHHHHHHHHhcCCC
Q psy2760 159 PKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKT 238 (333)
Q Consensus 159 ~~~~~~~~w~~~~~L~~~l~~~~~~~~~~~~~~~f~l~~~Q~~ai~~l~~g~~vlv~apTGSGKTl~~~l~il~~l~~g~ 238 (333)
.......+|+...+++..+.+|.+-.+..+..|||+++++|++||-++.+|.+|+|.|+|++|||+++.+||..+..+++
T Consensus 262 ~t~~~k~~wa~~vd~~~~~~df~~lVpe~a~~~pFelD~FQk~Ai~~lerg~SVFVAAHTSAGKTvVAEYAialaq~h~T 341 (1248)
T KOG0947|consen 262 STRPVKFEWAHVVDLSSLVEDFYQLVPEMALIYPFELDTFQKEAIYHLERGDSVFVAAHTSAGKTVVAEYAIALAQKHMT 341 (1248)
T ss_pred cCCCccccceeeeecccchHHHHHhchhHHhhCCCCccHHHHHHHHHHHcCCeEEEEecCCCCcchHHHHHHHHHHhhcc
Confidence 33335679999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eEEEEcccHHHHHHHHHHHHHhcCCcEEEeCCCCCCCCcceEEecc---------------CcceEeccccccccccCcC
Q psy2760 239 RTIYTSPIKALSNQKYRDFRETFQDVGLIDDLPPVFPDVEKLLEDL---------------NIGGLDELSIHDFNKHLKF 303 (333)
Q Consensus 239 ral~l~PtraLa~Q~~~~l~~~f~~vglltGd~~~~~~a~ili~t~---------------~i~liViDe~H~~~~~~R~ 303 (333)
|++|.+|.+||.+|.+++|++.|+++|++|||.++++.+.|+|+|+ ++..+|.||.||+++..||
T Consensus 342 R~iYTSPIKALSNQKfRDFk~tF~DvgLlTGDvqinPeAsCLIMTTEILRsMLYrgadliRDvE~VIFDEVHYiND~eRG 421 (1248)
T KOG0947|consen 342 RTIYTSPIKALSNQKFRDFKETFGDVGLLTGDVQINPEASCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYINDVERG 421 (1248)
T ss_pred ceEecchhhhhccchHHHHHHhccccceeecceeeCCCcceEeehHHHHHHHHhcccchhhccceEEEeeeeeccccccc
Confidence 9999999999999999999999999999999999999999999987 6788999999999999999
Q ss_pred cccccchhh---hhhheeccCc
Q psy2760 304 WKPKVQLDD---LFDWTMASDA 322 (333)
Q Consensus 304 ~~~~~~l~~---l~~l~~~~d~ 322 (333)
..|+.-++= -++++|.|++
T Consensus 422 vVWEEViIMlP~HV~~IlLSAT 443 (1248)
T KOG0947|consen 422 VVWEEVIIMLPRHVNFILLSAT 443 (1248)
T ss_pred ccceeeeeeccccceEEEEecc
Confidence 999854443 3778887764
|
|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG4626 Phage terminase-like protein, large subunit [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02746 TraC-F-type type-IV secretion system protein TraC | Back alignment and domain information |
|---|
| >TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK13880 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK13700 conjugal transfer protein TraD; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK13876 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13721 conjugal transfer ATP-binding protein TraC; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >KOG1805|consensus | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >KOG1806|consensus | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK13891 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13822 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 333 | ||||
| 4a4z_A | 997 | Crystal Structure Of The S. Cerevisiae Dexh Helicas | 4e-33 | ||
| 2xgj_A | 1010 | Structure Of Mtr4, A Dexh Helicase Involved In Nucl | 2e-22 | ||
| 3l9o_A | 1108 | Crystal Structure Of Mtr4, A Co-Factor Of The Nucle | 2e-22 | ||
| 4f92_B | 1724 | Brr2 Helicase Region S1087l Length = 1724 | 2e-07 | ||
| 4f91_B | 1724 | Brr2 Helicase Region Length = 1724 | 2e-07 | ||
| 2va8_A | 715 | Dna Repair Helicase Hel308 Length = 715 | 3e-05 | ||
| 2p6r_A | 702 | Crystal Structure Of Superfamily 2 Helicase Hel308 | 2e-04 |
| >pdb|4A4Z|A Chain A, Crystal Structure Of The S. Cerevisiae Dexh Helicase Ski2 Bound To Amppnp Length = 997 | Back alignment and structure |
|
| >pdb|2XGJ|A Chain A, Structure Of Mtr4, A Dexh Helicase Involved In Nuclear Rna Processing And Surveillance Length = 1010 | Back alignment and structure |
| >pdb|3L9O|A Chain A, Crystal Structure Of Mtr4, A Co-Factor Of The Nuclear Exosome Length = 1108 | Back alignment and structure |
| >pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 | Back alignment and structure |
| >pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 | Back alignment and structure |
| >pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 | Back alignment and structure |
| >pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 333 | |||
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 1e-43 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 8e-43 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 1e-42 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 9e-19 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 3e-12 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 5e-11 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 4e-04 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 5e-04 |
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 | Back alignment and structure |
|---|
Score = 159 bits (403), Expect = 1e-43
Identities = 62/106 (58%), Positives = 84/106 (79%), Gaps = 2/106 (1%)
Query: 164 QTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKT 223
+ EWA ++D++ + +FD +P A +WPFELD FQK+A+ LE+ + VFV AHTSAGKT
Sbjct: 9 KKEWAHVVDLNHKIENFDELIPNPARSWPFELDTFQKEAVYHLEQGDSVFVAAHTSAGKT 68
Query: 224 VIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETF--QDVGLI 267
V+AEYAIA++ + T+TIYTSPIKALSNQK+RDF+ETF ++GLI
Sbjct: 69 VVAEYAIAMAHRNMTKTIYTSPIKALSNQKFRDFKETFDDVNIGLI 114
|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 333 | |||
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.82 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.81 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.81 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.8 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.78 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.78 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.78 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.77 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.77 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.77 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.76 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.76 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.76 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.76 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.76 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.75 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.75 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.74 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.72 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.72 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.71 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.71 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.71 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.71 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.71 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.71 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.7 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.7 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.7 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.7 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.69 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.69 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.68 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.68 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.68 