Psyllid ID: psy2779


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWVEGSRG
ccEEEEEccccccccccccccccccccccccccccccccccHHHHHHHcccEEEHHHHccccccccEEEEcccccccccccccccccEEEEEEEEEccccc
ccEEEEcccccHHHEEccHcccccccccccccccHccccccHHHHHHHHcEEEEccccHHHHHHHcccccEEEEEEccccccccccccHHEEccccccccc
MKIEEVKSTVktqrisshshvkglglkengeanEMAAGLVGQQAAREVSRAVTWEKSFQFerckshslfrggravaggrtkcpkppntsmiidswvegsrg
mkieevkstvktqrisshshvkglglkENGEANEMAAGLVGQQAAREVSRAVTWEKSfqferckshslfrggravaggrtkcpkppntsmiidswvegsrg
MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWVEGSRG
***********************************************VSRAVTWEKSFQFERCKSHSLFRGGRAV**************************
*KIEE***********SHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWVEG***
********************VKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWVEGSRG
*KIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWV*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWVEGSRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
Q0IFL2 456 RuvB-like helicase 1 OS=A N/A N/A 0.514 0.114 0.75 3e-14
Q9DE26 456 RuvB-like 1 OS=Xenopus la N/A N/A 0.465 0.103 0.787 2e-13
Q29AK9 456 RuvB-like helicase 1 OS=D yes N/A 0.514 0.114 0.730 2e-13
Q8AWW7 456 RuvB-like 1 OS=Danio reri yes N/A 0.524 0.116 0.698 2e-13
Q9VH07 456 RuvB-like helicase 1 OS=D yes N/A 0.514 0.114 0.730 4e-13
P60123 456 RuvB-like 1 OS=Rattus nor yes N/A 0.465 0.103 0.765 6e-13
P60122 456 RuvB-like 1 OS=Mus muscul yes N/A 0.465 0.103 0.765 6e-13
Q9Y265 456 RuvB-like 1 OS=Homo sapie yes N/A 0.465 0.103 0.765 6e-13
Q9C0X6 456 RuvB-like helicase 1 OS=S yes N/A 0.524 0.116 0.452 1e-07
Q4ICA8 458 RuvB-like helicase 1 OS=G yes N/A 0.465 0.102 0.531 2e-07
>sp|Q0IFL2|RUVB1_AEDAE RuvB-like helicase 1 OS=Aedes aegypti GN=pont PE=3 SV=1 Back     alignment and function desciption
 Score = 77.0 bits (188), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 44/52 (84%)

Query: 1  MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAV 52
          MKIEEVKSTVKTQRI++HSHVKGLGL ENG   +MAAGLVGQ+ ARE +  V
Sbjct: 1  MKIEEVKSTVKTQRIAAHSHVKGLGLDENGVPLQMAAGLVGQKDAREAAGIV 52




