Psyllid ID: psy2807


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MNVPADVKDEVDVPVNVSPPHTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHTLDRKPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTFGRGTQISSAQFEWCT
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHccccccccccHHHHHHHccccccccccccHHHHHHHHccccccccccccccccccHHcccccccccHHHHccccccccEEEEEcccccEEEEEEEEEcccccccccEEEEEEEccEEEEEEEEcccHHHHHHcccccccccccccccccccEEEEEEcccccEEccccEEEEEEEcccccEEEcccccEEEEEEccccccccccEEEEEcccccccccccccccEEEccccEEcc
cccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccHccccccccEEEEEEccccEEEEEEEEEccccccccEEEEEEEEcccEEEEEEEccccEEEEEEccccccccccccccccccEEEEEEEEcccEEcccccEEEEEHcEEEEEEEcccccEEEEEEEcccccccccEEEEEEccccccccccccccEEcccEEEEcc
mnvpadvkdevdvpvnvspphtsavpirstrgwVWIGYIEECLRQLLIKAKDVMenadkiifpksvsaffqgsigepyqgfpkKLQEKVLGSlkdhtldrkpecdlmmedefgpvdrlptriflngpnigeefscefktgdtaYVTTLSISErlndhgertVFFLYNGQLRSVLIRDKNQAKKLKLrskadsdtageigapmpgnIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGvhkvrssnldynfmrplqlslngvrktdpltfgrgtqissaqfewct
mnvpadvkdevdvpvnvspphtsavpirstrgwVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHTLDRKPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDknqakklklrskadsdtageigapmpgNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTfgrgtqissaqfewct
MNVPADVKDEVDVPVNVSPPHTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHTLDRKPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTFGRGTQISSAQFEWCT
************************VPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSL**********CDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIR***************************GNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTFGRG************
****ADVKDEVDVPVNVSPPHTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQE*************KPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLI**************************MPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGV***********TQISSAQFEWCT
********DEVDVPVNVSPPHTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHTLDRKPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQ*************TAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTFGRGTQISSAQFEWCT
*******KDEVDVPVNVSPP*TSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHTLDRKPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTFGRGTQISSAQFEWCT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVPADVKDEVDVPVNVSPPHTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHTLDRKPECDLMMEDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGVHKVRSSNLDYNFMRPLQLSLNGVRKTDPLTFGRGTQISSAQFEWCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
Q29RK21178 Pyruvate carboxylase, mit yes N/A 0.656 0.160 0.380 1e-33
P114981178 Pyruvate carboxylase, mit yes N/A 0.652 0.159 0.366 3e-33
Q059201178 Pyruvate carboxylase, mit yes N/A 0.656 0.160 0.380 4e-33
P528731178 Pyruvate carboxylase, mit yes N/A 0.656 0.160 0.385 5e-33
O177321175 Pyruvate carboxylase 1 OS yes N/A 0.743 0.182 0.344 2e-31
Q8X1T31175 Pyruvate carboxylase OS=P N/A N/A 0.670 0.164 0.334 1e-28
Q9UUE11185 Pyruvate carboxylase OS=S yes N/A 0.725 0.176 0.313 1e-27
Q0CLK11193 Pyruvate carboxylase OS=A N/A N/A 0.666 0.160 0.327 4e-26
O939181193 Pyruvate carboxylase OS=A N/A N/A 0.666 0.160 0.327 4e-26
Q9HES81192 Pyruvate carboxylase OS=A yes N/A 0.666 0.161 0.323 9e-26
>sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 Back     alignment and function desciption
 Score =  144 bits (362), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 119/231 (51%), Gaps = 42/231 (18%)

Query: 62   FPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSL------------------------KDHT 97
            FP+SV  F QG IG P+ GFP+ L+ KVL  L                        + H 
Sbjct: 940  FPRSVVEFLQGYIGIPHGGFPEPLRSKVLKDLPRVEGRPGASLPPLDLQALEKELTERHG 999

Query: 98   LDRKPECDL---MMED----------EFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAY 144
             +  PE  L   M  D           FGP+D L TR+FL GP I EEF  E + G T +
Sbjct: 1000 EEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLH 1059

Query: 145  VTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPG 204
            +  L+IS+ LN  G+R VFF  NGQLRS+L++D    K++    KA  D  G+IGAPMPG
Sbjct: 1060 IKALAISD-LNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPG 1118

Query: 205  NIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADG----VHKVRSSNLD 251
             +I++K   G +V K   L V+S MK ET++ +  +G    VH  +   L+
Sbjct: 1119 KVIDIKVAAGAKVTKGQPLCVLSAMKMETVVTSPVEGTVRKVHVTKDMTLE 1169




Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
Bos taurus (taxid: 9913)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 1
>sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 Back     alignment and function description
>sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 Back     alignment and function description
>sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 Back     alignment and function description
>sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 Back     alignment and function description
>sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 Back     alignment and function description
>sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 Back     alignment and function description
>sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 Back     alignment and function description
>sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 Back     alignment and function description
>sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
345495993 1180 PREDICTED: pyruvate carboxylase, mitocho 0.774 0.188 0.391 1e-41
345495991 1124 PREDICTED: pyruvate carboxylase, mitocho 0.774 0.198 0.391 1e-41
156540073 1196 PREDICTED: pyruvate carboxylase, mitocho 0.774 0.186 0.391 1e-41
158297962 1196 AGAP004742-PA [Anopheles gambiae str. PE 0.756 0.182 0.393 3e-40
58390932 1180 AGAP004742-PB [Anopheles gambiae str. PE 0.756 0.184 0.393 4e-40
312385557 975 hypothetical protein AND_00634 [Anophele 0.756 0.223 0.389 4e-40
270005615 2284 hypothetical protein TcasGA2_TC007694 [T 0.777 0.098 0.373 7e-40
91080283 2228 PREDICTED: similar to carboxylase:pyruva 0.777 0.100 0.373 7e-40
170032630 1198 pyruvate carboxylase, mitochondrial [Cul 0.756 0.181 0.389 8e-40
328699549 1196 PREDICTED: pyruvate carboxylase, mitocho 0.75 0.180 0.382 2e-39
>gi|345495993|ref|XP_003427616.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 103/263 (39%), Positives = 142/263 (53%), Gaps = 40/263 (15%)

Query: 27   IRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQ 86
            I+ T     +G + + + Q  +K  DV+E A+++ FPKSV  F QG+IGEPYQGFP+  +
Sbjct: 907  IKVTPSSKVVGDLAQFMVQNKLKPADVLEKAEELSFPKSVVEFLQGAIGEPYQGFPEPFR 966

Query: 87   EKVL-------------------GSLKDHTLDRKPECD-----------------LMMED 110
             KVL                    +LK    +  P                    L   D
Sbjct: 967  SKVLKDMPRINGRPGESLPPLDFAALKARLQESHPRITDKDVMSAALYPEVTQDYLTFHD 1026

Query: 111  EFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQL 170
             FGPVD+L TRIFL GP +GEEF    + G T  + TL+++E L  +GER VFF  NGQL
Sbjct: 1027 AFGPVDKLDTRIFLIGPKVGEEFEVTIEKGKTLGIKTLAMAEDLTPNGEREVFFEMNGQL 1086

Query: 171  RSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMK 230
            RSV I+DK   K+L +  KA  +   +IGAPMPG +I+++ KVG  V+K   L+V+S MK
Sbjct: 1087 RSVFIKDKEAIKELHIHPKASKNDKNQIGAPMPGTVIDIRVKVGDTVEKGAALVVLSAMK 1146

Query: 231  TETLIHASADGVHKVRSSNLDYN 253
             E ++ A   G  K++S  LD N
Sbjct: 1147 MEMVVQAPRAG--KIKS--LDIN 1165




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345495991|ref|XP_003427615.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156540073|ref|XP_001600219.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 1 [Nasonia vitripennis] gi|345495988|ref|XP_003427614.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|158297962|ref|XP_001689096.1| AGAP004742-PA [Anopheles gambiae str. PEST] gi|157014579|gb|EDO63513.1| AGAP004742-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|58390932|ref|XP_318078.2| AGAP004742-PB [Anopheles gambiae str. PEST] gi|55236884|gb|EAA13216.3| AGAP004742-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312385557|gb|EFR30026.1| hypothetical protein AND_00634 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|270005615|gb|EFA02063.1| hypothetical protein TcasGA2_TC007694 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080283|ref|XP_973877.1| PREDICTED: similar to carboxylase:pyruvate/acetyl-coa/propionyl-coa [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170032630|ref|XP_001844183.1| pyruvate carboxylase, mitochondrial [Culex quinquefasciatus] gi|167873013|gb|EDS36396.1| pyruvate carboxylase, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328699549|ref|XP_003240969.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
ZFIN|ZDB-GENE-090908-31181 pcl "pyruvate carboxylase, lik 0.461 0.112 0.496 7e-37
FB|FBgn00275801197 CG1516 [Drosophila melanogaste 0.482 0.116 0.446 1.6e-36
UNIPROTKB|E9PS68298 PC "Pyruvate carboxylase, mito 0.461 0.446 0.466 1.7e-36
MGI|MGI:975201178 Pcx "pyruvate carboxylase" [Mu 0.461 0.112 0.459 3.1e-36
ZFIN|ZDB-GENE-000831-11181 pc "pyruvate carboxylase" [Dan 0.451 0.110 0.473 4.9e-36
UNIPROTKB|Q29RK21178 PC "Pyruvate carboxylase, mito 0.461 0.112 0.474 2.4e-34
UNIPROTKB|F1P6G91178 PC "Pyruvate carboxylase" [Can 0.461 0.112 0.474 2.4e-34
UNIPROTKB|P114981178 PC "Pyruvate carboxylase, mito 0.461 0.112 0.466 8.1e-34
RGD|32621178 Pc "pyruvate carboxylase" [Rat 0.461 0.112 0.466 1e-33
UNIPROTKB|F1RUV5725 PC "Uncharacterized protein" [ 0.454 0.180 0.466 5.4e-32
ZFIN|ZDB-GENE-090908-3 pcl "pyruvate carboxylase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 329 (120.9 bits), Expect = 7.0e-37, Sum P(2) = 7.0e-37
 Identities = 67/135 (49%), Positives = 90/135 (66%)

