Psyllid ID: psy2807
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 288 | ||||||
| 345495993 | 1180 | PREDICTED: pyruvate carboxylase, mitocho | 0.774 | 0.188 | 0.391 | 1e-41 | |
| 345495991 | 1124 | PREDICTED: pyruvate carboxylase, mitocho | 0.774 | 0.198 | 0.391 | 1e-41 | |
| 156540073 | 1196 | PREDICTED: pyruvate carboxylase, mitocho | 0.774 | 0.186 | 0.391 | 1e-41 | |
| 158297962 | 1196 | AGAP004742-PA [Anopheles gambiae str. PE | 0.756 | 0.182 | 0.393 | 3e-40 | |
| 58390932 | 1180 | AGAP004742-PB [Anopheles gambiae str. PE | 0.756 | 0.184 | 0.393 | 4e-40 | |
| 312385557 | 975 | hypothetical protein AND_00634 [Anophele | 0.756 | 0.223 | 0.389 | 4e-40 | |
| 270005615 | 2284 | hypothetical protein TcasGA2_TC007694 [T | 0.777 | 0.098 | 0.373 | 7e-40 | |
| 91080283 | 2228 | PREDICTED: similar to carboxylase:pyruva | 0.777 | 0.100 | 0.373 | 7e-40 | |
| 170032630 | 1198 | pyruvate carboxylase, mitochondrial [Cul | 0.756 | 0.181 | 0.389 | 8e-40 | |
| 328699549 | 1196 | PREDICTED: pyruvate carboxylase, mitocho | 0.75 | 0.180 | 0.382 | 2e-39 |
| >gi|345495993|ref|XP_003427616.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 4 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 176 bits (445), Expect = 1e-41, Method: Compositional matrix adjust.
Identities = 103/263 (39%), Positives = 142/263 (53%), Gaps = 40/263 (15%)
Query: 27 IRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQ 86
I+ T +G + + + Q +K DV+E A+++ FPKSV F QG+IGEPYQGFP+ +
Sbjct: 907 IKVTPSSKVVGDLAQFMVQNKLKPADVLEKAEELSFPKSVVEFLQGAIGEPYQGFPEPFR 966
Query: 87 EKVL-------------------GSLKDHTLDRKPECD-----------------LMMED 110
KVL +LK + P L D
Sbjct: 967 SKVLKDMPRINGRPGESLPPLDFAALKARLQESHPRITDKDVMSAALYPEVTQDYLTFHD 1026
Query: 111 EFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQL 170
FGPVD+L TRIFL GP +GEEF + G T + TL+++E L +GER VFF NGQL
Sbjct: 1027 AFGPVDKLDTRIFLIGPKVGEEFEVTIEKGKTLGIKTLAMAEDLTPNGEREVFFEMNGQL 1086
Query: 171 RSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMK 230
RSV I+DK K+L + KA + +IGAPMPG +I+++ KVG V+K L+V+S MK
Sbjct: 1087 RSVFIKDKEAIKELHIHPKASKNDKNQIGAPMPGTVIDIRVKVGDTVEKGAALVVLSAMK 1146
Query: 231 TETLIHASADGVHKVRSSNLDYN 253
E ++ A G K++S LD N
Sbjct: 1147 MEMVVQAPRAG--KIKS--LDIN 1165
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345495991|ref|XP_003427615.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|156540073|ref|XP_001600219.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 1 [Nasonia vitripennis] gi|345495988|ref|XP_003427614.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|158297962|ref|XP_001689096.1| AGAP004742-PA [Anopheles gambiae str. PEST] gi|157014579|gb|EDO63513.1| AGAP004742-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|58390932|ref|XP_318078.2| AGAP004742-PB [Anopheles gambiae str. PEST] gi|55236884|gb|EAA13216.3| AGAP004742-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312385557|gb|EFR30026.1| hypothetical protein AND_00634 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|270005615|gb|EFA02063.1| hypothetical protein TcasGA2_TC007694 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91080283|ref|XP_973877.1| PREDICTED: similar to carboxylase:pyruvate/acetyl-coa/propionyl-coa [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170032630|ref|XP_001844183.1| pyruvate carboxylase, mitochondrial [Culex quinquefasciatus] gi|167873013|gb|EDS36396.1| pyruvate carboxylase, mitochondrial [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|328699549|ref|XP_003240969.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 288 | ||||||
| ZFIN|ZDB-GENE-090908-3 | 1181 | pcl "pyruvate carboxylase, lik | 0.461 | 0.112 | 0.496 | 7e-37 | |
| FB|FBgn0027580 | 1197 | CG1516 [Drosophila melanogaste | 0.482 | 0.116 | 0.446 | 1.6e-36 | |
| UNIPROTKB|E9PS68 | 298 | PC "Pyruvate carboxylase, mito | 0.461 | 0.446 | 0.466 | 1.7e-36 | |
| MGI|MGI:97520 | 1178 | Pcx "pyruvate carboxylase" [Mu | 0.461 | 0.112 | 0.459 | 3.1e-36 | |
| ZFIN|ZDB-GENE-000831-1 | 1181 | pc "pyruvate carboxylase" [Dan | 0.451 | 0.110 | 0.473 | 4.9e-36 | |
| UNIPROTKB|Q29RK2 | 1178 | PC "Pyruvate carboxylase, mito | 0.461 | 0.112 | 0.474 | 2.4e-34 | |
| UNIPROTKB|F1P6G9 | 1178 | PC "Pyruvate carboxylase" [Can | 0.461 | 0.112 | 0.474 | 2.4e-34 | |
| UNIPROTKB|P11498 | 1178 | PC "Pyruvate carboxylase, mito | 0.461 | 0.112 | 0.466 | 8.1e-34 | |
| RGD|3262 | 1178 | Pc "pyruvate carboxylase" [Rat | 0.461 | 0.112 | 0.466 | 1e-33 | |
| UNIPROTKB|F1RUV5 | 725 | PC "Uncharacterized protein" [ | 0.454 | 0.180 | 0.466 | 5.4e-32 |
| ZFIN|ZDB-GENE-090908-3 pcl "pyruvate carboxylase, like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 329 (120.9 bits), Expect = 7.0e-37, Sum P(2) = 7.0e-37
Identities = 67/135 (49%), Positives = 90/135 (66%)
Query: 112 FGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLR 171
FGPVD L TR+FL+GP I EEF E + G T ++ L++ + LN G+R VFF NGQLR
Sbjct: 1029 FGPVDCLDTRLFLDGPKIAEEFEVELERGKTLHIKALALGD-LNKAGQREVFFELNGQLR 1087
Query: 172 SVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKT 231
SVL++D K++ KA D G+IGAPMPG ++EVK K GQQV+K L V+S MK
Sbjct: 1088 SVLVKDTVAMKEMHFHPKALKDVRGQIGAPMPGKVVEVKVKQGQQVEKGQPLCVLSAMKM 1147
Query: 232 ETLIHASADG-VHKV 245
ET++++ G V K+
Sbjct: 1148 ETVVNSPISGTVAKI 1162