Proposed core component of the chromatin remodeling Ino80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Aedes aegypti (taxid: 7159)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q9DE26|RUVB1_XENLA RuvB-like 1 OS=Xenopus laevis GN=ruvbl1 PE=2 SV=1 Back     alignment and function description
>sp|Q29AK9|RUVB1_DROPS RuvB-like helicase 1 OS=Drosophila pseudoobscura pseudoobscura GN=pont PE=3 SV=1 Back     alignment and function description
>sp|Q8AWW7|RUVB1_DANRE RuvB-like 1 OS=Danio rerio GN=ruvbl1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VH07|RUVB1_DROME RuvB-like helicase 1 OS=Drosophila melanogaster GN=pont PE=1 SV=1 Back     alignment and function description
>sp|P60123|RUVB1_RAT RuvB-like 1 OS=Rattus norvegicus GN=Ruvbl1 PE=1 SV=1 Back     alignment and function description
>sp|P60122|RUVB1_MOUSE RuvB-like 1 OS=Mus musculus GN=Ruvbl1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y265|RUVB1_HUMAN RuvB-like 1 OS=Homo sapiens GN=RUVBL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9C0X6|RUVB1_SCHPO RuvB-like helicase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rvb1 PE=3 SV=1 Back     alignment and function description
>sp|Q4ICA8|RUVB1_GIBZE RuvB-like helicase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RVB1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
312373428 847 hypothetical protein AND_17438 [Anophele 0.524 0.062 0.735 5e-13
170034306 456 pontin [Culex quinquefasciatus] gi|16787 0.514 0.114 0.75 8e-13
193713703 456 PREDICTED: ruvB-like helicase 1-like [Ac 0.514 0.114 0.769 1e-12
194740952 456 GF17460 [Drosophila ananassae] gi|190626 0.514 0.114 0.75 1e-12
157107057 456 TATA-binding protein, putative [Aedes ae 0.514 0.114 0.75 1e-12
156382397 455 predicted protein [Nematostella vectensi 0.514 0.114 0.711 3e-12
260816078 456 hypothetical protein BRAFLDRAFT_127120 [ 0.514 0.114 0.75 3e-12
195388750 456 GJ23553 [Drosophila virilis] gi|19415112 0.524 0.116 0.716 4e-12
301607045 456 PREDICTED: ruvB-like 1 [Xenopus (Siluran 0.465 0.103 0.787 4e-12
357623020 443 putative pontin [Danaus plexippus] 0.514 0.117 0.711 4e-12
>gi|312373428|gb|EFR21173.1| hypothetical protein AND_17438 [Anopheles darlingi] Back     alignment and taxonomy information
 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/53 (73%), Positives = 44/53 (83%)

Query: 1   MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVT 53
           MKIEEVKSTVKTQRI++HSHVKGLGL ENG   +MAAGLVGQ+ ARE +  V 
Sbjct: 392 MKIEEVKSTVKTQRIAAHSHVKGLGLDENGAPLQMAAGLVGQKNAREAAGVVV 444




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170034306|ref|XP_001845015.1| pontin [Culex quinquefasciatus] gi|167875648|gb|EDS39031.1| pontin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|193713703|ref|XP_001952030.1| PREDICTED: ruvB-like helicase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|194740952|ref|XP_001952953.1| GF17460 [Drosophila ananassae] gi|190626012|gb|EDV41536.1| GF17460 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|157107057|ref|XP_001649604.1| TATA-binding protein, putative [Aedes aegypti] gi|122115038|sp|Q0IFL2.1|RUVB1_AEDAE RecName: Full=RuvB-like helicase 1; AltName: Full=Pontin gi|108879667|gb|EAT43892.1| AAEL004686-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|156382397|ref|XP_001632540.1| predicted protein [Nematostella vectensis] gi|156219597|gb|EDO40477.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|260816078|ref|XP_002602799.1| hypothetical protein BRAFLDRAFT_127120 [Branchiostoma floridae] gi|229288111|gb|EEN58811.1| hypothetical protein BRAFLDRAFT_127120 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|195388750|ref|XP_002053042.1| GJ23553 [Drosophila virilis] gi|194151128|gb|EDW66562.1| GJ23553 [Drosophila virilis] Back     alignment and taxonomy information
>gi|301607045|ref|XP_002933113.1| PREDICTED: ruvB-like 1 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|357623020|gb|EHJ74338.1| putative pontin [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
UNIPROTKB|F1SPF6 269 LOC100518399 "Uncharacterized 0.465 0.174 0.787 3.8e-14
UNIPROTKB|Q0IFL2 456 pont "RuvB-like helicase 1" [A 0.514 0.114 0.75 8.8e-14
ZFIN|ZDB-GENE-030109-2 456 ruvbl1 "RuvB-like 1 (E. coli)" 0.524 0.116 0.698 1.4e-13
UNIPROTKB|Q29AK9 456 pont "RuvB-like helicase 1" [D 0.514 0.114 0.730 2.4e-13
UNIPROTKB|Q9DE26 456 ruvbl1 "RuvB-like 1" [Xenopus 0.465 0.103 0.787 2.4e-13
FB|FBgn0040078 456 pont "pontin" [Drosophila mela 0.514 0.114 0.730 6.5e-13
UNIPROTKB|A7MBG8 456 RUVBL1 "Uncharacterized protei 0.465 0.103 0.765 8.4e-13
UNIPROTKB|E2RQC9 456 RUVBL1 "Uncharacterized protei 0.465 0.103 0.765 8.4e-13
UNIPROTKB|Q9Y265 456 RUVBL1 "RuvB-like 1" [Homo sap 0.465 0.103 0.765 8.4e-13
MGI|MGI:1928760 456 Ruvbl1 "RuvB-like protein 1" [ 0.465 0.103 0.765 8.4e-13
UNIPROTKB|F1SPF6 LOC100518399 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 182 (69.1 bits), Expect = 3.8e-14, P = 3.8e-14
 Identities = 37/47 (78%), Positives = 41/47 (87%)