Query:   112 FGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLR 171
             FGPVD L TR+FL+GP I EEF  E + G T ++  L++ + LN  G+R VFF  NGQLR
Sbjct:  1029 FGPVDCLDTRLFLDGPKIAEEFEVELERGKTLHIKALALGD-LNKAGQREVFFELNGQLR 1087

Query:   172 SVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKT 231
             SVL++D    K++    KA  D  G+IGAPMPG ++EVK K GQQV+K   L V+S MK 
Sbjct:  1088 SVLVKDTVAMKEMHFHPKALKDVRGQIGAPMPGKVVEVKVKQGQQVEKGQPLCVLSAMKM 1147

Query:   232 ETLIHASADG-VHKV 245
             ET++++   G V K+
Sbjct:  1148 ETVVNSPISGTVAKI 1162


GO:0016874 "ligase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004075 "biotin carboxylase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006094 "gluconeogenesis" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0004736 "pyruvate carboxylase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0027580 CG1516 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E9PS68 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97520 Pcx "pyruvate carboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000831-1 pc "pyruvate carboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RK2 PC "Pyruvate carboxylase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6G9 PC "Pyruvate carboxylase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P11498 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|3262 Pc "pyruvate carboxylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUV5 PC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy produc 2e-52
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-51
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 3e-51
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 3e-15
pfam02436198 pfam02436, PYC_OADA, Conserved carboxylase domain 6e-14
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 2e-11
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B 7e-11
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 7e-11
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 7e-10
TIGR01108582 TIGR01108, oadA, oxaloacetate decarboxylase alpha 1e-08
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 2e-08
PRK14042596 PRK14042, PRK14042, pyruvate carboxylase subunit B 8e-08
PRK05641153 PRK05641, PRK05641, putative acetyl-CoA carboxylas 3e-06
PRK06549130 PRK06549, PRK06549, acetyl-CoA carboxylase biotin 2e-05
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 6e-05
pfam1353350 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like 5e-04
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 0.003
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
 Score =  184 bits (468), Expect = 2e-52
 Identities = 82/230 (35%), Positives = 114/230 (49%), Gaps = 38/230 (16%)

Query: 50   AKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHT------------ 97
             +DV  +A+ + FP SV +FF+G +G+P  GFP+ LQ+KVL   +  T            
Sbjct: 898  EEDVENDANDLDFPDSVVSFFRGELGQPPGGFPEPLQKKVLKGREPLTDRPGELLEPADF 957

Query: 98   ----------LDRKP-ECD----LM----------MEDEFGPVDRLPTRIFLNGPNIGEE 132
                      L R+  + D    L+            + +G V  LPT  F  G   GEE
Sbjct: 958  EAIRKELEEKLGREVSDQDVASYLLYPKVFEDYQKHRETYGDVSVLPTPTFFYGLRPGEE 1017

Query: 133  FSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADS 192
               E + G T  +   +I E  ++ G RTV+F  NGQ R + ++D++    +  R KAD 
Sbjct: 1018 IEVEIEKGKTLIIKLQAIGE-PDEKGMRTVYFELNGQPREIKVKDRSVGSSVVARRKADP 1076

Query: 193  DTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGV 242
               G IGAPMPG ++EVK K G +VKK DVL V+  MK ET I A  DG 
Sbjct: 1077 GNPGHIGAPMPGVVVEVKVKKGDKVKKGDVLAVIEAMKMETTISAPFDGT 1126