|
|
| FB|FBgn0027580 CG1516 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PS68 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97520 Pcx "pyruvate carboxylase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-000831-1 pc "pyruvate carboxylase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29RK2 PC "Pyruvate carboxylase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P6G9 PC "Pyruvate carboxylase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11498 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|3262 Pc "pyruvate carboxylase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUV5 PC "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 288 | |||
| COG1038 | 1149 | COG1038, PycA, Pyruvate carboxylase [Energy produc | 2e-52 | |
| TIGR01235 | 1143 | TIGR01235, pyruv_carbox, pyruvate carboxylase | 1e-51 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 3e-51 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 3e-15 | |
| pfam02436 | 198 | pfam02436, PYC_OADA, Conserved carboxylase domain | 6e-14 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 2e-11 | |
| PRK09282 | 592 | PRK09282, PRK09282, pyruvate carboxylase subunit B | 7e-11 | |
| PRK14040 | 593 | PRK14040, PRK14040, oxaloacetate decarboxylase; Pr | 7e-11 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 7e-10 | |
| TIGR01108 | 582 | TIGR01108, oadA, oxaloacetate decarboxylase alpha | 1e-08 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 2e-08 | |
| PRK14042 | 596 | PRK14042, PRK14042, pyruvate carboxylase subunit B | 8e-08 | |
| PRK05641 | 153 | PRK05641, PRK05641, putative acetyl-CoA carboxylas | 3e-06 | |
| PRK06549 | 130 | PRK06549, PRK06549, acetyl-CoA carboxylase biotin | 2e-05 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 6e-05 | |
| pfam13533 | 50 | pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like | 5e-04 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 0.003 |
| >gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
Score = 184 bits (468), Expect = 2e-52
Identities = 82/230 (35%), Positives = 114/230 (49%), Gaps = 38/230 (16%)
Query: 50 AKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHT------------ 97
+DV +A+ + FP SV +FF+G +G+P GFP+ LQ+KVL + T
Sbjct: 898 EEDVENDANDLDFPDSVVSFFRGELGQPPGGFPEPLQKKVLKGREPLTDRPGELLEPADF 957
Query: 98 ----------LDRKP-ECD----LM----------MEDEFGPVDRLPTRIFLNGPNIGEE 132
L R+ + D L+ + +G V LPT F G GEE
Sbjct: 958 EAIRKELEEKLGREVSDQDVASYLLYPKVFEDYQKHRETYGDVSVLPTPTFFYGLRPGEE 1017
Query: 133 FSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADS 192
E + G T + +I E ++ G RTV+F NGQ R + ++D++ + R KAD
Sbjct: 1018 IEVEIEKGKTLIIKLQAIGE-PDEKGMRTVYFELNGQPREIKVKDRSVGSSVVARRKADP 1076
Query: 193 DTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGV 242
G IGAPMPG ++EVK K G +VKK DVL V+ MK ET I A DG
Sbjct: 1077 GNPGHIGAPMPGVVVEVKVKKGDKVKKGDVLAVIEAMKMETTISAPFDGT 1126
|
Length = 1149 |
| >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|217032 pfam02436, PYC_OADA, Conserved carboxylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|205711 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 288 | |||
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 100.0 | |
| KOG0369|consensus | 1176 | 100.0 | ||
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 100.0 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 100.0 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 100.0 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 100.0 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 100.0 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 100.0 | |
| PF02436 | 196 | PYC_OADA: Conserved carboxylase domain; InterPro: | 99.97 | |
| PRK12330 | 499 | oxaloacetate decarboxylase; Provisional | 99.89 | |
| PRK14041 | 467 | oxaloacetate decarboxylase; Provisional | 99.88 | |
| COG5016 | 472 | Pyruvate/oxaloacetate carboxyltransferase [Energy | 99.88 | |
| PRK12331 | 448 | oxaloacetate decarboxylase; Provisional | 99.88 | |
| PRK12581 | 468 | oxaloacetate decarboxylase; Provisional | 99.87 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 99.87 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.84 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.81 | |
| KOG0238|consensus | 670 | 99.8 | ||
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.77 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.75 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.69 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.67 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.65 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.6 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.57 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.56 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.54 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.51 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.44 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.4 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.35 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 99.3 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 99.3 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 99.17 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 99.08 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.07 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.05 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 99.02 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 98.97 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 98.96 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 98.94 | |
| KOG0368|consensus | 2196 | 98.9 | ||
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 98.9 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 98.9 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 98.87 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 98.87 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 98.74 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 98.66 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 98.63 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 98.58 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 98.5 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 98.5 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 98.49 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.45 | |
| KOG0559|consensus | 457 | 98.43 | ||
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 98.42 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 98.34 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 98.33 | |
| KOG0557|consensus | 470 | 98.33 | ||
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 98.29 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 98.28 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 98.26 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 98.21 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 98.2 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 98.19 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 98.17 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 98.14 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 98.07 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 98.04 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 98.02 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 98.0 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.97 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 97.82 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 97.81 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 97.66 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.53 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 97.46 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.45 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.45 | |
| KOG0558|consensus | 474 | 97.39 | ||
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.24 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 97.22 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.2 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.19 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.18 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 96.98 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.96 | |
| PRK07051 | 80 | hypothetical protein; Validated | 96.95 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 96.82 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 96.71 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 96.68 | |
| PRK06748 | 83 | hypothetical protein; Validated | 96.57 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 96.53 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 96.5 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 96.48 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 96.38 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 96.35 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 96.34 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 96.32 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 96.3 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 96.26 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 96.09 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 96.0 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 95.85 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 95.75 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 95.64 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 95.64 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 95.62 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 95.59 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 95.29 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 95.23 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 95.11 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 95.1 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 95.09 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 95.05 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 94.87 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 94.78 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.67 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 94.32 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 94.25 | |
| PF06898 | 385 | YqfD: Putative stage IV sporulation protein YqfD; | 94.08 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 93.88 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 93.84 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 93.61 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 93.59 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 93.44 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 93.42 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 93.26 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 93.17 | |
| TIGR02876 | 382 | spore_yqfD sporulation protein YqfD. YqfD is part | 93.13 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 92.88 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 92.75 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 92.72 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 92.72 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 92.69 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 92.55 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 92.53 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 92.45 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 92.38 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 92.23 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 92.04 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 92.02 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 91.96 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 91.95 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 91.93 | |
| KOG3373|consensus | 172 | 91.88 | ||
| KOG0559|consensus | 457 | 91.86 | ||
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 91.82 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 91.8 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 91.8 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 91.71 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 91.69 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 91.67 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 91.62 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 91.62 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 91.55 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 91.17 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 90.85 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 90.85 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 90.67 | |
| TIGR01995 | 610 | PTS-II-ABC-beta PTS system, beta-glucoside-specifi | 89.83 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 89.64 | |
| PF01551 | 96 | Peptidase_M23: Peptidase family M23; InterPro: IPR | 88.85 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 88.59 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 88.55 | |
| PRK10255 | 648 | PTS system N-acetyl glucosamine specific transport | 88.18 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 88.16 | |
| PRK09824 | 627 | PTS system beta-glucoside-specific transporter sub | 88.08 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 87.52 | |
| PRK10255 | 648 | PTS system N-acetyl glucosamine specific transport | 87.31 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 87.25 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 86.78 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 86.77 | |
| PRK09824 | 627 | PTS system beta-glucoside-specific transporter sub | 86.53 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 86.19 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 85.42 | |
| KOG0369|consensus | 1176 | 84.48 | ||
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 83.25 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 82.51 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 82.46 | |
| TIGR01995 | 610 | PTS-II-ABC-beta PTS system, beta-glucoside-specifi | 82.1 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 81.57 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 81.52 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 80.99 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 80.63 | |
| PRK03934 | 265 | phosphatidylserine decarboxylase; Provisional | 80.07 |
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.3e-61 Score=479.35 Aligned_cols=241 Identities=34% Similarity=0.515 Sum_probs=226.0
Q ss_pred CCCCceeecccccchhhhHHHHHhccCchhhhhhcccccccchhHHHHhccccCCCCCCCCHhHHHHhhCCCCcc-----
Q psy2807 22 TSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDH----- 96 (288)
Q Consensus 22 ~~G~iv~VTPsSqiVG~~A~~~V~N~l~~e~~~~~~~~~~~p~svv~~l~G~yG~Pp~gf~~~l~~~vL~g~~~i----- 96 (288)
=+|||||||||||+|||+|+|||+|.||.+++.++++.++||+||++||+|.+||||+|||++||+++|+|++|+
T Consensus 870 mfGdivKVTPSSKVVGDmAl~MV~n~Lt~~dv~~~~~~l~fPdSVv~ff~G~lGqP~gGfPe~Lqk~vLkg~~p~t~Rpg 949 (1149)
T COG1038 870 MFGDIVKVTPSSKVVGDLALFMVQNDLTEEDVENDANDLDFPDSVVSFFRGELGQPPGGFPEPLQKKVLKGREPLTDRPG 949 (1149)
T ss_pred HhCCceEecccchhHHHHHHHHHhcCCCHHHHhcccccCCCcHHHHHHhhcccCCCCCCCCHHHHHHHhcCCCccccCcc
Confidence 379999999999999999999999999999999999999999999999999999999999999999999999888
Q ss_pred --------------cccc----CCccccee--------------ecccCCCCCCCcccccCCCCCCceeeeeecCCceEE
Q psy2807 97 --------------TLDR----KPECDLMM--------------EDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAY 144 (288)
Q Consensus 97 --------------L~~~----~~deDvL~--------------~a~fg~~~~l~t~~F~~g~~~gee~~v~~~~Gk~~~ 144 (288)
|+++ .++.|++. ...||++++|||+.|||||..||+++++++.||++.
T Consensus 950 ~~l~~~d~~a~r~~l~~~~~~~~~d~d~~sy~lyPkvf~dy~~~~~~yGd~S~L~t~~ff~gm~~gEe~~v~ie~GktLi 1029 (1149)
T COG1038 950 ELLEPADFEAIRKELEEKLGREVSDQDVASYLLYPKVFEDYQKHRETYGDVSVLPTPTFFYGLRPGEEIEVEIEKGKTLI 1029 (1149)
T ss_pred ccCCccchHHHHHHHHHHhCCCchhHHHHHHHhcchhHHHHHHHHHhcCCccccCcchhhccCCCCceEEEEecCCcEEE
Confidence 1112 46777773 445899999999999999999999999999999999
Q ss_pred EEEeecccccccCCceEEEEEeCCEEEEEEEeccchhhhhhccccCCCCCCCeeecCCcEEEEEEecCCCCEEecCCEEE
Q psy2807 145 VTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLI 224 (288)
Q Consensus 145 v~l~~~~~~~~~~~~~~~~~~vnG~~~~v~v~~~~~~~~~~~~~~a~~~~~~~i~apm~G~V~~v~V~~Gd~V~~G~~l~ 224 (288)
|++.+++ ++++.|.++++|++||+.|++.|+|.+.......++||+.+|+++|.|||||+|+++.|++||.|++||+|+
T Consensus 1030 i~l~aig-e~d~~G~r~v~felNGq~R~i~v~Drs~~~~~~~r~KAd~~Np~higApmpG~Vv~v~V~~G~~Vk~Gd~l~ 1108 (1149)
T COG1038 1030 IKLQAIG-EPDEKGMRTVYFELNGQPREIKVKDRSVGSSVVARRKADPGNPGHIGAPMPGVVVEVKVKKGDKVKKGDVLA 1108 (1149)
T ss_pred EEecccC-CCCcCCcEEEEEEeCCceeeeeecccccccccccccccCCCCccccCCCCCCceEEEEEccCCeecCCCeee
Confidence 9999999 999999999999999999999999987666666778999999999999999999999999999999999999
Q ss_pred EEeccceeEEEEcCCCeEEEEEeeCCCCeecc-ceeEEEe
Q psy2807 225 VMSVMKTETLIHASADGVHKVRSSNLDYNFMR-PLQLSLN 263 (288)
Q Consensus 225 ~lEamKme~~I~Ap~~G~V~~i~v~~Gd~V~~-~~L~~i~ 263 (288)
++||||||+.|.||+||+|.+++|+.||+|.. ++|.+++
T Consensus 1109 ~ieAMKMEt~i~Ap~dG~i~~v~V~~gd~i~~gDLLi~~~ 1148 (1149)
T COG1038 1109 VIEAMKMETTISAPFDGTVKEVLVKDGDQIDGGDLLVVVE 1148 (1149)
T ss_pred ehhhhhhceeeecCCCceEeEEEecCCCccccCceEEEcc
Confidence 99999999999999999999999999999999 9998875
|
|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PF02436 PYC_OADA: Conserved carboxylase domain; InterPro: IPR003379 This domain represents a conserved region in pyruvate carboxylase (PYC) (6 | Back alignment and domain information |
|---|
| >PRK12330 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK14041 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12331 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12581 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0368|consensus | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >KOG0557|consensus | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0558|consensus | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >TIGR02876 spore_yqfD sporulation protein YqfD | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >KOG3373|consensus | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >PF01551 Peptidase_M23: Peptidase family M23; InterPro: IPR016047 Members of this family are zinc metallopeptidases with a range of specificities | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK03934 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 288 | ||||
| 3bg3_A | 718 | Crystal Structure Of Human Pyruvate Carboxylase (Mi | 3e-34 | ||
| 3bg9_A | 718 | Crystal Structure Of Human Pyruvate Carboxylase (Mi | 3e-33 | ||
| 3hb9_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 5e-24 | ||
| 3hbl_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 5e-24 | ||
| 3ho8_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 5e-24 | ||
| 4hnu_A | 1173 | Crystal Structure Of K442e Mutant Of S. Aureus Pyru | 5e-24 | ||
| 4hnv_A | 1173 | Crystal Structure Of R54e Mutant Of S. Aureus Pyruv | 5e-24 | ||
| 4hnt_A | 1173 | Crystal Structure Of F403a Mutant Of S. Aureus Pyru | 5e-24 | ||
| 3bg5_A | 1173 | Crystal Structure Of Staphylococcus Aureus Pyruvate | 6e-24 | ||
| 3tw7_A | 1165 | Structure Of Rhizobium Etli Pyruvate Carboxylase T8 | 3e-23 | ||
| 2qf7_A | 1165 | Crystal Structure Of A Complete Multifunctional Pyr | 3e-23 | ||
| 3n6r_A | 681 | Crystal Structure Of The Holoenzyme Of Propionyl-co | 2e-04 |
| >pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 | Back alignment and structure |
|
| >pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 | Back alignment and structure |
| >pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 | Back alignment and structure |
| >pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 | Back alignment and structure |
| >pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 | Back alignment and structure |
| >pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 | Back alignment and structure |
| >pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 | Back alignment and structure |
| >pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 288 | |||
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 3e-62 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 5e-60 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 4e-56 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 8e-20 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 8e-19 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 2e-17 | |
| 1rqb_A | 539 | Transcarboxylase 5S subunit; TIM-barrel, carbamyla | 3e-17 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 5e-17 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 5e-16 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 6e-15 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 1e-14 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 2e-11 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 1e-10 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 5e-10 | |
| 2nx9_A | 464 | Oxaloacetate decarboxylase 2, subunit alpha; carbo | 7e-07 |
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
Score = 211 bits (539), Expect = 3e-62
Identities = 70/232 (30%), Positives = 105/232 (45%), Gaps = 38/232 (16%)
Query: 48 IKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHT---------- 97
+ + V+ + K+ FP+SV +FF+G IG+P GF K LQ +L + T
Sbjct: 894 LDEQSVITDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPV 953
Query: 98 ------------LDRKP-ECDLMM--------------EDEFGPVDRLPTRIFLNGPNIG 130
E D++ +++G + L T F G G
Sbjct: 954 DFEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNG 1013
Query: 131 EEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKA 190
E E G + +ISE +++G RT+++ NGQ R + I+D+N ++ KA
Sbjct: 1014 ETVEIEIDKGKRLIIKLETISE-PDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKA 1072
Query: 191 DSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGV 242
D IGA MPG++ EVK VG+ VK N L++ MK ET I A DGV
Sbjct: 1073 DKSNPSHIGAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGV 1124
|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Length = 539 | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Length = 464 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 288 | |||
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 100.0 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 100.0 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 100.0 | |
| 1rqb_A | 539 | Transcarboxylase 5S subunit; TIM-barrel, carbamyla | 99.84 | |
| 2nx9_A | 464 | Oxaloacetate decarboxylase 2, subunit alpha; carbo | 99.82 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.82 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.75 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.66 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.64 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.63 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.62 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.6 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.59 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.59 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.58 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.58 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.56 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.55 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.55 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.54 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.52 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.52 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.51 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.51 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.5 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.49 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.48 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.43 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 99.21 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 99.14 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.13 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.1 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.87 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.76 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.73 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 98.48 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 98.47 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 98.45 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 98.43 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 98.32 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 98.23 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 98.11 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 98.11 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.97 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 97.73 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.72 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 97.68 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 97.68 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 97.64 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 97.44 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 97.06 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 97.03 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 96.95 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 96.92 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.9 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 96.83 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 96.77 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 96.69 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 96.62 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 96.54 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 96.3 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 96.29 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 96.26 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 96.08 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 95.9 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 95.65 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 95.65 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 95.54 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 95.52 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 95.44 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 95.44 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 95.33 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 95.22 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 95.18 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 95.17 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 94.9 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 94.87 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 94.66 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 94.64 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 94.16 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 93.99 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 93.82 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 93.25 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 92.5 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 92.14 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 92.03 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 91.88 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 91.39 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 90.22 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 89.15 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 88.62 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 87.92 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 87.41 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 87.2 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 87.19 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 87.04 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 85.84 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 83.38 | |
| 3it5_A | 182 | Protease LASA; metallopeptidase, beta-protein, cel | 81.47 |
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.7e-53 Score=454.11 Aligned_cols=243 Identities=30% Similarity=0.463 Sum_probs=221.1
Q ss_pred CCCCCceeecccccchhhhHHHHHhccCchhhhhhcccccccchhHHHHhccccCCCCCCCCHhHHHHhhCCCCcc----
Q psy2807 21 HTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDH---- 96 (288)
Q Consensus 21 ~~~G~iv~VTPsSqiVG~~A~~~V~N~l~~e~~~~~~~~~~~p~svv~~l~G~yG~Pp~gf~~~l~~~vL~g~~~i---- 96 (288)
.++|||||||||||||||||+|||+|+|+++++.++++.++||+|+++||+|+||+||+|||++|++++|+|++++
T Consensus 867 ~~~g~~~~vtp~sq~vg~~a~~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~G~~g~~~~~~~~~~~~~~~~~~~~~~~rp 946 (1150)
T 3hbl_A 867 FLFGDIVKVAPSSKVVGDMALYMVQNDLDEQSVITDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARP 946 (1150)
T ss_dssp HHTTSCCCCTTHHHHHHHHHHHHHHTTCCTTHHHHSGGGCCCCHHHHHHTTTSSCCCTTCCCHHHHHHHHTTCCCCSSCG
T ss_pred HHcCCCceECchhHHHHHHHHHHHHcCCChhhhhcccccccCCHHHHHHhCcCCCCCCCCCCHHHHHHHhcCCCCccCCc
Confidence 3689999999999999999999999999999999888889999999999999999999999999999999998776
Q ss_pred ---c--------ccc--------CCcccceeec--------------ccCCCCCCCcccccCCCCCCceeeeeecCCceE
Q psy2807 97 ---T--------LDR--------KPECDLMMED--------------EFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTA 143 (288)
Q Consensus 97 ---L--------~~~--------~~deDvL~~a--------------~fg~~~~l~t~~F~~g~~~gee~~v~~~~Gk~~ 143 (288)
| +++ .++||+|.|+ .||+++.|||+.||+|++.||++++++++||++
T Consensus 947 ~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~ 1026 (1150)
T 3hbl_A 947 GEYLEPVDFEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNGETVEIEIDKGKRL 1026 (1150)
T ss_dssp GGGSCCCCHHHHHHHHHHHSCSCCCHHHHHHHHHSHHHHHHHHHHHHHHCCGGGSCHHHHHHCCCTTCEEEEEEETTEEE
T ss_pred cccCChhhHHHHHHHHHHhhCCCCCHHHHHHHHcCCHHHHHHHHHHHhcCCcccCCchhhhcCCCCCceEEEEccCCcEE
Confidence 1 111 4789999544 478999999999999999999999999999999
Q ss_pred EEEEeecccccccCCceEEEEEeCCEEEEEEEeccchhhhhhccccCCCCCCCeeecCCcEEEEEEecCCCCEEecCCEE
Q psy2807 144 YVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVL 223 (288)
Q Consensus 144 ~v~l~~~~~~~~~~~~~~~~~~vnG~~~~v~v~~~~~~~~~~~~~~a~~~~~~~i~apm~G~V~~v~V~~Gd~V~~G~~l 223 (288)
.|++.+++ .+++.|.++++|++||+.+++.|.+..........+++++.+..+|.|||+|+|++|+|++||.|++||+|
T Consensus 1027 ~i~l~~~~-~~~~~g~~~~~~e~nG~~~~v~v~~~~~~~~~~~~~~~~~~~~~~v~ap~~G~v~~~~v~~Gd~V~~G~~l 1105 (1150)
T 3hbl_A 1027 IIKLETIS-EPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADKSNPSHIGAQMPGSVTEVKVSVGETVKANQPL 1105 (1150)
T ss_dssp EEEEEEEC-CCCTTSEEEEEEEETTEEEEEEEECCCSSSCCCCCCBCCTTCSSEEECSSSEEEEEECCCTTCEECTTCEE
T ss_pred EEEecccC-CCCCCCceEEEEEECCeEEEEecccccccccccccccCCCCCCceeecCceEEEEEEEeCCCCEECCCCEE
Confidence 99999998 78888999999999999999999987643333344667777889999999999999999999999999999
Q ss_pred EEEeccceeEEEEcCCCeEEEEEeeCCCCeecc-ceeEEEec
Q psy2807 224 IVMSVMKTETLIHASADGVHKVRSSNLDYNFMR-PLQLSLNG 264 (288)
Q Consensus 224 ~~lEamKme~~I~Ap~~G~V~~i~v~~Gd~V~~-~~L~~i~~ 264 (288)
++|||||||++|+||.+|+|.++++++||.|.. ++|++|++
T Consensus 1106 ~~ieamK~~~~i~ap~~G~v~~i~v~~G~~V~~g~~l~~i~~ 1147 (1150)
T 3hbl_A 1106 LITEAMKMETTIQAPFDGVIKQVTVNNGDTIATGDLLIEIEK 1147 (1150)
T ss_dssp EEEESSSCEEEEECSSSEEEEEECCCTTCEECTTBEEEEEC-
T ss_pred EEEEeccceeEEecCCCeEEEEEEeCCCCEeCCCCEEEEEec
Confidence 999999999999999999999999999999999 99999975
|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* | Back alignment and structure |
|---|
| >2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell out membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa} PDB: 3it7_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 288 | ||||
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 4e-12 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-04 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 4e-04 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 8e-04 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 0.001 | |
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 0.001 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 0.002 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 0.004 |
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) species: Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]
Score = 58.4 bits (141), Expect = 4e-12
Identities = 20/55 (36%), Positives = 29/55 (52%)
Query: 188 SKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGV 242
+ A GEI AP+ G + ++ K G VK ++V+ MK ET I+A DG
Sbjct: 1 AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGK 55
|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 288 | |||
| d1rqba1 | 168 | Transcarboxylase 5S subunit, C-terminal domain {Pr | 99.87 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.84 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.79 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.71 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.62 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.61 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.59 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.56 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.52 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.43 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.42 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 97.94 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 97.46 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 97.4 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 97.36 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 97.12 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 96.92 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.85 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 96.83 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 96.62 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.38 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.97 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.9 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 94.82 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 94.63 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.35 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 94.14 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 93.96 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 93.77 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 92.21 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 91.36 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 88.62 | |
| d2tpta3 | 105 | Thymidine phosphorylase {Escherichia coli [TaxId: | 82.48 |
| >d1rqba1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RuvA C-terminal domain-like superfamily: post-HMGL domain-like family: Conserved carboxylase domain domain: Transcarboxylase 5S subunit, C-terminal domain species: Propionibacterium freudenreichii shermanii [TaxId: 1752]
Probab=99.87 E-value=6.4e-24 Score=180.82 Aligned_cols=92 Identities=12% Similarity=0.065 Sum_probs=78.8
Q ss_pred CCCCCceeecccccchhhhHHHHHhccCchhhhhhcccccccchhHHHHhccccCCCCCCCCHhHHHHh--hCCCCcc--
Q psy2807 21 HTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKV--LGSLKDH-- 96 (288)
Q Consensus 21 ~~~G~iv~VTPsSqiVG~~A~~~V~N~l~~e~~~~~~~~~~~p~svv~~l~G~yG~Pp~gf~~~l~~~v--L~g~~~i-- 96 (288)
..+|||||||||||||||||+|||+|. +|+ .+|+|+++|++|+||+||++|++++++++ ++|++++
T Consensus 34 ~~lG~~~~VTPsSqvVG~~A~~nV~~g----~~~------~~~~e~~~~~~G~~G~~P~~~~~~~~k~~~~~~g~~pit~ 103 (168)
T d1rqba1 34 KAAGFPPLVTPSSQIVGTQAVFNVMMG----EYK------RMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQ 103 (168)
T ss_dssp HHTTCCCCCTTHHHHHHHHHHHHHHHC----TTS------SCCHHHHHHHTTTTCCCSSCCCHHHHHHHHHHHCCCCCCS
T ss_pred HhcCCCceeCcHHHHHHHHHHHHHHhh----hcc------cccHHHHHHhcccccCCCCCCCHHHHHHHHhccCCCCCCC
Confidence 468999999999999999999987774 466 89999999999999999999999999866 6688777
Q ss_pred ----------------cccc----CCcccceeecccCCCCCCCcccccCC
Q psy2807 97 ----------------TLDR----KPECDLMMEDEFGPVDRLPTRIFLNG 126 (288)
Q Consensus 97 ----------------L~~~----~~deDvL~~a~fg~~~~l~t~~F~~g 126 (288)
+.+. .++||+|.|++||++. ..|+..
T Consensus 104 RPgd~l~pd~~~~~~el~~~~g~~~sdedlLsyaLyP~V~----~~f~~~ 149 (168)
T d1rqba1 104 RPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVA----PVFFEH 149 (168)
T ss_dssp CGGGGCCCCHHHHHHHHTTSTTCCSSHHHHHHHHHCTTTH----HHHHHH
T ss_pred CchhhccccHHHHHHHHHHHhCCCCCHHHHHHHHcCChhH----HHHHHH
Confidence 1111 6899999999999988 788753
|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|