Query:     1 MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAARE 47
             MKIEEVKST KTQRI+SHSHVKGLGL ENG A + A+GLVGQ+ ARE
Sbjct:     1 MKIEEVKSTTKTQRIASHSHVKGLGLDENGLAKQAASGLVGQENARE 47




GO:0043141 "ATP-dependent 5'-3' DNA helicase activity" evidence=IEA
GO:0031011 "Ino80 complex" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|Q0IFL2 pont "RuvB-like helicase 1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030109-2 ruvbl1 "RuvB-like 1 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q29AK9 pont "RuvB-like helicase 1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DE26 ruvbl1 "RuvB-like 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
FB|FBgn0040078 pont "pontin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBG8 RUVBL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQC9 RUVBL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y265 RUVBL1 "RuvB-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1928760 Ruvbl1 "RuvB-like protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8AWW7RUVB1_DANRE3, ., 6, ., 4, ., 1, 20.69810.52470.1162yesN/A
Q29AK9RUVB1_DROPS3, ., 6, ., 4, ., 1, 20.73070.51480.1140yesN/A
Q9VH07RUVB1_DROME3, ., 6, ., 4, ., 1, 20.73070.51480.1140yesN/A
P60123RUVB1_RAT3, ., 6, ., 4, ., 1, 20.76590.46530.1030yesN/A
P60122RUVB1_MOUSE3, ., 6, ., 4, ., 1, 20.76590.46530.1030yesN/A
Q4ICA8RUVB1_GIBZE3, ., 6, ., 4, ., 1, 20.53190.46530.1026yesN/A
Q9Y265RUVB1_HUMAN3, ., 6, ., 4, ., 1, 20.76590.46530.1030yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 5e-11
pfam06068 395 pfam06068, TIP49, TIP49 C-terminus 1e-10
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
 Score = 57.0 bits (138), Expect = 5e-11
 Identities = 25/46 (54%), Positives = 32/46 (69%), Gaps = 1/46 (2%)

Query: 2  KIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAARE 47
          KI E     +  RI++HSH+KGLGL ENG+A  +  GLVGQ+ ARE
Sbjct: 5  KIREEDVGERE-RIAAHSHIKGLGLDENGKAKFIGDGLVGQEEARE 49


Length = 450

>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
KOG1942|consensus 456 99.95
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.94
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.94
KOG2680|consensus 454 99.92
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 97.13
COG0606 490 Predicted ATPase with chaperone activity [Posttran 96.58
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 96.43
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.39
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 96.02
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.94
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 95.93
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.91
PRK13342 413 recombination factor protein RarA; Reviewed 95.61
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.59
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.47
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 95.31
PRK06893 229 DNA replication initiation factor; Validated 95.27
cd00009 151 AAA The AAA+ (ATPases Associated with a wide varie 95.23
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.22
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 95.17
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 94.9
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 94.89
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 94.7
PF1324576 AAA_19: Part of AAA domain 94.65
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 94.57
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 94.55
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.43
PRK12402 337 replication factor C small subunit 2; Reviewed 94.31
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 94.28
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 94.18
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.01
PRK04195 482 replication factor C large subunit; Provisional 93.84
TIGR02237 209 recomb_radB DNA repair and recombination protein R 93.81
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 93.79
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 93.76
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.69
PF13654 509 AAA_32: AAA domain; PDB: 3K1J_B. 93.65
PLN03025 319 replication factor C subunit; Provisional 93.59
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 93.45
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 93.39
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.36
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.35
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.33
cd01394 218 radB RadB. The archaeal protein radB shares simila 93.23
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 93.23
KOG0734|consensus 752 93.21
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 93.13
PHA02544 316 44 clamp loader, small subunit; Provisional 93.06
KOG0744|consensus 423 93.03
KOG1970|consensus 634 92.95
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.88
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 92.84
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 92.75
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 92.69
COG2256 436 MGS1 ATPase related to the helicase subunit of the 92.67
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 92.66
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 92.59
PRK13531 498 regulatory ATPase RavA; Provisional 92.57
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 92.51
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 92.5
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 92.48
PRK05973 237 replicative DNA helicase; Provisional 92.35
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 92.32
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 92.08
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 92.06
CHL00181 287 cbbX CbbX; Provisional 91.97
PRK13341 725 recombination factor protein RarA/unknown domain f 91.9
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 91.87
PRK07940 394 DNA polymerase III subunit delta'; Validated 91.78
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 91.78
PF06414 199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 91.77
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 91.67
PRK08903 227 DnaA regulatory inactivator Hda; Validated 91.5
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 91.48
PRK08084 235 DNA replication initiation factor; Provisional 91.42
PRK06067 234 flagellar accessory protein FlaH; Validated 91.41
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 91.38
KOG0731|consensus 774 91.35
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 91.34
PRK14737 186 gmk guanylate kinase; Provisional 91.26
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 91.23
TIGR03880 224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 91.23
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 91.23
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 91.22
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 91.21
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 91.18
PRK04328 249 hypothetical protein; Provisional 91.16
PRK06526 254 transposase; Provisional 91.08
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 91.07
CHL00195 489 ycf46 Ycf46; Provisional 91.04
PRK00300 205 gmk guanylate kinase; Provisional 91.02
PRK03992 389 proteasome-activating nucleotidase; Provisional 90.96
PRK05642 234 DNA replication initiation factor; Validated 90.91
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 90.9
KOG0733|consensus 802 90.85
PRK00131 175 aroK shikimate kinase; Reviewed 90.82
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 90.78
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.77
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 90.75
PF00437 270 T2SE: Type II/IV secretion system protein; InterPr 90.69
PRK07471 365 DNA polymerase III subunit delta'; Validated 90.62
CHL00095 821 clpC Clp protease ATP binding subunit 90.61
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 90.5
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 90.49
COG0714 329 MoxR-like ATPases [General function prediction onl 90.39
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 90.39
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 90.34
PRK00440 319 rfc replication factor C small subunit; Reviewed 90.33
PRK13765 637 ATP-dependent protease Lon; Provisional 90.33
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 90.28
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 90.26
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 90.13
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.08
TIGR02236 310 recomb_radA DNA repair and recombination protein R 90.01
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 90.01
PRK14738 206 gmk guanylate kinase; Provisional 89.95
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 89.91
PRK09112 351 DNA polymerase III subunit delta'; Validated 89.89
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.88
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 89.68
PRK04301 317 radA DNA repair and recombination protein RadA; Va 89.55
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 89.46
PRK12377 248 putative replication protein; Provisional 89.4
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 89.36
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 89.12
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 89.03
PRK14527 191 adenylate kinase; Provisional 89.01
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 88.98
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 88.98
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 88.96
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 88.93
KOG0727|consensus 408 88.92
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 88.76
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 88.62
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 88.56
PRK06620 214 hypothetical protein; Validated 88.5
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.44
KOG2028|consensus 554 88.4
CHL00176 638 ftsH cell division protein; Validated 88.19
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 88.09
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 88.03
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 88.01
PRK00411 394 cdc6 cell division control protein 6; Reviewed 87.89
KOG0730|consensus 693 87.87
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 87.85
PRK08533 230 flagellar accessory protein FlaH; Reviewed 87.83
PRK10865 857 protein disaggregation chaperone; Provisional 87.66
KOG0733|consensus 802 87.6
PRK09183 259 transposase/IS protein; Provisional 87.59
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 87.44
PF00270 169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 87.44
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 87.39
PRK05541 176 adenylylsulfate kinase; Provisional 87.35
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 87.26
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 87.2
PF13481 193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 87.16
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 87.08
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 87.07
KOG0991|consensus 333 87.03
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 86.99
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 86.76
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 86.64
PF00005137 ABC_tran: ABC transporter This structure is on hol 86.55
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 86.43
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 86.41
PRK00889 175 adenylylsulfate kinase; Provisional 86.35
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 86.3
PRK00149 450 dnaA chromosomal replication initiation protein; R 86.27
PRK09302 509 circadian clock protein KaiC; Reviewed 86.25
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 86.08
PRK08181 269 transposase; Validated 85.96
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 85.91
PRK09862 506 putative ATP-dependent protease; Provisional 85.83
PRK05480 209 uridine/cytidine kinase; Provisional 85.81
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 85.76
PF04851 184 ResIII: Type III restriction enzyme, res subunit; 85.74
TIGR02782 299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 85.74
PLN03186 342 DNA repair protein RAD51 homolog; Provisional 85.7
PRK08356 195 hypothetical protein; Provisional 85.65
TIGR00235 207 udk uridine kinase. Model contains a number of lon 85.64
KOG0738|consensus 491 85.58
PLN02200 234 adenylate kinase family protein 85.42
PLN03187 344 meiotic recombination protein DMC1 homolog; Provis 85.3
TIGR02788 308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 85.03
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 84.96
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 84.91
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 84.81
cd00983 325 recA RecA is a bacterial enzyme which has roles in 84.57
PHA00729 226 NTP-binding motif containing protein 84.47
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 84.34
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 84.3
PRK10436 462 hypothetical protein; Provisional 84.28
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 84.24
PRK13851 344 type IV secretion system protein VirB11; Provision 84.17
PRK09302 509 circadian clock protein KaiC; Reviewed 84.0
PRK05564 313 DNA polymerase III subunit delta'; Validated 83.98
smart00487 201 DEXDc DEAD-like helicases superfamily. 83.97
PRK13833 323 conjugal transfer protein TrbB; Provisional 83.94
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 83.93
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 83.85
PRK08727 233 hypothetical protein; Validated 83.67
PLN02165 334 adenylate isopentenyltransferase 83.66
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 83.59
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA m 83.58
cd03238 176 ABC_UvrA The excision repair protein UvrA; Nucleot 83.49
PRK11823 446 DNA repair protein RadA; Provisional 83.39
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 83.33
TIGR02533 486 type_II_gspE general secretory pathway protein E. 83.25
PRK07667 193 uridine kinase; Provisional 83.19
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 83.19
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 83.15
PF01695 178 IstB_IS21: IstB-like ATP binding protein; InterPro 83.1
PF13476 202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 83.09
KOG0989|consensus 346 83.05
TIGR00665 434 DnaB replicative DNA helicase. This model describe 83.04
PRK13900 332 type IV secretion system ATPase VirB11; Provisiona 82.86
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 82.83
PRK15455 644 PrkA family serine protein kinase; Provisional 82.72
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 82.69
KOG0741|consensus 744 82.44
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 82.35
PRK09354 349 recA recombinase A; Provisional 82.22
PTZ00035 337 Rad51 protein; Provisional 82.21
KOG0739|consensus 439 81.86
PRK13894 319 conjugal transfer ATPase TrbB; Provisional 81.77
TIGR00376 637 DNA helicase, putative. The gene product may repre 81.67
KOG0735|consensus 952 81.59
PRK09087 226 hypothetical protein; Validated 81.46
PRK10875 615 recD exonuclease V subunit alpha; Provisional 81.44
cd03280 200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 81.39
PRK14088 440 dnaA chromosomal replication initiation protein; P 81.29
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 81.28
PHA02244 383 ATPase-like protein 81.26
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 81.19
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 81.17
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 80.99
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 80.96
PRK05748 448 replicative DNA helicase; Provisional 80.83
KOG3078|consensus 235 80.72
PRK06547 172 hypothetical protein; Provisional 80.64
KOG1807|consensus 1025 80.57
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 80.51
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 80.38
KOG0736|consensus 953 80.26
KOG0737|consensus 386 80.23
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 80.2
PTZ00202 550 tuzin; Provisional 80.18
>KOG1942|consensus Back     alignment and domain information
Probab=99.95  E-value=6.8e-30  Score=212.64  Aligned_cols=83  Identities=49%  Similarity=0.646  Sum_probs=77.4

Q ss_pred             CccceeecceeeeeeccccccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCC
Q psy2779           1 MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRT   80 (101)
Q Consensus         1 ~~i~ev~~~~r~~RIaaHSHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p   80 (101)
                      ++|+||+++.+.+||++||||||||||+.|.|.+.++|||||++|||||||||||       +|++ +++||++|++|||
T Consensus         2 ~~ieeVkst~~~~ria~HsHvkgLGlde~g~~~~~~~g~vGQ~~AReAagiivdl-------ik~K-kmaGravLlaGpp   73 (456)
T KOG1942|consen    2 VKIEEVKSTGRTQRIAAHSHVKGLGLDETGNAVEVAAGFVGQENAREAAGIIVDL-------IKSK-KMAGRAVLLAGPP   73 (456)
T ss_pred             cchhhhcccccchhhhhhhhccccCcCCCCCeeecccccccchhhhhhhhHHHHH-------HHhh-hccCcEEEEecCC
Confidence            5899999999999999999999999999999999999999999999999999999       5554 5689999999999


Q ss_pred             CCC--------------CCCCceee
Q psy2779          81 KCP--------------KPPNTSMI   91 (101)
Q Consensus        81 ~~g--------------~~~~~~~~   91 (101)
                      |||              |.||++|.
T Consensus        74 gtGKTAlAlaisqELG~kvPFcpmv   98 (456)
T KOG1942|consen   74 GTGKTALALAISQELGPKVPFCPMV   98 (456)
T ss_pred             CCchhHHHHHHHHHhCCCCCccccc
Confidence            999              56999986



>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG3078|consensus Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
2c9o_A 456 3d Structure Of The Human Ruvb-Like Helicase Ruvbl1 5e-14
2xsz_A 367 The Dodecameric Human Ruvbl1:ruvbl2 Complex With Tr 3e-13
3uk6_A 368 Crystal Structure Of The Tip48 (Tip49b) Hexamer Len 3e-06
2xsz_D 378 The Dodecameric Human Ruvbl1:ruvbl2 Complex With Tr 6e-06
>pdb|2C9O|A Chain A, 3d Structure Of The Human Ruvb-Like Helicase Ruvbl1 Length = 456 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 5e-14, Method: Composition-based stats. Identities = 36/47 (76%), Positives = 41/47 (87%) Query: 1 MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAARE 47 MKIEEVKST KTQRI+SHSHVKGLGL E+G A + A+GLVGQ+ ARE Sbjct: 1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENARE 47
>pdb|2XSZ|A Chain A, The Dodecameric Human Ruvbl1:ruvbl2 Complex With Truncated Domains Ii Length = 367 Back     alignment and structure
>pdb|3UK6|A Chain A, Crystal Structure Of The Tip48 (Tip49b) Hexamer Length = 368 Back     alignment and structure
>pdb|2XSZ|D Chain D, The Dodecameric Human Ruvbl1:ruvbl2 Complex With Truncated Domains Ii Length = 378 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 2e-18
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 3e-14
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Length = 368 Back     alignment and structure
 Score = 77.3 bits (190), Expect = 2e-18
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 1  MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQF 60
           K+ E++   + +RI +HSH++GLGL +  E  + + G+VGQ AAR  +      +  + 
Sbjct: 8  TKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAG--VVLEMIRE 65