Length = 1149

>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|217032 pfam02436, PYC_OADA, Conserved carboxylase domain Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|205711 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
COG10381149 PycA Pyruvate carboxylase [Energy production and c 100.0
KOG0369|consensus1176 100.0
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 100.0
PRK129991146 pyruvate carboxylase; Reviewed 100.0
PRK14042596 pyruvate carboxylase subunit B; Provisional 100.0
PRK09282592 pyruvate carboxylase subunit B; Validated 100.0
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 100.0
PRK14040593 oxaloacetate decarboxylase; Provisional 100.0
PF02436196 PYC_OADA: Conserved carboxylase domain; InterPro: 99.97
PRK12330499 oxaloacetate decarboxylase; Provisional 99.89
PRK14041467 oxaloacetate decarboxylase; Provisional 99.88
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 99.88
PRK12331448 oxaloacetate decarboxylase; Provisional 99.88
PRK12581468 oxaloacetate decarboxylase; Provisional 99.87
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 99.87
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.84
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.81
KOG0238|consensus670 99.8
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.77
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.75
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.69
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.67
PRK0674883 hypothetical protein; Validated 99.65
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.6
PRK0705180 hypothetical protein; Validated 99.57
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.56
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.54
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 99.51
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.44
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 99.4
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.35
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 99.3
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 99.3
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 99.17
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 99.08
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.07
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.05
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 99.02
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 98.97
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 98.96
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 98.94
KOG0368|consensus 2196 98.9
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 98.9
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.9
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.87
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.87
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 98.74
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 98.66
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 98.63
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 98.58
PRK09783 409 copper/silver efflux system membrane fusion protei 98.5
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 98.5
PRK13380144 glycine cleavage system protein H; Provisional 98.49
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 98.45
KOG0559|consensus 457 98.43
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 98.42
PRK10476 346 multidrug resistance protein MdtN; Provisional 98.34
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 98.33
KOG0557|consensus 470 98.33
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 98.29
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 98.28
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 98.26
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 98.21
PRK15136 390 multidrug efflux system protein EmrA; Provisional 98.2
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 98.19
PRK03598 331 putative efflux pump membrane fusion protein; Prov 98.17
PRK09859 385 multidrug efflux system protein MdtE; Provisional 98.14
PRK00624114 glycine cleavage system protein H; Provisional 98.07
PRK11578 370 macrolide transporter subunit MacA; Provisional 98.04
TIGR00527127 gcvH glycine cleavage system H protein. The genome 98.02
PRK01202127 glycine cleavage system protein H; Provisional 98.0
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 97.97
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 97.82
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 97.81
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 97.66
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 97.53
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 97.46
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 97.45
PRK1278484 hypothetical protein; Provisional 97.45
KOG0558|consensus 474 97.39
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.24
COG1566 352 EmrA Multidrug resistance efflux pump [Defense mec 97.22
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 97.2
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 97.19
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 97.18
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 96.98
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 96.96
PRK0705180 hypothetical protein; Validated 96.95
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 96.82
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 96.71
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 96.68
PRK0674883 hypothetical protein; Validated 96.57
PF13437105 HlyD_3: HlyD family secretion protein 96.53
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 96.5
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 96.48
PRK14040593 oxaloacetate decarboxylase; Provisional 96.38
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 96.35
COG3608331 Predicted deacylase [General function prediction o 96.34
PF00529 305 HlyD: HlyD family secretion protein the correspond 96.32
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 96.3
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 96.26
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 96.09
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 96.0
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 95.85
PRK129991146 pyruvate carboxylase; Reviewed 95.75
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 95.64
PF09891150 DUF2118: Uncharacterized protein conserved in arch 95.64
PRK09282592 pyruvate carboxylase subunit B; Validated 95.62
PF05896 257 NQRA: Na(+)-translocating NADH-quinone reductase s 95.59
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 95.29
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 95.23
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 95.11
PF13437105 HlyD_3: HlyD family secretion protein 95.1
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 95.09
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 95.05
PRK14042596 pyruvate carboxylase subunit B; Provisional 94.87
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 94.78
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 94.67
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 94.32
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 94.25
PF06898385 YqfD: Putative stage IV sporulation protein YqfD; 94.08
PRK09439169 PTS system glucose-specific transporter subunit; P 93.88
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 93.84
COG2190156 NagE Phosphotransferase system IIA components [Car 93.61
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 93.59
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 93.44
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 93.42
PRK09439169 PTS system glucose-specific transporter subunit; P 93.26
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 93.17
TIGR02876382 spore_yqfD sporulation protein YqfD. YqfD is part 93.13
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 92.88
PRK10476346 multidrug resistance protein MdtN; Provisional 92.75
PRK15136390 multidrug efflux system protein EmrA; Provisional 92.72
PRK11578 370 macrolide transporter subunit MacA; Provisional 92.72
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 92.69
COG2190156 NagE Phosphotransferase system IIA components [Car 92.55
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 92.53
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 92.45
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 92.38
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 92.23
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogen 92.04
PRK09859 385 multidrug efflux system protein MdtE; Provisional 92.02
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 91.96
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 91.95
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 91.93
KOG3373|consensus172 91.88
KOG0559|consensus 457 91.86
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 91.82
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 91.8
PRK09783 409 copper/silver efflux system membrane fusion protei 91.8
PRK03598331 putative efflux pump membrane fusion protein; Prov 91.71
PRK05035 695 electron transport complex protein RnfC; Provision 91.69
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 91.67
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 91.62
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 91.62
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 91.55
COG4072161 Uncharacterized protein conserved in archaea [Func 91.17
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 90.85
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 90.85
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 90.67
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 89.83
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 89.64
PF0155196 Peptidase_M23: Peptidase family M23; InterPro: IPR 88.85
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 88.59
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 88.55
PRK10255648 PTS system N-acetyl glucosamine specific transport 88.18
COG10381149 PycA Pyruvate carboxylase [Energy production and c 88.16
PRK09824627 PTS system beta-glucoside-specific transporter sub 88.08
COG1566352 EmrA Multidrug resistance efflux pump [Defense mec 87.52
PRK10255648 PTS system N-acetyl glucosamine specific transport 87.31
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 87.25
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 86.78
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 86.77
PRK09824627 PTS system beta-glucoside-specific transporter sub 86.53
PRK05305206 phosphatidylserine decarboxylase; Provisional 86.19
PRK1278484 hypothetical protein; Provisional 85.42
KOG0369|consensus1176 84.48
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 83.25
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 82.51
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 82.46
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 82.1
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 81.57
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogen 81.52
PRK05305206 phosphatidylserine decarboxylase; Provisional 80.99
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 80.63
PRK03934265 phosphatidylserine decarboxylase; Provisional 80.07
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=9.3e-61  Score=479.35  Aligned_cols=241  Identities=34%  Similarity=0.515  Sum_probs=226.0