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.67 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.66 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.66 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.66 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.66 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.66 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.66 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.61 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.6 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.6 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.6 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.59 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.59 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.59 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.58 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.58 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.55 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.54 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.53 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.53 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.52 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.44 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.37 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.34 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.31 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.26 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.25 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.2 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.2 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.2 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.2 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.19 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.18 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.16 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.15 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.15 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.12 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.12 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.1 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.09 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 98.91 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 98.82 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 98.81 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.81 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 98.68 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 98.1 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.76 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 97.65 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 97.64 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 97.49 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 97.34 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 97.32 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.22 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 97.21 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 97.14 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 96.94 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 96.7 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 96.67 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 96.63 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 96.51 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 96.04 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.37 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.82 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.47 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 93.96 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.44 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 92.89 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 92.81 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 92.73 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 92.46 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.13 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 92.09 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 91.98 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 91.58 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 91.2 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 91.05 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 91.01 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 90.92 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 90.79 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 90.35 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 90.23 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 90.22 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 90.12 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 89.84 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 89.7 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 89.62 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 89.61 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 89.6 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 89.36 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 89.34 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 89.27 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 89.25 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 89.13 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 89.1 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 88.77 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 88.7 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 88.67 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 88.35 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 88.17 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 87.64 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 87.49 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 87.38 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 87.27 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 87.11 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 86.82 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 86.76 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 86.61 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 86.59 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 86.55 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 86.48 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 86.31 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 85.9 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 85.86 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 85.78 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 85.61 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 84.95 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 84.92 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 84.88 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 84.72 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 84.69 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 84.45 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 84.37 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 84.35 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 84.33 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 84.16 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 84.07 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 83.8 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 83.62 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 83.59 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 83.58 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 83.58 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 83.47 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 83.47 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 83.47 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 83.43 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 83.4 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 83.35 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 83.18 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 83.15 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 83.12 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 83.07 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 82.9 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 82.67 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 82.65 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 82.6 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 82.59 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 82.53 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 82.34 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 82.19 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 82.14 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 82.05 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 82.05 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 82.01 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 81.97 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 81.96 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 81.75 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 81.72 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 81.72 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 81.63 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 81.61 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 81.6 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 81.52 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 81.38 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 81.29 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 81.03 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 80.9 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 80.74 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 80.7 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 80.63 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 80.58 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 80.54 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 80.51 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 80.48 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 80.31 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 80.17 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 80.13 |
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.82 E-value=1.9e-20 Score=205.03 Aligned_cols=135 Identities=41% Similarity=0.529 Sum_probs=120.3
Q ss_pred cccCCCCCCHHHHHHHHHHHcCCcEEEEcCCCCcHHHHHHHHHHHHhcCCCeEEEEcccHHHHHHHHHHHHHhcCCcEEE
Q psy2760 188 AHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLI 267 (333)
Q Consensus 188 ~~~~~f~l~~~Q~~ai~~l~~g~~vlv~apTGSGKTl~~~l~il~~l~~g~ral~l~PtraLa~Q~~~~l~~~f~~vgll 267 (333)
...++|.|+++|.+|++.+..|++++++||||||||++|.+|++..+..+.+++|++||++|++|++++|++.|+.+|++
T Consensus 178 ~~~~~f~ltp~Q~~AI~~i~~g~dvLV~ApTGSGKTlva~l~i~~~l~~g~rvlvl~PtraLa~Q~~~~l~~~~~~Vgll 257 (1108)
T 3l9o_A 178 ARTYPFTLDPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLM 257 (1108)
T ss_dssp SSCCSSCCCHHHHHHHHHHTTTCCEEEECCSSSHHHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHHHTSSEEEE
T ss_pred HHhCCCCCCHHHHHHHHHHHcCCCEEEECCCCCChHHHHHHHHHHHHhcCCeEEEEcCcHHHHHHHHHHHHHHhCCccEE
Confidence 45678899999999999999999999999999999999999999988899999999999999999999999999999999
Q ss_pred eCCCCCCCCcceEEecc---------------CcceEeccccccccccCcCcccccchh---hhhhheeccCc
Q psy2760 268 DDLPPVFPDVEKLLEDL---------------NIGGLDELSIHDFNKHLKFWKPKVQLD---DLFDWTMASDA 322 (333)
Q Consensus 268 tGd~~~~~~a~ili~t~---------------~i~liViDe~H~~~~~~R~~~~~~~l~---~l~~l~~~~d~ 322 (333)
+|+.+.+.+..++|+|+ ++.++|+||+|++.+.+|+..|...+. ..++++++|++
T Consensus 258 tGd~~~~~~~~IlV~Tpe~L~~~L~~~~~~l~~l~lVVIDEaH~l~d~~rg~~~e~ii~~l~~~~qvl~lSAT 330 (1108)
T 3l9o_A 258 TGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSAT 330 (1108)
T ss_dssp CSSCBCCCSCSEEEEEHHHHHHHHHHCSSHHHHEEEEEEETGGGTTSHHHHHHHHHHHHHSCTTSEEEEEECS
T ss_pred eCccccCCCCCEEEeChHHHHHHHHcCccccccCCEEEEhhhhhccccchHHHHHHHHHhcCCCceEEEEcCC
Confidence 99999999999999985 578999999999998888866654222 23567777776
|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 333 | ||||
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 5e-06 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 1e-05 | |
| d1a1va1 | 136 | c.37.1.14 (A:190-325) HCV helicase domain {Human h | 3e-05 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 8e-05 | |
| d2eyqa3 | 233 | c.37.1.19 (A:546-778) Transcription-repair couplin | 0.001 | |
| d2fz4a1 | 206 | c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc | 0.004 |
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Helicase-like "domain" of reverse gyrase domain: Helicase-like "domain" of reverse gyrase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 44.9 bits (105), Expect = 5e-06
Identities = 14/69 (20%), Positives = 19/69 (27%)
Query: 198 FQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDF 257
QK ++ TA T GKT R P L Q
Sbjct: 47 IQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLALKGKRCYVIFPTSLLVIQAAETI 106
Query: 258 RETFQDVGL 266
R+ + G+
Sbjct: 107 RKYAEKAGV 115
|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 333 | |||
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.79 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.77 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.76 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.75 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.74 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.73 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.73 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.73 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.72 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.71 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.71 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.69 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.63 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.62 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.58 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.5 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.48 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.46 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.43 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.35 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.25 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 98.09 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.89 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.68 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.25 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.09 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.68 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 95.54 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.41 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.1 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 94.53 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 94.23 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.16 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 94.1 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.04 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 93.77 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.4 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 92.96 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.72 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 92.64 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 92.36 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.13 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.96 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 91.82 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 91.8 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.59 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 90.92 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 90.82 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 90.45 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 90.14 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 90.11 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 90.07 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 90.07 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 89.81 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 89.53 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.47 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 89.41 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 89.4 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 89.34 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 89.01 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 88.93 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 88.84 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 88.71 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 88.66 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 88.6 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 88.21 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 87.92 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 87.41 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 87.38 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 86.99 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 86.55 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 86.51 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 86.19 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 85.88 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 85.66 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 85.36 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 85.19 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 84.92 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 84.55 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 84.52 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 84.11 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 84.05 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 83.86 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 83.42 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 83.25 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 83.1 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 82.46 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 82.08 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 82.05 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 81.55 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 81.45 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 81.28 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 81.04 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 80.82 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 80.63 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 80.43 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 80.17 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 80.16 |
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Hel308 helicase species: Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.79 E-value=4e-20 Score=162.28 Aligned_cols=145 Identities=19% Similarity=0.207 Sum_probs=112.3
Q ss_pred cCChhhhhhhhccccccccCCCCCCHHHHHHHHHHHcCCcEEEEcCCCCcHHHHHHHHHHHHhcCCCeEEEEcccHHHHH
Q psy2760 172 DVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSN 251 (333)
Q Consensus 172 ~L~~~l~~~~~~~~~~~~~~~f~l~~~Q~~ai~~l~~g~~vlv~apTGSGKTl~~~l~il~~l~~g~ral~l~PtraLa~ 251 (333)
.+++.+.++++..|+. +|+|+|.+|+..+.+|+++++++|||||||.++.++++..+.++.+++|++|+++|+.
T Consensus 9 ~~~~~~~~~l~~~g~~------~l~~~Q~~ai~~l~~~~~~il~apTGsGKT~~a~l~i~~~~~~~~~vl~l~P~~~L~~ 82 (202)
T d2p6ra3 9 SISSYAVGILKEEGIE------ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAG 82 (202)
T ss_dssp HHHHHHHHHHHCC---------CCCCCCHHHHHHHTTCSCEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEEESSHHHHH
T ss_pred hhhHHHHHHHHHcCCC------CCCHHHHHHHHHHHcCCCEEEEcCCCCchhHHHHHHHHHHhhccCcceeecccHHHHH
Confidence 3566777777766655 7999999999999999999999999999999999999988888899999999999999
Q ss_pred HHHHHHHHhcCC---cEEEeCCCCCCCC----cceEEecc---------------CcceEeccccccccccCcCcccccc
Q psy2760 252 QKYRDFRETFQD---VGLIDDLPPVFPD----VEKLLEDL---------------NIGGLDELSIHDFNKHLKFWKPKVQ 309 (333)
Q Consensus 252 Q~~~~l~~~f~~---vglltGd~~~~~~----a~ili~t~---------------~i~liViDe~H~~~~~~R~~~~~~~ 309 (333)
|+.+++++.++. ++..+|+...... ..+++.++ .+.++++||+|.+....|+......
T Consensus 83 q~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~ii~~~~~~~~~~~~~~~~~~~~~~~ii~DE~h~~~~~~r~~~~~~~ 162 (202)
T d2p6ra3 83 EKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEIL 162 (202)
T ss_dssp HHHHHHTTTTTTTCCEEEECSSCBCCSSCSTTCSEEEEEHHHHHHHHHTTCSGGGGCCEEEETTGGGGGCTTTHHHHHHH
T ss_pred HHHHHHHHHhhccccceeeccCcccccccccccceeeeccHHHHHHHhccchhhhhhhhccccHHHHhcccccchHHHHH
Confidence 999999876553 6777777654432 34455443 5689999999999988888766542
Q ss_pred hhh------hhhheeccCc
Q psy2760 310 LDD------LFDWTMASDA 322 (333)
Q Consensus 310 l~~------l~~l~~~~d~ 322 (333)
+.. .++++++|++
T Consensus 163 l~~i~~~~~~~~~l~lSAT 181 (202)
T d2p6ra3 163 VTKMRRMNKALRVIGLSAT 181 (202)
T ss_dssp HHHHHHHCTTCEEEEEECC
T ss_pred HHHHHhcCCCCcEEEEcCC
Confidence 221 2356777765
|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|