Query: 61 ERCKSHS-LFRGGRAVAGGRTKCPK 84
           +    + L  G      G+T    
Sbjct: 66 GKIAGRAVLIAGQPGT--GKTAIAM 88


>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.56
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.52
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.69
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.61
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.27
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.18
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.17
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.06
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 96.04
3bos_A 242 Putative DNA replication factor; P-loop containing 95.92
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 95.92
3pvs_A 447 Replication-associated recombination protein A; ma 95.9
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.89
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.89
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 95.78
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 95.71
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.7
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.64
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.63
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.61
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.59
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 95.47
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 95.46
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.41
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 95.34
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 95.23
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.22
2chg_A 226 Replication factor C small subunit; DNA-binding pr 95.21
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.1
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 95.08
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 95.03
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 94.86
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 94.86
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 94.6
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 94.6
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 94.49
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.47
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.43
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 94.42
2chq_A 319 Replication factor C small subunit; DNA-binding pr 94.42
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.36
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 94.35
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.27
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 94.2
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.12
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 94.1
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 94.09
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 94.06
3co5_A143 Putative two-component system transcriptional RES 94.01
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 93.98
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.92
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 93.9
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.85
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.84
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 93.79
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 93.77
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 93.71
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 93.67
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 93.61
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.36
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 93.34
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 93.07
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.05
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 93.04
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 93.02
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 92.98
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.97
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 92.9
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.85
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.72
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 92.69
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.41
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 92.37
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 92.29
2cvh_A 220 DNA repair and recombination protein RADB; filamen 92.25
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 92.22
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 92.1
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 92.07
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 92.05
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 92.04
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 91.93
2kjq_A149 DNAA-related protein; solution structure, NESG, st 91.92
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 91.86
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.85
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 91.84
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.77
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 91.7
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 91.6
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 91.58
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 91.53
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 91.46
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 91.45
2vli_A 183 Antibiotic resistance protein; transferase, tunica 91.25
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.03
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.01
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.98
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 90.92
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 90.85
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 90.83
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.75
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 90.7
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 90.47
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.43
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 90.4
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 90.4
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 90.36
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 90.35
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 90.24
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 90.17
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.06
4a74_A 231 DNA repair and recombination protein RADA; hydrola 89.85
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 89.57
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 89.39
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 89.17
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 89.13
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 89.07
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 88.99
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 88.91
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 88.89
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 88.85
1tue_A 212 Replication protein E1; helicase, replication, E1E 88.82
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.47
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 88.43
2qgz_A 308 Helicase loader, putative primosome component; str 88.43
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.31
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 88.18
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.18
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 88.05
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 88.02
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 87.86
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 87.66
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 87.65
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 87.62
2z43_A 324 DNA repair and recombination protein RADA; archaea 87.43
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.25
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 87.05
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 87.03
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 86.9
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 86.75
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 86.64
1via_A 175 Shikimate kinase; structural genomics, transferase 86.53
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.46
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 86.26
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 86.22
2eyu_A 261 Twitching motility protein PILT; pilus retraction 86.19
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 86.03
2r6a_A 454 DNAB helicase, replicative helicase; replication, 85.99
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 85.65
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 85.57
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 85.3
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 85.29
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 85.22
2r2a_A 199 Uncharacterized protein; zonular occludens toxin, 85.14
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 85.12
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 85.12
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 85.03
1u94_A 356 RECA protein, recombinase A; homologous recombinat 84.85
2gxq_A 207 Heat resistant RNA dependent ATPase; RNA helicase, 84.76
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 84.68
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 84.63
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 84.62
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 84.61
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 84.59
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 84.58
1vec_A 206 ATP-dependent RNA helicase P54; DEAD-box protein, 84.56
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 84.44
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 84.05
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 83.95
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 83.81
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 83.7
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 83.62
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 83.52
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 83.44
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 83.37
2ewv_A 372 Twitching motility protein PILT; pilus retraction 83.35
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 83.21
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 83.18
1p9r_A 418 General secretion pathway protein E; bacterial typ 83.02
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 82.9
3kta_A 182 Chromosome segregation protein SMC; structural mai 82.83
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 82.48
2fna_A 357 Conserved hypothetical protein; structural genomic 82.33
1xp8_A 366 RECA protein, recombinase A; recombination, radior 82.03
1yks_A 440 Genome polyprotein [contains: flavivirin protease 81.97
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 81.95
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 81.83
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 81.7
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 81.41
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 81.33
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 81.25
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 81.12
3iuy_A 228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 80.98
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 80.93
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 80.9
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 80.62
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 80.59
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 80.3
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
Probab=99.56  E-value=2.1e-16  Score=125.13  Aligned_cols=77  Identities=53%  Similarity=0.683  Sum_probs=61.2

Q ss_pred             CccceeecceeeeeeccccccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCC
Q psy2779           1 MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRT   80 (101)
Q Consensus         1 ~~i~ev~~~~r~~RIaaHSHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p   80 (101)
                      |+++||+++.+.+|+++||||+|+||++...+.+..+.+|||+++++++..++++       ++.+. ..++-+|+.|||
T Consensus         1 ~~~~~~~~~~~~~~~~~~s~i~~~~l~~~~~~~~~~~~iiG~~~~~~~l~~~~~~-------~~~~~-~~~~~iLl~Gpp   72 (456)
T 2c9o_A            1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVEL-------IKSKK-MAGRAVLLAGPP   72 (456)
T ss_dssp             --------CHHHHHHHTTTTCCSCCBCTTSCBCSEETTEESCHHHHHHHHHHHHH-------HHTTC-CTTCEEEEECCT
T ss_pred             CCcccccccccccchhhhhcccCCCCCcccChhhchhhccCHHHHHHHHHHHHHH-------HHhCC-CCCCeEEEECCC
Confidence            5688999988999999999999999999999999999999999999999988888       44433 355678899999


Q ss_pred             CCCCC
Q psy2779          81 KCPKP   85 (101)
Q Consensus        81 ~~g~~   85 (101)
                      |||||
T Consensus        73 GtGKT   77 (456)
T 2c9o_A           73 GTGKT   77 (456)
T ss_dssp             TSSHH
T ss_pred             cCCHH
Confidence            99996



>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.64
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.56
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 97.37
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.27
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.69
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 96.56
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.53
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 96.51
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 96.43
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 96.41
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 96.21
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.15
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 96.11
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.04
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.95
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 95.94
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.9
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.88
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 95.79
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.75
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 95.71
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.46
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.25
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.14
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 95.08
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.06
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 94.9
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.7
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.43
d1yksa1 140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.34
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 94.33
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 94.17
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.14
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 93.89
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.75
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.61
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 93.49
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 93.12
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.85
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 92.75
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.29
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 92.08
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.82
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 91.76
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.7
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.56
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.23
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.63
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 90.56
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.46
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.81
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 88.9
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.66
d1okkd2 207 GTPase domain of the signal recognition particle r 88.6
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 88.47
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 87.06
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 86.59
d1j8yf2 211 GTPase domain of the signal sequence recognition p 85.49
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 85.41
d1ls1a2 207 GTPase domain of the signal sequence recognition p 84.98
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 84.32
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 83.95
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 83.01
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 82.95
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 82.6
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.2
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 80.57
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermotoga maritima [TaxId: 2336]
Probab=97.64  E-value=2.4e-06  Score=58.61  Aligned_cols=43  Identities=12%  Similarity=0.063  Sum_probs=28.9

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      -+-+|||+++.+.....++.       .+.+.. .-.-+|+.||||||||-
T Consensus         8 ~~divGqe~~~~~l~~~i~~-------~~~~~~-~~~~~L~~GPpGtGKT~   50 (238)
T d1in4a2           8 LDEFIGQENVKKKLSLALEA-------AKMRGE-VLDHVLLAGPPGLGKTT   50 (238)
T ss_dssp             GGGCCSCHHHHHHHHHHHHH-------HHHHTC-CCCCEEEESSTTSSHHH
T ss_pred             HHHcCChHHHHHHHHHHHHH-------HHhcCC-CCCeEEEECCCCCcHHH
Confidence            46699999999887766554       111110 12347899999999984



>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure