Psyllid ID: psy2833
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| 383854408 | 550 | PREDICTED: T-complex protein 1 subunit g | 0.328 | 0.129 | 0.830 | 3e-29 | |
| 124487748 | 429 | putative T-complex protein 1 subunit gam | 0.305 | 0.153 | 0.909 | 6e-29 | |
| 242023106 | 549 | T-complex protein 1 subunit gamma, putat | 0.305 | 0.120 | 0.878 | 9e-29 | |
| 340714939 | 514 | PREDICTED: t-complex protein 1 subunit g | 0.328 | 0.138 | 0.816 | 1e-28 | |
| 340714937 | 550 | PREDICTED: t-complex protein 1 subunit g | 0.328 | 0.129 | 0.816 | 1e-28 | |
| 350402034 | 550 | PREDICTED: T-complex protein 1 subunit g | 0.328 | 0.129 | 0.816 | 1e-28 | |
| 158290572 | 547 | AGAP002759-PA [Anopheles gambiae str. PE | 0.333 | 0.131 | 0.780 | 1e-28 | |
| 374720905 | 548 | AGAP002759-PA [Anopheles stephensi] | 0.333 | 0.131 | 0.794 | 2e-28 | |
| 170048590 | 546 | T-complex protein 1 subunit gamma [Culex | 0.333 | 0.131 | 0.767 | 3e-28 | |
| 380011241 | 511 | PREDICTED: T-complex protein 1 subunit g | 0.328 | 0.138 | 0.802 | 3e-28 |
| >gi|383854408|ref|XP_003702713.1| PREDICTED: T-complex protein 1 subunit gamma-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 134 bits (337), Expect = 3e-29, Method: Compositional matrix adjust.
Identities = 59/71 (83%), Positives = 68/71 (95%)
Query: 55 LGDEYFCYITECQNPKACTILLRGASKDLLNETERNLQDALHVARNIMLEPKLVPGGGAV 114
LGDEYFC+ITEC++PKACTI+LRGASKD+LNETERNLQDALHVARN+++EPKLVPGGGAV
Sbjct: 358 LGDEYFCFITECKDPKACTIILRGASKDMLNETERNLQDALHVARNLLIEPKLVPGGGAV 417
Query: 115 EMAVSHVSASK 125
EMAVS + A K
Sbjct: 418 EMAVSRLLAEK 428
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|124487748|gb|ABN11961.1| putative T-complex protein 1 subunit gamma [Maconellicoccus hirsutus] | Back alignment and taxonomy information |
|---|
| >gi|242023106|ref|XP_002431977.1| T-complex protein 1 subunit gamma, putative [Pediculus humanus corporis] gi|212517328|gb|EEB19239.1| T-complex protein 1 subunit gamma, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340714939|ref|XP_003395979.1| PREDICTED: t-complex protein 1 subunit gamma-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340714937|ref|XP_003395978.1| PREDICTED: t-complex protein 1 subunit gamma-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350402034|ref|XP_003486345.1| PREDICTED: T-complex protein 1 subunit gamma-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|158290572|ref|XP_312164.4| AGAP002759-PA [Anopheles gambiae str. PEST] gi|157017960|gb|EAA07808.4| AGAP002759-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|374720905|gb|AEZ67841.1| AGAP002759-PA [Anopheles stephensi] | Back alignment and taxonomy information |
|---|
| >gi|170048590|ref|XP_001870702.1| T-complex protein 1 subunit gamma [Culex quinquefasciatus] gi|167870651|gb|EDS34034.1| T-complex protein 1 subunit gamma [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|380011241|ref|XP_003689719.1| PREDICTED: T-complex protein 1 subunit gamma-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| FB|FBgn0015019 | 544 | Cctgamma "Cctgamma" [Drosophil | 0.337 | 0.134 | 0.739 | 4.1e-37 | |
| UNIPROTKB|F1PDX9 | 476 | CCT3 "Uncharacterized protein" | 0.523 | 0.237 | 0.516 | 3.6e-32 | |
| UNIPROTKB|Q3T0K2 | 545 | CCT3 "T-complex protein 1 subu | 0.328 | 0.130 | 0.690 | 9.9e-32 | |
| UNIPROTKB|F1RP17 | 547 | CCT3 "T-complex protein 1 subu | 0.328 | 0.129 | 0.690 | 1e-31 | |
| UNIPROTKB|P49368 | 545 | CCT3 "T-complex protein 1 subu | 0.328 | 0.130 | 0.676 | 2.1e-31 | |
| MGI|MGI:104708 | 545 | Cct3 "chaperonin containing Tc | 0.328 | 0.130 | 0.676 | 2.1e-31 | |
| RGD|735038 | 545 | Cct3 "chaperonin containing Tc | 0.328 | 0.130 | 0.676 | 2.1e-31 | |
| UNIPROTKB|E2RB79 | 549 | CCT3 "Uncharacterized protein" | 0.328 | 0.129 | 0.690 | 7.2e-31 | |
| ZFIN|ZDB-GENE-020419-5 | 543 | cct3 "chaperonin containing TC | 0.305 | 0.121 | 0.712 | 4.1e-30 | |
| ASPGD|ASPL0000038552 | 538 | AN3134 [Emericella nidulans (t | 0.300 | 0.120 | 0.707 | 5.7e-27 |
| FB|FBgn0015019 Cctgamma "Cctgamma" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 293 (108.2 bits), Expect = 4.1e-37, Sum P(2) = 4.1e-37
Identities = 54/73 (73%), Positives = 64/73 (87%)
Query: 55 LGDEYFCYITECQNPKACTILLRGASKDLLNETERNLQDALHVARNIMLEPKLVPGGGAV 114
+GDEYF ++TEC+ PKACTILLRGASKD+LNETERNLQDALHVARN++LEP+LV GGGAV
Sbjct: 357 IGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAV 416
Query: 115 EMAVSHVSASKDL 127
EMA S + K +
Sbjct: 417 EMAASQLLTRKQV 429
|
|
| UNIPROTKB|F1PDX9 CCT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0K2 CCT3 "T-complex protein 1 subunit gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RP17 CCT3 "T-complex protein 1 subunit gamma" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49368 CCT3 "T-complex protein 1 subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104708 Cct3 "chaperonin containing Tcp1, subunit 3 (gamma)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|735038 Cct3 "chaperonin containing Tcp1, subunit 3 (gamma)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RB79 CCT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020419-5 cct3 "chaperonin containing TCP1, subunit 3 (gamma)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000038552 AN3134 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 216 | |||
| cd03337 | 480 | cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type | 1e-40 | |
| TIGR02344 | 525 | TIGR02344, chap_CCT_gamma, T-complex protein 1, ga | 8e-38 | |
| cd00309 | 464 | cd00309, chaperonin_type_I_II, chaperonin families | 2e-26 | |
| pfam00118 | 481 | pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami | 1e-20 | |
| cd03343 | 517 | cd03343, cpn60, cpn60 chaperonin family | 2e-20 | |
| COG0459 | 524 | COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po | 2e-20 | |
| TIGR02339 | 519 | TIGR02339, thermosome_arch, thermosome, various su | 6e-19 | |
| cd03333 | 209 | cd03333, chaperonin_like, chaperonin_like superfam | 1e-17 | |
| cd03338 | 515 | cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type | 4e-15 | |
| cd03340 | 522 | cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type I | 9e-15 | |
| TIGR02345 | 523 | TIGR02345, chap_CCT_eta, T-complex protein 1, eta | 9e-15 | |
| cd03339 | 526 | cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic ty | 2e-14 | |
| TIGR02343 | 532 | TIGR02343, chap_CCT_epsi, T-complex protein 1, eps | 2e-13 | |
| PTZ00212 | 533 | PTZ00212, PTZ00212, T-complex protein 1 subunit be | 9e-13 | |
| cd03336 | 517 | cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type | 2e-12 | |
| cd03342 | 484 | cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type | 4e-11 | |
| TIGR02347 | 531 | TIGR02347, chap_CCT_zeta, T-complex protein 1, zet | 5e-11 | |
| TIGR02341 | 518 | TIGR02341, chap_CCT_beta, T-complex protein 1, bet | 7e-11 | |
| TIGR02342 | 517 | TIGR02342, chap_CCT_delta, T-complex protein 1, de | 1e-10 | |
| cd03335 | 527 | cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type | 1e-10 | |
| cd03341 | 472 | cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type | 1e-10 | |
| TIGR02340 | 536 | TIGR02340, chap_CCT_alpha, T-complex protein 1, al | 1e-08 | |
| cd03337 | 480 | cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type | 2e-08 | |
| TIGR02344 | 525 | TIGR02344, chap_CCT_gamma, T-complex protein 1, ga | 5e-08 | |
| TIGR02346 | 531 | TIGR02346, chap_CCT_theta, T-complex protein 1, th | 5e-08 | |
| cd03341 | 472 | cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type | 7e-05 | |
| TIGR02340 | 536 | TIGR02340, chap_CCT_alpha, T-complex protein 1, al | 1e-04 | |
| TIGR02342 | 517 | TIGR02342, chap_CCT_delta, T-complex protein 1, de | 2e-04 | |
| TIGR02341 | 518 | TIGR02341, chap_CCT_beta, T-complex protein 1, bet | 7e-04 | |
| cd03334 | 261 | cd03334, Fab1_TCP, TCP-1 like domain of the eukary | 7e-04 | |
| TIGR02346 | 531 | TIGR02346, chap_CCT_theta, T-complex protein 1, th | 8e-04 |
| >gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
Score = 143 bits (364), Expect = 1e-40
Identities = 54/65 (83%), Positives = 60/65 (92%)
Query: 56 GDEYFCYITECQNPKACTILLRGASKDLLNETERNLQDALHVARNIMLEPKLVPGGGAVE 115
GDEYF +ITEC++PKACTILLRGASKD+LNE ERNLQDA+ VARNI+L PKLVPGGGA E
Sbjct: 311 GDEYFTFITECKDPKACTILLRGASKDVLNEVERNLQDAMAVARNIILNPKLVPGGGATE 370
Query: 116 MAVSH 120
MAVSH
Sbjct: 371 MAVSH 375
|
Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin. Length = 480 |
| >gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233823 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|239449 cd03333, chaperonin_like, chaperonin_like superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239454 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239456 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|200176 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239455 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131396 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239452 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239458 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233827 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|211733 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239451 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233826 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|211733 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239450 cd03334, Fab1_TCP, TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 | Back alignment and domain information |
|---|
| >gnl|CDD|233826 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| KOG0361|consensus | 543 | 100.0 | ||
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 100.0 | |
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 100.0 | |
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 100.0 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 100.0 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 100.0 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 100.0 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 100.0 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 100.0 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 100.0 | |
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 100.0 | |
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 100.0 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 100.0 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 100.0 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 100.0 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 100.0 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 100.0 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 100.0 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 100.0 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 99.98 | |
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 99.98 | |
| KOG0363|consensus | 527 | 99.98 | ||
| KOG0364|consensus | 527 | 99.97 | ||
| KOG0359|consensus | 520 | 99.97 | ||
| KOG0357|consensus | 400 | 99.97 | ||
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 99.96 | |
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 99.96 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 99.96 | |
| PF00118 | 485 | Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon | 99.96 | |
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 99.96 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 99.96 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 99.95 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 99.95 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 99.95 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 99.95 | |
| KOG0358|consensus | 534 | 99.95 | ||
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 99.95 | |
| CHL00093 | 529 | groEL chaperonin GroEL | 99.94 | |
| KOG0362|consensus | 537 | 99.94 | ||
| KOG0360|consensus | 545 | 99.94 | ||
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 99.92 | |
| cd03334 | 261 | Fab1_TCP TCP-1 like domain of the eukaryotic phosp | 99.67 | |
| cd03333 | 209 | chaperonin_like chaperonin_like superfamily. Chape | 99.61 | |
| KOG0357|consensus | 400 | 99.19 | ||
| KOG0358|consensus | 534 | 98.85 | ||
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 98.82 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 98.82 | |
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 98.8 | |
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 98.8 | |
| CHL00093 | 529 | groEL chaperonin GroEL | 98.79 | |
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 98.79 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 98.78 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 98.77 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 98.77 | |
| KOG0361|consensus | 543 | 98.76 | ||
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 98.75 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 98.75 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 98.74 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 98.7 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 98.7 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 98.7 | |
| KOG0363|consensus | 527 | 98.69 | ||
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 98.69 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 98.68 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 98.68 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 98.68 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 98.67 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 98.64 | |
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 98.63 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 98.62 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 98.6 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 98.6 | |
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 98.6 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 98.59 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 98.56 | |
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 98.55 | |
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 98.55 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 98.48 | |
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 98.4 | |
| KOG0362|consensus | 537 | 98.36 | ||
| KOG0364|consensus | 527 | 98.27 | ||
| PF00118 | 485 | Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon | 98.08 | |
| KOG0360|consensus | 545 | 97.96 | ||
| KOG0230|consensus | 1598 | 97.86 | ||
| KOG0356|consensus | 550 | 97.62 | ||
| KOG0359|consensus | 520 | 97.08 | ||
| KOG0356|consensus | 550 | 93.42 |
| >KOG0361|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-38 Score=284.70 Aligned_cols=175 Identities=21% Similarity=0.314 Sum_probs=164.4
Q ss_pred hcCceeeeeecccCc---ceeceEEEEEECCeEEEEEeecCCCceEEEEEeCCChhhHHHHHHHhchhhHHHHHHhcCCe
Q psy2833 30 QAGKYIDSSIVTLNH---WLCSSQDACLLGDEYFCYITECQNPKACTILLRGASKDLLNETERNLQDALHVARNIMLEPK 106 (216)
Q Consensus 30 ~~G~~i~~sl~~~~~---g~c~~v~~~~ig~~~~~~~~~~~~~~~~TIllrG~t~~~l~E~ersi~Dal~v~~~~~~~~~ 106 (216)
+||++++++..++.+ |.|..||++++|+++|.+|++|+..++||++|||+.+++++|+|||+|||+++++.++++..
T Consensus 325 acGGsi~tt~~~i~~~~LG~C~~FeE~QvG~eRyN~Fegcp~aktcTliLRGgaeqfieE~eRSlHDAImIVrralkn~~ 404 (543)
T KOG0361|consen 325 ACGGSIQTTVSDIKEEVLGTCALFEERQVGGERYNLFEGCPKAKTCTLILRGGAEQFIEETERSLHDAIMIVRRALKNDS 404 (543)
T ss_pred hcCcchhhhhhhcchhhcchhhhHHHHhhcchhhhhhcCCCccceeEEEEeccHHHHHHHHhhhhhhHHHHHHHHhccCc
Confidence 799999999999886 99999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEecCCchhHHHHHHHhhhh-----hhhHHHHHHHHHHHHHHHHHhcCcccCCCChhHHHHHHHHHHhhhhcCCceEEEE
Q psy2833 107 LVPGGGAVEMAVSHVSASKD-----LLNETERNLQDALHVARNIMLEPKLVPGGGAVEMAVSHVSSCFQDNLLGRVVVTL 181 (216)
Q Consensus 107 vV~GGGa~E~~ls~~L~~~~-----~~~e~~ra~adAL~vIp~~L~~N~~v~Ggga~E~~~s~~L~~~a~~~~g~~~~~i 181 (216)
+|+|||++||+||++||+|+ +.+....+|++||++||+.|++|+ |.++++++. +|++. |..|..||||
T Consensus 405 vVaGGGaiEMElSk~lRd~S~ti~gK~q~~i~A~akalEvIPrqLc~Na---GfDa~~iln--kLR~r--HA~G~~w~Gv 477 (543)
T KOG0361|consen 405 VVAGGGAIEMELSKYLRDYSRTIAGKQQLFINAYAKALEVIPRQLCDNA---GFDATNILN--KLRQR--HAQGEKWYGV 477 (543)
T ss_pred EeeCCceeeehHHHHHHHhhcccCcHHHHHHHHHHHHHHHhHHHHhhhc---CCcHHHHHH--HHHHH--hhcCCceeee
Confidence 99999999999999999998 999999999999999999999999 889999885 45554 3458999999
Q ss_pred eeccCCCCCCCCCCcccccchhhhhhhhhhh
Q psy2833 182 GLHAGGPGLIPGGAEVFFGSVLGVRGALSLV 212 (216)
Q Consensus 182 ~~~~~~~~~~~~~~gi~~~~~~~~~~~~~~~ 212 (216)
|..++.++|+ -+.+|||+++|+-+++.++-
T Consensus 478 di~~e~i~dn-~~~~VwEP~~VK~Nai~aat 507 (543)
T KOG0361|consen 478 DINTEGIADN-FEKFVWEPSIVKINAITAAT 507 (543)
T ss_pred eecccchhhH-HHhhccChHHHHHHHHHHHH
Confidence 9999999987 57899999999999988763
|
|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >KOG0363|consensus | Back alignment and domain information |
|---|
| >KOG0364|consensus | Back alignment and domain information |
|---|
| >KOG0359|consensus | Back alignment and domain information |
|---|
| >KOG0357|consensus | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism | Back alignment and domain information |
|---|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >KOG0358|consensus | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
| >KOG0362|consensus | Back alignment and domain information |
|---|
| >KOG0360|consensus | Back alignment and domain information |
|---|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 | Back alignment and domain information |
|---|
| >cd03333 chaperonin_like chaperonin_like superfamily | Back alignment and domain information |
|---|
| >KOG0357|consensus | Back alignment and domain information |
|---|
| >KOG0358|consensus | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >KOG0361|consensus | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >KOG0363|consensus | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0362|consensus | Back alignment and domain information |
|---|
| >KOG0364|consensus | Back alignment and domain information |
|---|
| >PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism | Back alignment and domain information |
|---|
| >KOG0360|consensus | Back alignment and domain information |
|---|
| >KOG0230|consensus | Back alignment and domain information |
|---|
| >KOG0356|consensus | Back alignment and domain information |
|---|
| >KOG0359|consensus | Back alignment and domain information |
|---|
| >KOG0356|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 216 | ||||
| 3iyg_G | 515 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 2e-26 | ||
| 3p9d_C | 590 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 9e-17 | ||
| 3iyg_H | 515 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 7e-11 | ||
| 1q3r_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 5e-10 | ||
| 1q2v_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 5e-10 | ||
| 1q3s_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 5e-10 | ||
| 3p9d_B | 527 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 7e-10 | ||
| 3p9d_F | 546 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 8e-10 | ||
| 3iyg_Z | 517 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 7e-09 | ||
| 3ko1_A | 553 | Cystal Structure Of Thermosome From Acidianus Tengc | 1e-08 | ||
| 1a6d_A | 545 | Thermosome From T. Acidophilum Length = 545 | 1e-08 | ||
| 3p9d_G | 550 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 2e-08 | ||
| 1a6d_B | 543 | Thermosome From T. Acidophilum Length = 543 | 3e-08 | ||
| 3iyg_B | 513 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 4e-08 | ||
| 3iyg_E | 515 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 4e-08 | ||
| 1gml_A | 178 | Crystal Structure Of The Mouse Cct Gamma Apical Dom | 2e-07 | ||
| 3aq1_B | 500 | Open State Monomer Of A Group Ii Chaperonin From Me | 4e-07 | ||
| 3iyg_A | 529 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 1e-06 | ||
| 3iyf_A | 521 | Atomic Model Of The Lidless Mm-Cpn In The Open Stat | 4e-06 | ||
| 3izn_A | 491 | Mm-Cpn Deltalid With Atp Length = 491 | 4e-06 | ||
| 3los_A | 543 | Atomic Model Of Mm-Cpn In The Closed State Length = | 4e-06 | ||
| 3izh_A | 513 | Mm-Cpn D386a With Atp Length = 513 | 5e-06 | ||
| 3izk_A | 491 | Mm-Cpn Rls Deltalid With Atp Length = 491 | 5e-06 | ||
| 3rus_A | 543 | Crystal Structure Of Cpn-Rls In Complex With Adp Fr | 6e-06 | ||
| 3izi_A | 513 | Mm-Cpn Rls With Atp Length = 513 | 6e-06 | ||
| 3p9d_E | 562 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 6e-06 | ||
| 3iyg_D | 518 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 7e-06 | ||
| 3p9d_A | 559 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 4e-05 | ||
| 3j02_A | 491 | Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Boun | 4e-05 | ||
| 3p9d_D | 528 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 8e-05 | ||
| 3iyg_Q | 512 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 9e-05 |
| >pdb|3IYG|G Chain G, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 | Back alignment and structure |
|
| >pdb|3P9D|C Chain C, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 590 | Back alignment and structure |
| >pdb|3IYG|H Chain H, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 | Back alignment and structure |
| >pdb|1Q3R|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form Of Single Mutant) Length = 548 | Back alignment and structure |
| >pdb|1Q2V|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form) Length = 548 | Back alignment and structure |
| >pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548 | Back alignment and structure |
| >pdb|3P9D|B Chain B, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 527 | Back alignment and structure |
| >pdb|3P9D|F Chain F, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 546 | Back alignment and structure |
| >pdb|3IYG|Z Chain Z, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 517 | Back alignment and structure |
| >pdb|3KO1|A Chain A, Cystal Structure Of Thermosome From Acidianus Tengchongensis Strain S5 Length = 553 | Back alignment and structure |
| >pdb|1A6D|A Chain A, Thermosome From T. Acidophilum Length = 545 | Back alignment and structure |
| >pdb|3P9D|G Chain G, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 550 | Back alignment and structure |
| >pdb|1A6D|B Chain B, Thermosome From T. Acidophilum Length = 543 | Back alignment and structure |
| >pdb|3IYG|B Chain B, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 513 | Back alignment and structure |
| >pdb|3IYG|E Chain E, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 | Back alignment and structure |
| >pdb|1GML|A Chain A, Crystal Structure Of The Mouse Cct Gamma Apical Domain (Triclinic) Length = 178 | Back alignment and structure |
| >pdb|3AQ1|B Chain B, Open State Monomer Of A Group Ii Chaperonin From Methanococcoides Burtonii Length = 500 | Back alignment and structure |
| >pdb|3IYG|A Chain A, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 529 | Back alignment and structure |
| >pdb|3IYF|A Chain A, Atomic Model Of The Lidless Mm-Cpn In The Open State Length = 521 | Back alignment and structure |
| >pdb|3IZN|A Chain A, Mm-Cpn Deltalid With Atp Length = 491 | Back alignment and structure |
| >pdb|3LOS|A Chain A, Atomic Model Of Mm-Cpn In The Closed State Length = 543 | Back alignment and structure |
| >pdb|3IZH|A Chain A, Mm-Cpn D386a With Atp Length = 513 | Back alignment and structure |
| >pdb|3IZK|A Chain A, Mm-Cpn Rls Deltalid With Atp Length = 491 | Back alignment and structure |
| >pdb|3RUS|A Chain A, Crystal Structure Of Cpn-Rls In Complex With Adp From Methanococcus Maripaludis Length = 543 | Back alignment and structure |
| >pdb|3IZI|A Chain A, Mm-Cpn Rls With Atp Length = 513 | Back alignment and structure |
| >pdb|3P9D|E Chain E, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 562 | Back alignment and structure |
| >pdb|3IYG|D Chain D, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 518 | Back alignment and structure |
| >pdb|3P9D|A Chain A, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 559 | Back alignment and structure |
| >pdb|3J02|A Chain A, Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Bound State Length = 491 | Back alignment and structure |
| >pdb|3P9D|D Chain D, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 528 | Back alignment and structure |
| >pdb|3IYG|Q Chain Q, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 512 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 216 | |||
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 8e-32 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 1e-31 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 2e-31 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 4e-05 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 2e-31 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 3e-31 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 2e-05 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 3e-31 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 3e-04 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 3e-31 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 1e-04 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 3e-31 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 6e-07 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 4e-31 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 4e-31 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 7e-06 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 5e-31 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 1e-04 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 6e-31 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 1e-30 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 1e-30 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 2e-30 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 3e-30 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 5e-30 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 3e-29 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 3e-27 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 5e-27 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 1e-04 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 2e-25 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 7e-19 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 3e-05 | |
| 1gml_A | 178 | T-complex protein 1 subunit gamma; chaperone, chap | 1e-10 |
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
Score = 119 bits (302), Expect = 8e-32
Identities = 48/66 (72%), Positives = 61/66 (92%)
Query: 55 LGDEYFCYITECQNPKACTILLRGASKDLLNETERNLQDALHVARNIMLEPKLVPGGGAV 114
+GDEYF +ITEC++PKACTILLRGASK++L+E ERNLQDA+ V RN++L+P+LVPGGGA
Sbjct: 343 IGDEYFTFITECKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGAS 402
Query: 115 EMAVSH 120
EMAV+H
Sbjct: 403 EMAVAH 408
|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 | Back alignment and structure |
|---|
| >1gml_A T-complex protein 1 subunit gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} SCOP: c.8.5.2 PDB: 1gn1_A Length = 178 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 100.0 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 100.0 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 100.0 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 100.0 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 100.0 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 100.0 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 100.0 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 100.0 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 100.0 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 100.0 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 100.0 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 100.0 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 100.0 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 100.0 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 100.0 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 100.0 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 100.0 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 100.0 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 100.0 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 100.0 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 100.0 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 100.0 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 99.96 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 99.96 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 99.96 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 99.96 | |
| 1gml_A | 178 | T-complex protein 1 subunit gamma; chaperone, chap | 99.44 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 99.03 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 98.96 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 98.95 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 98.93 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 98.92 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 98.9 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 98.9 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 98.89 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 98.86 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 98.85 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 98.85 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 98.84 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 98.83 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 98.83 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 98.82 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 98.82 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 98.81 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 98.78 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 98.78 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 98.75 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 98.75 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 98.74 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 98.64 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 98.57 | |
| 1ass_A | 159 | Thermosome; chaperonin, HSP60, TCP1, groel, thermo | 98.56 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 98.55 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 98.53 |
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-36 Score=287.34 Aligned_cols=196 Identities=32% Similarity=0.447 Sum_probs=170.8
Q ss_pred CcEEEEecCcccccccchhhhhhhcCceeeeeecccCc---ce-eceEEEEEECCeEEEEEeecCCCceEEEEEeCCChh
Q psy2833 7 APVLVLSSNTKRDSGRKVQLENIQAGKYIDSSIVTLNH---WL-CSSQDACLLGDEYFCYITECQNPKACTILLRGASKD 82 (216)
Q Consensus 7 ~~~~v~~~~~~r~~~~~~~~~~i~~G~~i~~sl~~~~~---g~-c~~v~~~~ig~~~~~~~~~~~~~~~~TIllrG~t~~ 82 (216)
..++++++..+++ +++...+|||+++++++++++ |+ |+.|+++++|+++|+||++|+++++|||+|||+|++
T Consensus 295 ~~I~av~~~~k~~----leria~~tGa~ii~~l~~l~~~~LG~~a~~v~~~~~g~~~~~~i~g~~~~~~~TIllrG~t~~ 370 (515)
T 3iyg_G 295 ANITAIRRVRKTD----NNRIARACGARIVSRPEELREEDVGTGAGLLEIKKIGDEYFTFITECKDPKACTILLRGASKE 370 (515)
T ss_pred CCceeeccCCHHH----HHHHHHHhCCeeeccccccChhhcCCcccEEEEEEECCceEEEEeCCCCCCeEEEEEcCCCHH
Confidence 4566664444443 444555799999999999986 99 999999999999999999999999999999999999
Q ss_pred hHHHHHHHhchhhHHHHHHhcCCeEEecCCchhHHHHHHHhhhh-----hhhHHHHHHHHHHHHHHHHHhcCcccCCCCh
Q psy2833 83 LLNETERNLQDALHVARNIMLEPKLVPGGGAVEMAVSHVSASKD-----LLNETERNLQDALHVARNIMLEPKLVPGGGA 157 (216)
Q Consensus 83 ~l~E~ersi~Dal~v~~~~~~~~~vV~GGGa~E~~ls~~L~~~~-----~~~e~~ra~adAL~vIp~~L~~N~~v~Ggga 157 (216)
+++|+||+++||+++++++++++++|||||++|+++|.+|++++ .++.++++|++||++||++|++|+ |.++
T Consensus 371 ~l~E~er~i~Dal~~~r~~~~~~~ivpGGGa~e~~~~~~L~~~~~~~~g~eq~~i~~~a~Ale~ip~~La~Na---G~d~ 447 (515)
T 3iyg_G 371 ILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNC---GAST 447 (515)
T ss_pred HHHHHHHHHHHHHHHHHHHhhCCcEEeCCCHHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHHHhc---CCCH
Confidence 99999999999999999999999999999999999999999986 899999999999999999999999 8899
Q ss_pred hHHHHHHHHHHhhhhcCCceEEEEeeccCCCCCCCCCCcccccchhhhhhhhhhhh
Q psy2833 158 VEMAVSHVSSCFQDNLLGRVVVTLGLHAGGPGLIPGGAEVFFGSVLGVRGALSLVR 213 (216)
Q Consensus 158 ~E~~~s~~L~~~a~~~~g~~~~~i~~~~~~~~~~~~~~gi~~~~~~~~~~~~~~~~ 213 (216)
.++.. .|+..+.+ .+...+|+|+.+|++.|| .++||||+..++.+++++|.-
T Consensus 448 ~~~v~--~l~~~h~~-~~~~~~G~d~~~g~~~d~-~~~gi~dp~~vk~~al~~A~e 499 (515)
T 3iyg_G 448 IRLLT--SLRAKHTQ-ENCETWGVNGETGTLVDM-KELGIWEPLAVKLQTYKTAVE 499 (515)
T ss_pred HHHHH--HHHHHHHh-cCCCceeeeCCCCccccc-HHcCCEEcHHHHHHHHHHHHH
Confidence 98765 34332221 234478999999999988 578999999999999998764
|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >1gml_A T-complex protein 1 subunit gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} SCOP: c.8.5.2 PDB: 1gn1_A | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >1ass_A Thermosome; chaperonin, HSP60, TCP1, groel, thermoplasma ACI ATP-binding; 2.30A {Thermoplasma acidophilum} SCOP: c.8.5.2 PDB: 1asx_A | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 216 | ||||
| d1gmla_ | 168 | c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musc | 6e-07 |
| >d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} Length = 168 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: The "swivelling" beta/beta/alpha domain superfamily: GroEL apical domain-like family: Group II chaperonin (CCT, TRIC), apical domain domain: Thermosome, A-domain species: Mouse (Mus musculus), gamma chain [TaxId: 10090]
Score = 45.8 bits (108), Expect = 6e-07
Identities = 18/44 (40%), Positives = 25/44 (56%)
Query: 35 IDSSIVTLNHWLCSSQDACLLGDEYFCYITECQNPKACTILLRG 78
+ + +GDEYF +IT+C++PKACTILLRG
Sbjct: 125 PEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRG 168
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| d1a6db1 | 243 | Thermosome, E domain {Archaeon Thermoplasma acidop | 99.61 | |
| d1a6da1 | 245 | Thermosome, E domain {Archaeon Thermoplasma acidop | 99.3 | |
| d1gmla_ | 168 | Thermosome, A-domain {Mouse (Mus musculus), gamma | 98.99 | |
| d1we3a1 | 255 | GroEL, E domain {Thermus thermophilus [TaxId: 274] | 98.94 | |
| d1q3qa1 | 258 | Thermosome, E domain {Archaeon Thermococcus sp. ks | 98.77 | |
| d1a6db2 | 152 | Thermosome, A-domain {Archaeon Thermoplasma acidop | 98.62 | |
| d1q3qa2 | 153 | Thermosome, A-domain {Archaeon Thermococcus sp. ks | 98.59 | |
| d1assa_ | 152 | Thermosome, A-domain {Archaeon Thermoplasma acidop | 98.4 | |
| d1sjpa1 | 180 | GroEL, E domain {Mycobacterium tuberculosis, GroEL | 98.35 | |
| d1a6db1 | 243 | Thermosome, E domain {Archaeon Thermoplasma acidop | 97.49 | |
| d1a6da1 | 245 | Thermosome, E domain {Archaeon Thermoplasma acidop | 95.53 | |
| d1we3a1 | 255 | GroEL, E domain {Thermus thermophilus [TaxId: 274] | 93.72 | |
| d1ioka1 | 252 | GroEL, E domain {Paracoccus denitrificans [TaxId: | 92.37 | |
| d1q3qa1 | 258 | Thermosome, E domain {Archaeon Thermococcus sp. ks | 86.15 |
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GroEL equatorial domain-like superfamily: GroEL equatorial domain-like family: Group II chaperonin (CCT, TRIC), ATPase domain domain: Thermosome, E domain species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]
Probab=99.61 E-value=4.7e-16 Score=131.71 Aligned_cols=131 Identities=13% Similarity=0.118 Sum_probs=112.5
Q ss_pred EEeCCChh-hHHHHHHHhchhhHHHHHHhcCCeEEecCCchhHHHHHHHhhhh-----hhhHHHHHHHHHHHHHHHHHhc
Q psy2833 75 LLRGASKD-LLNETERNLQDALHVARNIMLEPKLVPGGGAVEMAVSHVSASKD-----LLNETERNLQDALHVARNIMLE 148 (216)
Q Consensus 75 llrG~t~~-~l~E~ersi~Dal~v~~~~~~~~~vV~GGGa~E~~ls~~L~~~~-----~~~e~~ra~adAL~vIp~~L~~ 148 (216)
+-+|-++. +.+-+++++++++..++....+..+++|||++|+++|..|++++ +.++++++|++||++||++|++
T Consensus 94 i~~G~~p~~I~~g~~~a~~~~~~~L~~~a~~v~~~~ggGa~e~~~a~~l~~~a~~~~g~~q~~i~~~a~Ale~ip~~Lae 173 (243)
T d1a6db1 94 INQNVHPTVISEGYRMASEEAKRVIDEISTKIAYAAGGGATAAEIAFRLRSYAQKIGGRQQLAIEKFADAIEEIPRALAE 173 (243)
T ss_dssp HHTTCCHHHHHHHHHHHHHHHHHHHHHHCEECEEEETTTHHHHHHHHHHHHHHHHTCSSHHHHHHHHHHHHTHHHHHHHH
T ss_pred HHcCCCHHHHHHHHHHHHHHHHHHHHhhccccccccCCCchhHHHHHHHhhhhhccCCHHHHHHHHHHHHhhccCccccc
Confidence 34466555 55668889999999999999999999999999999999999998 8899999999999999999999
Q ss_pred CcccCCCChhHHHHHHHHHHhhhhcCCceEEEEeeccCCCCCCCCCCcccccchhhhhhhhhhhh
Q psy2833 149 PKLVPGGGAVEMAVSHVSSCFQDNLLGRVVVTLGLHAGGPGLIPGGAEVFFGSVLGVRGALSLVR 213 (216)
Q Consensus 149 N~~v~Ggga~E~~~s~~L~~~a~~~~g~~~~~i~~~~~~~~~~~~~~gi~~~~~~~~~~~~~~~~ 213 (216)
|+ |.++.|+... |+ +.|.++..++|+|..+|++.|+ .+.||||+..++.++++++..
T Consensus 174 Na---G~d~~~~i~~--l~--~~h~~~~~~~Gvd~~~g~i~d~-~~~gV~dp~~vk~~ai~~A~e 230 (243)
T d1a6db1 174 NA---GLDPIDILLK--LR--AEHAKGNKTYGINVFTGEIEDM-VKNGVIEPIRVGKQAIESATE 230 (243)
T ss_dssp HH---TCCHHHHHHH--HH--HHHHTTCTTEEEETTTTEEEET-TTTTCEEEHHHHHHHHHHHHH
T ss_pred cC---CCChhHHHHH--HH--HHHhCCCCceeEECcCCEEeeh-HhcccEecHHHHHHHHHHHHH
Confidence 99 8899988763 22 3345677889999999999987 578999999999999888754
|
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|
| >d1a6db2 c.8.5.2 (B:216-367) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1q3qa2 c.8.5.2 (A:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|
| >d1assa_ c.8.5.2 (A:) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|