Q ss_pred             CCCCceeecccccchhhhHHHHHhccCchhhhhhcccccccchhHHHHhccccCCCCCCCCHhHHHHhhCCCCcc-----
Q psy2807          22 TSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDH-----   96 (288)
Q Consensus        22 ~~G~iv~VTPsSqiVG~~A~~~V~N~l~~e~~~~~~~~~~~p~svv~~l~G~yG~Pp~gf~~~l~~~vL~g~~~i-----   96 (288)
                      =+|||||||||||+|||+|+|||+|.||.+++.++++.++||+||++||+|.+||||+|||++||+++|+|++|+     
T Consensus       870 mfGdivKVTPSSKVVGDmAl~MV~n~Lt~~dv~~~~~~l~fPdSVv~ff~G~lGqP~gGfPe~Lqk~vLkg~~p~t~Rpg  949 (1149)
T COG1038         870 MFGDIVKVTPSSKVVGDLALFMVQNDLTEEDVENDANDLDFPDSVVSFFRGELGQPPGGFPEPLQKKVLKGREPLTDRPG  949 (1149)
T ss_pred             HhCCceEecccchhHHHHHHHHHhcCCCHHHHhcccccCCCcHHHHHHhhcccCCCCCCCCHHHHHHHhcCCCccccCcc
Confidence            379999999999999999999999999999999999999999999999999999999999999999999999888     


Q ss_pred             --------------cccc----CCccccee--------------ecccCCCCCCCcccccCCCCCCceeeeeecCCceEE
Q psy2807          97 --------------TLDR----KPECDLMM--------------EDEFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTAY  144 (288)
Q Consensus        97 --------------L~~~----~~deDvL~--------------~a~fg~~~~l~t~~F~~g~~~gee~~v~~~~Gk~~~  144 (288)
                                    |+++    .++.|++.              ...||++++|||+.|||||..||+++++++.||++.
T Consensus       950 ~~l~~~d~~a~r~~l~~~~~~~~~d~d~~sy~lyPkvf~dy~~~~~~yGd~S~L~t~~ff~gm~~gEe~~v~ie~GktLi 1029 (1149)
T COG1038         950 ELLEPADFEAIRKELEEKLGREVSDQDVASYLLYPKVFEDYQKHRETYGDVSVLPTPTFFYGLRPGEEIEVEIEKGKTLI 1029 (1149)
T ss_pred             ccCCccchHHHHHHHHHHhCCCchhHHHHHHHhcchhHHHHHHHHHhcCCccccCcchhhccCCCCceEEEEecCCcEEE
Confidence                          1112    46777773              445899999999999999999999999999999999


Q ss_pred             EEEeecccccccCCceEEEEEeCCEEEEEEEeccchhhhhhccccCCCCCCCeeecCCcEEEEEEecCCCCEEecCCEEE
Q psy2807         145 VTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLI  224 (288)
Q Consensus       145 v~l~~~~~~~~~~~~~~~~~~vnG~~~~v~v~~~~~~~~~~~~~~a~~~~~~~i~apm~G~V~~v~V~~Gd~V~~G~~l~  224 (288)
                      |++.+++ ++++.|.++++|++||+.|++.|+|.+.......++||+.+|+++|.|||||+|+++.|++||.|++||+|+
T Consensus      1030 i~l~aig-e~d~~G~r~v~felNGq~R~i~v~Drs~~~~~~~r~KAd~~Np~higApmpG~Vv~v~V~~G~~Vk~Gd~l~ 1108 (1149)
T COG1038        1030 IKLQAIG-EPDEKGMRTVYFELNGQPREIKVKDRSVGSSVVARRKADPGNPGHIGAPMPGVVVEVKVKKGDKVKKGDVLA 1108 (1149)
T ss_pred             EEecccC-CCCcCCcEEEEEEeCCceeeeeecccccccccccccccCCCCccccCCCCCCceEEEEEccCCeecCCCeee
Confidence            9999999 999999999999999999999999987666666778999999999999999999999999999999999999


Q ss_pred             EEeccceeEEEEcCCCeEEEEEeeCCCCeecc-ceeEEEe
Q psy2807         225 VMSVMKTETLIHASADGVHKVRSSNLDYNFMR-PLQLSLN  263 (288)
Q Consensus       225 ~lEamKme~~I~Ap~~G~V~~i~v~~Gd~V~~-~~L~~i~  263 (288)
                      ++||||||+.|.||+||+|.+++|+.||+|.. ++|.+++
T Consensus      1109 ~ieAMKMEt~i~Ap~dG~i~~v~V~~gd~i~~gDLLi~~~ 1148 (1149)
T COG1038        1109 VIEAMKMETTISAPFDGTVKEVLVKDGDQIDGGDLLVVVE 1148 (1149)
T ss_pred             ehhhhhhceeeecCCCceEeEEEecCCCccccCceEEEcc
Confidence            99999999999999999999999999999999 9998875



>KOG0369|consensus Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF02436 PYC_OADA: Conserved carboxylase domain; InterPro: IPR003379 This domain represents a conserved region in pyruvate carboxylase (PYC) (6 Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>KOG3373|consensus Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>COG4072 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PF01551 Peptidase_M23: Peptidase family M23; InterPro: IPR016047 Members of this family are zinc metallopeptidases with a range of specificities Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK03934 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3bg3_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 3e-34
3bg9_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 3e-33
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 5e-24
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 5e-24
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 5e-24
4hnu_A1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 5e-24
4hnv_A1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 5e-24
4hnt_A1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 5e-24
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 6e-24
3tw7_A1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 3e-23
2qf7_A1165 Crystal Structure Of A Complete Multifunctional Pyr 3e-23
3n6r_A681 Crystal Structure Of The Holoenzyme Of Propionyl-co 2e-04
>pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 Back     alignment and structure

Iteration: 1

Score = 142 bits (357), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 85/232 (36%), Positives = 120/232 (51%), Gaps = 44/232 (18%) Query: 62 FPKSVSAFFQGSIGEPYQGFPKKLQEKVLG-------------------SLKDHTLDRKP 102 FP+SV F QG IG P+ GFP+ + KVL +L+ +DR Sbjct: 480 FPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHG 539 Query: 103 ECDLMMED-------------------EFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTA 143 E ++ ED FGP+D L TR+FL GP I EEF E + G T Sbjct: 540 E-EVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTL 598 Query: 144 YVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMP 203 ++ L++S+ LN G+R VFF NGQLRS+L++D K++ KA D G+IGAPMP Sbjct: 599 HIKALAVSD-LNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMP 657 Query: 204 GNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADG----VHKVRSSNLD 251 G +I++K G +V K L V+S MK ET++ + +G VH + L+ Sbjct: 658 GKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLE 709
>pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 3e-62
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 5e-60
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 4e-56
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 8e-20
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 8e-19
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 2e-17
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 3e-17
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 5e-17
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 5e-16
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 6e-15
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 1e-14
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 2e-11
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 1e-10
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 5e-10
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 7e-07
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
 Score =  211 bits (539), Expect = 3e-62
 Identities = 70/232 (30%), Positives = 105/232 (45%), Gaps = 38/232 (16%)

Query: 48   IKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDHT---------- 97
            +  + V+ +  K+ FP+SV +FF+G IG+P  GF K LQ  +L   +  T          
Sbjct: 894  LDEQSVITDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPV 953

Query: 98   ------------LDRKP-ECDLMM--------------EDEFGPVDRLPTRIFLNGPNIG 130
                              E D++                +++G +  L T  F  G   G
Sbjct: 954  DFEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNG 1013

Query: 131  EEFSCEFKTGDTAYVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKA 190
            E    E   G    +   +ISE  +++G RT+++  NGQ R + I+D+N      ++ KA
Sbjct: 1014 ETVEIEIDKGKRLIIKLETISE-PDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKA 1072

Query: 191  DSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGV 242
            D      IGA MPG++ EVK  VG+ VK N  L++   MK ET I A  DGV
Sbjct: 1073 DKSNPSHIGAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGV 1124


>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Length = 539 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Length = 464 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 100.0
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 100.0
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 100.0
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 99.84
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 99.82
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 99.82
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 99.75
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.66
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.64
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.63
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.62
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.6
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 99.59
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.59
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.58
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.58
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.56
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 99.55
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.55
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.54
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.52
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.52
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.51
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.51
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.5
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.49
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.48
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.43
1zko_A136 Glycine cleavage system H protein; TM0212, structu 99.21
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 99.14
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 99.13
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitoch 99.1
1hpc_A131 H protein of the glycine cleavage system; transit 98.87
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.76
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.73
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 98.48
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 98.47
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 98.45
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 98.43
3klr_A125 Glycine cleavage system H protein; antiparallel be 98.32
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 98.23
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 98.11
3mxu_A143 Glycine cleavage system H protein; seattle structu 98.11
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 97.97
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 97.73
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.72
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 97.68
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 97.68
2gpr_A154 Glucose-permease IIA component; phosphotransferase 97.64
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 97.44
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 97.06
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 97.03
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 96.95
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 96.92
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 96.9
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 96.83
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 96.77
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 96.69
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 96.62
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 96.54
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 96.3
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 96.29
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 96.26
2qj8_A332 MLR6093 protein; structural genomics, joint center 96.08
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 95.9
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 95.65
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 95.65
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 95.54
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 95.52
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 95.44
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 95.44
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 95.33
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 95.22
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 95.18
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 95.17
2gpr_A154 Glucose-permease IIA component; phosphotransferase 94.9
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 94.87
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 94.66
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 94.64
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 94.16
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 93.99
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 93.82
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 93.25
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 92.5
3our_B183 EIIA, phosphotransferase system IIA component; exh 92.14
3our_B183 EIIA, phosphotransferase system IIA component; exh 92.03
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 91.88
2xha_A193 NUSG, transcription antitermination protein NUSG; 91.39
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 90.22
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 89.15
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 88.62
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 87.92
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 87.41
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 87.2
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 87.19
2xha_A193 NUSG, transcription antitermination protein NUSG; 87.04
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 85.84
2bco_A350 Succinylglutamate desuccinylase; NESG, VPR14, stru 83.38
3it5_A182 Protease LASA; metallopeptidase, beta-protein, cel 81.47
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-53  Score=454.11  Aligned_cols=243  Identities=30%  Similarity=0.463  Sum_probs=221.1

Q ss_pred             CCCCCceeecccccchhhhHHHHHhccCchhhhhhcccccccchhHHHHhccccCCCCCCCCHhHHHHhhCCCCcc----
Q psy2807          21 HTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKVLGSLKDH----   96 (288)
Q Consensus        21 ~~~G~iv~VTPsSqiVG~~A~~~V~N~l~~e~~~~~~~~~~~p~svv~~l~G~yG~Pp~gf~~~l~~~vL~g~~~i----   96 (288)
                      .++|||||||||||||||||+|||+|+|+++++.++++.++||+|+++||+|+||+||+|||++|++++|+|++++    
T Consensus       867 ~~~g~~~~vtp~sq~vg~~a~~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~G~~g~~~~~~~~~~~~~~~~~~~~~~~rp  946 (1150)
T 3hbl_A          867 FLFGDIVKVAPSSKVVGDMALYMVQNDLDEQSVITDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARP  946 (1150)
T ss_dssp             HHTTSCCCCTTHHHHHHHHHHHHHHTTCCTTHHHHSGGGCCCCHHHHHHTTTSSCCCTTCCCHHHHHHHHTTCCCCSSCG
T ss_pred             HHcCCCceECchhHHHHHHHHHHHHcCCChhhhhcccccccCCHHHHHHhCcCCCCCCCCCCHHHHHHHhcCCCCccCCc
Confidence            3689999999999999999999999999999999888889999999999999999999999999999999998776    


Q ss_pred             ---c--------ccc--------CCcccceeec--------------ccCCCCCCCcccccCCCCCCceeeeeecCCceE
Q psy2807          97 ---T--------LDR--------KPECDLMMED--------------EFGPVDRLPTRIFLNGPNIGEEFSCEFKTGDTA  143 (288)
Q Consensus        97 ---L--------~~~--------~~deDvL~~a--------------~fg~~~~l~t~~F~~g~~~gee~~v~~~~Gk~~  143 (288)
                         |        +++        .++||+|.|+              .||+++.|||+.||+|++.||++++++++||++
T Consensus       947 ~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~ 1026 (1150)
T 3hbl_A          947 GEYLEPVDFEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNGETVEIEIDKGKRL 1026 (1150)
T ss_dssp             GGGSCCCCHHHHHHHHHHHSCSCCCHHHHHHHHHSHHHHHHHHHHHHHHCCGGGSCHHHHHHCCCTTCEEEEEEETTEEE
T ss_pred             cccCChhhHHHHHHHHHHhhCCCCCHHHHHHHHcCCHHHHHHHHHHHhcCCcccCCchhhhcCCCCCceEEEEccCCcEE
Confidence               1        111        4789999544              478999999999999999999999999999999


Q ss_pred             EEEEeecccccccCCceEEEEEeCCEEEEEEEeccchhhhhhccccCCCCCCCeeecCCcEEEEEEecCCCCEEecCCEE
Q psy2807         144 YVTTLSISERLNDHGERTVFFLYNGQLRSVLIRDKNQAKKLKLRSKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVL  223 (288)
Q Consensus       144 ~v~l~~~~~~~~~~~~~~~~~~vnG~~~~v~v~~~~~~~~~~~~~~a~~~~~~~i~apm~G~V~~v~V~~Gd~V~~G~~l  223 (288)
                      .|++.+++ .+++.|.++++|++||+.+++.|.+..........+++++.+..+|.|||+|+|++|+|++||.|++||+|
T Consensus      1027 ~i~l~~~~-~~~~~g~~~~~~e~nG~~~~v~v~~~~~~~~~~~~~~~~~~~~~~v~ap~~G~v~~~~v~~Gd~V~~G~~l 1105 (1150)
T 3hbl_A         1027 IIKLETIS-EPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADKSNPSHIGAQMPGSVTEVKVSVGETVKANQPL 1105 (1150)
T ss_dssp             EEEEEEEC-CCCTTSEEEEEEEETTEEEEEEEECCCSSSCCCCCCBCCTTCSSEEECSSSEEEEEECCCTTCEECTTCEE
T ss_pred             EEEecccC-CCCCCCceEEEEEECCeEEEEecccccccccccccccCCCCCCceeecCceEEEEEEEeCCCCEECCCCEE
Confidence            99999998 78888999999999999999999987643333344667777889999999999999999999999999999


Q ss_pred             EEEeccceeEEEEcCCCeEEEEEeeCCCCeecc-ceeEEEec
Q psy2807         224 IVMSVMKTETLIHASADGVHKVRSSNLDYNFMR-PLQLSLNG  264 (288)
Q Consensus       224 ~~lEamKme~~I~Ap~~G~V~~i~v~~Gd~V~~-~~L~~i~~  264 (288)
                      ++|||||||++|+||.+|+|.++++++||.|.. ++|++|++
T Consensus      1106 ~~ieamK~~~~i~ap~~G~v~~i~v~~G~~V~~g~~l~~i~~ 1147 (1150)
T 3hbl_A         1106 LITEAMKMETTIQAPFDGVIKQVTVNNGDTIATGDLLIEIEK 1147 (1150)
T ss_dssp             EEEESSSCEEEEECSSSEEEEEECCCTTCEECTTBEEEEEC-
T ss_pred             EEEEeccceeEEecCCCeEEEEEEeCCCCEeCCCCEEEEEec
Confidence            999999999999999999999999999999999 99999975



>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell out membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa} PDB: 3it7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 4e-12
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-04
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 4e-04
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 8e-04
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 0.001
d1bdoa_80 b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox 0.001
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 0.002
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 0.004
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S)
species: Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]
 Score = 58.4 bits (141), Expect = 4e-12
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 188 SKADSDTAGEIGAPMPGNIIEVKAKVGQQVKKNDVLIVMSVMKTETLIHASADGV 242
           + A     GEI AP+ G + ++  K G  VK    ++V+  MK ET I+A  DG 
Sbjct: 1   AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGK 55


>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d1rqba1168 Transcarboxylase 5S subunit, C-terminal domain {Pr 99.87
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.84
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.79
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.71
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.62
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.61
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.59
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.56
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.52
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.43
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.42
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 97.94
d1onla_127 Protein H of glycine cleavage system {Thermus ther 97.46
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 97.4
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 97.36
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 97.12
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 96.92
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 96.85
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 96.83
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 96.62
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 96.38
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 95.97
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 95.9
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 94.82
d1vf7a_ 237 Multidrug resistance protein MexA domain {Pseudomo 94.63
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 94.35
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 94.14
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 93.96
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 93.77
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 92.21
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 91.36
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 88.62
d2tpta3105 Thymidine phosphorylase {Escherichia coli [TaxId: 82.48
>d1rqba1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: post-HMGL domain-like
family: Conserved carboxylase domain
domain: Transcarboxylase 5S subunit, C-terminal domain
species: Propionibacterium freudenreichii shermanii [TaxId: 1752]
Probab=99.87  E-value=6.4e-24  Score=180.82  Aligned_cols=92  Identities=12%  Similarity=0.065  Sum_probs=78.8

Q ss_pred             CCCCCceeecccccchhhhHHHHHhccCchhhhhhcccccccchhHHHHhccccCCCCCCCCHhHHHHh--hCCCCcc--
Q psy2807          21 HTSAVPIRSTRGWVWIGYIEECLRQLLIKAKDVMENADKIIFPKSVSAFFQGSIGEPYQGFPKKLQEKV--LGSLKDH--   96 (288)
Q Consensus        21 ~~~G~iv~VTPsSqiVG~~A~~~V~N~l~~e~~~~~~~~~~~p~svv~~l~G~yG~Pp~gf~~~l~~~v--L~g~~~i--   96 (288)
                      ..+|||||||||||||||||+|||+|.    +|+      .+|+|+++|++|+||+||++|++++++++  ++|++++  
T Consensus        34 ~~lG~~~~VTPsSqvVG~~A~~nV~~g----~~~------~~~~e~~~~~~G~~G~~P~~~~~~~~k~~~~~~g~~pit~  103 (168)
T d1rqba1          34 KAAGFPPLVTPSSQIVGTQAVFNVMMG----EYK------RMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQ  103 (168)
T ss_dssp             HHTTCCCCCTTHHHHHHHHHHHHHHHC----TTS------SCCHHHHHHHTTTTCCCSSCCCHHHHHHHHHHHCCCCCCS
T ss_pred             HhcCCCceeCcHHHHHHHHHHHHHHhh----hcc------cccHHHHHHhcccccCCCCCCCHHHHHHHHhccCCCCCCC
Confidence            468999999999999999999987774    466      89999999999999999999999999866  6688777  


Q ss_pred             ----------------cccc----CCcccceeecccCCCCCCCcccccCC
Q psy2807          97 ----------------TLDR----KPECDLMMEDEFGPVDRLPTRIFLNG  126 (288)
Q Consensus        97 ----------------L~~~----~~deDvL~~a~fg~~~~l~t~~F~~g  126 (288)
                                      +.+.    .++||+|.|++||++.    ..|+..
T Consensus       104 RPgd~l~pd~~~~~~el~~~~g~~~sdedlLsyaLyP~V~----~~f~~~  149 (168)
T d1rqba1         104 RPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVA----PVFFEH  149 (168)
T ss_dssp             CGGGGCCCCHHHHHHHHTTSTTCCSSHHHHHHHHHCTTTH----HHHHHH
T ss_pred             CchhhccccHHHHHHHHHHHhCCCCCHHHHHHHHcCChhH----HHHHHH
Confidence                            1111    6899999999999988    788753



>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure