Psyllid ID: psy2834
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 137 | ||||||
| 322800429 | 550 | hypothetical protein SINV_09122 [Solenop | 0.525 | 0.130 | 0.780 | 5e-23 | |
| 332020672 | 550 | T-complex protein 1 subunit gamma [Acrom | 0.525 | 0.130 | 0.767 | 7e-23 | |
| 307185868 | 549 | T-complex protein 1 subunit gamma [Campo | 0.525 | 0.131 | 0.767 | 1e-22 | |
| 307204854 | 550 | T-complex protein 1 subunit gamma [Harpe | 0.510 | 0.127 | 0.773 | 1e-22 | |
| 193618005 | 551 | PREDICTED: t-complex protein 1 subunit g | 0.540 | 0.134 | 0.693 | 8e-22 | |
| 340714939 | 514 | PREDICTED: t-complex protein 1 subunit g | 0.518 | 0.138 | 0.75 | 1e-21 | |
| 340714937 | 550 | PREDICTED: t-complex protein 1 subunit g | 0.518 | 0.129 | 0.75 | 1e-21 | |
| 350402034 | 550 | PREDICTED: T-complex protein 1 subunit g | 0.518 | 0.129 | 0.75 | 1e-21 | |
| 383854408 | 550 | PREDICTED: T-complex protein 1 subunit g | 0.518 | 0.129 | 0.75 | 3e-21 | |
| 380011241 | 511 | PREDICTED: T-complex protein 1 subunit g | 0.518 | 0.138 | 0.736 | 7e-21 |
| >gi|322800429|gb|EFZ21433.1| hypothetical protein SINV_09122 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 112 bits (280), Expect = 5e-23, Method: Compositional matrix adjust.
Identities = 57/73 (78%), Positives = 64/73 (87%), Gaps = 1/73 (1%)
Query: 66 TTFGINGETGDLVDMKTLGIWEPLTVKLQVYKTAVETAILLLRIDDIVSGSKKKKDENQN 125
TT+GI+GETG LVDMK GIWEPL+VKLQ YKTA+ETAILLLRIDDIVSGSKKKK+EN
Sbjct: 478 TTWGIDGETGKLVDMKERGIWEPLSVKLQTYKTAIETAILLLRIDDIVSGSKKKKNENDT 537
Query: 126 -QAAQPTEESMRE 137
Q +Q TEESM+E
Sbjct: 538 AQPSQVTEESMKE 550
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332020672|gb|EGI61078.1| T-complex protein 1 subunit gamma [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307185868|gb|EFN71709.1| T-complex protein 1 subunit gamma [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307204854|gb|EFN83412.1| T-complex protein 1 subunit gamma [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|193618005|ref|XP_001948977.1| PREDICTED: t-complex protein 1 subunit gamma-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|340714939|ref|XP_003395979.1| PREDICTED: t-complex protein 1 subunit gamma-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340714937|ref|XP_003395978.1| PREDICTED: t-complex protein 1 subunit gamma-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350402034|ref|XP_003486345.1| PREDICTED: T-complex protein 1 subunit gamma-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383854408|ref|XP_003702713.1| PREDICTED: T-complex protein 1 subunit gamma-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380011241|ref|XP_003689719.1| PREDICTED: T-complex protein 1 subunit gamma-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 137 | ||||||
| RGD|735038 | 545 | Cct3 "chaperonin containing Tc | 0.467 | 0.117 | 0.75 | 1.8e-23 | |
| MGI|MGI:104708 | 545 | Cct3 "chaperonin containing Tc | 0.467 | 0.117 | 0.75 | 2.2e-23 | |
| UNIPROTKB|B4DUR8 | 500 | CCT3 "cDNA, FLJ78822, highly s | 0.467 | 0.128 | 0.75 | 9.7e-22 | |
| UNIPROTKB|Q3T0K2 | 545 | CCT3 "T-complex protein 1 subu | 0.467 | 0.117 | 0.75 | 1.6e-21 | |
| UNIPROTKB|P49368 | 545 | CCT3 "T-complex protein 1 subu | 0.467 | 0.117 | 0.75 | 1.6e-21 | |
| UNIPROTKB|F1RP17 | 547 | CCT3 "T-complex protein 1 subu | 0.467 | 0.117 | 0.75 | 1.6e-21 | |
| UNIPROTKB|E2RB79 | 549 | CCT3 "Uncharacterized protein" | 0.467 | 0.116 | 0.75 | 1.6e-21 | |
| ZFIN|ZDB-GENE-020419-5 | 543 | cct3 "chaperonin containing TC | 0.627 | 0.158 | 0.579 | 1.8e-19 | |
| FB|FBgn0015019 | 544 | Cctgamma "Cctgamma" [Drosophil | 0.627 | 0.158 | 0.563 | 2.2e-18 | |
| SGD|S000003551 | 534 | CCT3 "Subunit of the cytosolic | 0.416 | 0.106 | 0.561 | 3.6e-18 |
| RGD|735038 Cct3 "chaperonin containing Tcp1, subunit 3 (gamma)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 1.8e-23, Sum P(3) = 1.8e-23
Identities = 48/64 (75%), Positives = 52/64 (81%)
Query: 67 TFGINGETGDLVDMKTLGIWEPLTVKLQVYKTAVETAILLLRIDDIVSGSKKKKDENQNQ 126
T+G+NGETG LVDMK LGIWEPL VKLQ YKTAVETA+LLLRIDDIVSG KKK D+ Q
Sbjct: 477 TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQ 536
Query: 127 AAQP 130
P
Sbjct: 537 TGAP 540
|
|
| MGI|MGI:104708 Cct3 "chaperonin containing Tcp1, subunit 3 (gamma)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DUR8 CCT3 "cDNA, FLJ78822, highly similar to T-complex protein 1 subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0K2 CCT3 "T-complex protein 1 subunit gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49368 CCT3 "T-complex protein 1 subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RP17 CCT3 "T-complex protein 1 subunit gamma" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RB79 CCT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020419-5 cct3 "chaperonin containing TCP1, subunit 3 (gamma)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015019 Cctgamma "Cctgamma" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| SGD|S000003551 CCT3 "Subunit of the cytosolic chaperonin Cct ring complex" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 137 | |||
| TIGR02344 | 525 | TIGR02344, chap_CCT_gamma, T-complex protein 1, ga | 2e-25 | |
| cd03337 | 480 | cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type | 4e-25 | |
| cd00309 | 464 | cd00309, chaperonin_type_I_II, chaperonin families | 1e-14 | |
| pfam00118 | 481 | pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami | 5e-14 | |
| cd03343 | 517 | cd03343, cpn60, cpn60 chaperonin family | 5e-13 | |
| TIGR02339 | 519 | TIGR02339, thermosome_arch, thermosome, various su | 2e-11 | |
| COG0459 | 524 | COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po | 7e-11 | |
| PTZ00212 | 533 | PTZ00212, PTZ00212, T-complex protein 1 subunit be | 2e-10 | |
| cd03336 | 517 | cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type | 2e-10 | |
| TIGR02341 | 518 | TIGR02341, chap_CCT_beta, T-complex protein 1, bet | 1e-07 | |
| cd03337 | 480 | cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type | 4e-07 | |
| cd03338 | 515 | cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type | 1e-06 | |
| TIGR02344 | 525 | TIGR02344, chap_CCT_gamma, T-complex protein 1, ga | 3e-06 | |
| cd03340 | 522 | cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type I | 5e-06 | |
| TIGR02345 | 523 | TIGR02345, chap_CCT_eta, T-complex protein 1, eta | 9e-06 | |
| cd03335 | 527 | cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type | 5e-05 | |
| TIGR02340 | 536 | TIGR02340, chap_CCT_alpha, T-complex protein 1, al | 7e-05 | |
| cd03341 | 472 | cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type | 8e-05 | |
| TIGR02342 | 517 | TIGR02342, chap_CCT_delta, T-complex protein 1, de | 6e-04 | |
| cd00309 | 464 | cd00309, chaperonin_type_I_II, chaperonin families | 8e-04 | |
| cd03343 | 517 | cd03343, cpn60, cpn60 chaperonin family | 0.001 | |
| cd03342 | 484 | cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type | 0.003 |
| >gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
Score = 99.8 bits (249), Expect = 2e-25
Identities = 41/58 (70%), Positives = 48/58 (82%)
Query: 62 GDGETTFGINGETGDLVDMKTLGIWEPLTVKLQVYKTAVETAILLLRIDDIVSGSKKK 119
+G T+GI+GETG +VDMK GIWEPL VKLQ YKTA+E+A +LLRIDDIVSG KKK
Sbjct: 468 QEGNCTWGIDGETGKIVDMKEKGIWEPLAVKLQTYKTAIESACMLLRIDDIVSGVKKK 525
|
Members of this family, all eukaryotic, are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT gamma chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes. Length = 525 |
| >gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|233823 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239452 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|211733 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239454 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239456 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|200176 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239451 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|239458 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| KOG0361|consensus | 543 | 99.91 | ||
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 99.89 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 99.89 | |
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 99.89 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 99.89 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 99.89 | |
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 99.88 | |
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 99.88 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 99.88 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 99.88 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 99.88 | |
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 99.87 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 99.87 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 99.87 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 99.87 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 99.87 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 99.86 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 99.86 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 99.86 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 99.86 | |
| KOG0363|consensus | 527 | 99.86 | ||
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 99.86 | |
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 99.86 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 99.86 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 99.86 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 99.85 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 99.84 | |
| KOG0362|consensus | 537 | 99.84 | ||
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 99.83 | |
| CHL00093 | 529 | groEL chaperonin GroEL | 99.83 | |
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 99.81 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 99.81 | |
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 99.81 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 99.8 | |
| PF00118 | 485 | Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon | 99.8 | |
| KOG0358|consensus | 534 | 99.79 | ||
| KOG0357|consensus | 400 | 99.79 | ||
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 99.78 | |
| KOG0364|consensus | 527 | 99.64 | ||
| KOG0359|consensus | 520 | 99.55 | ||
| KOG0360|consensus | 545 | 99.43 | ||
| KOG0356|consensus | 550 | 98.25 | ||
| KOG0361|consensus | 543 | 93.18 | ||
| KOG0364|consensus | 527 | 93.01 | ||
| KOG0358|consensus | 534 | 92.36 | ||
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 92.34 | |
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 92.22 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 92.17 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 91.75 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 91.68 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 91.62 | |
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 91.52 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 91.46 | |
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 91.39 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 91.25 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 91.24 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 91.24 | |
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 91.14 | |
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 91.14 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 90.72 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 90.28 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 90.07 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 90.05 | |
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 89.86 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 89.58 | |
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 89.28 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 89.24 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 89.23 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 89.14 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 88.96 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 88.81 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 88.75 | |
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 88.48 | |
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 88.11 | |
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 86.37 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 85.58 | |
| CHL00093 | 529 | groEL chaperonin GroEL | 84.85 |
| >KOG0361|consensus | Back alignment and domain information |
|---|
Probab=99.91 E-value=5.3e-24 Score=179.99 Aligned_cols=112 Identities=21% Similarity=0.260 Sum_probs=106.6
Q ss_pred chhHHHHhhcCCChhHHHHHHH--HHhhh-HHHHhccCccHHHHHHHHHHHhhCCCceeeeeccCcchhhhhhhCccccH
Q psy2834 13 KKDENQNQAAQPTEEQYPASLV--ILEGK-TAAGKYTGKSMIEIARTQDEEVGDGETTFGINGETGDLVDMKTLGIWEPL 89 (137)
Q Consensus 13 ~~~~~~~a~~~~g~e~~~i~af--aLe~I-k~La~NaG~d~ieil~~l~~~~~~G~~~~GVdl~~g~i~d~~e~gV~dP~ 89 (137)
.|=++++++++.|++|+-+.+| |||+| |+|++|+|+|.++++++||..|+.|..||||++.++.+.|+++.+||||.
T Consensus 417 Sk~lRd~S~ti~gK~q~~i~A~akalEvIPrqLc~NaGfDa~~ilnkLR~rHA~G~~w~Gvdi~~e~i~dn~~~~VwEP~ 496 (543)
T KOG0361|consen 417 SKYLRDYSRTIAGKQQLFINAYAKALEVIPRQLCDNAGFDATNILNKLRQRHAQGEKWYGVDINTEGIADNFEKFVWEPS 496 (543)
T ss_pred HHHHHHhhcccCcHHHHHHHHHHHHHHHhHHHHhhhcCCcHHHHHHHHHHHhhcCCceeeeeecccchhhHHHhhccChH
Confidence 3668999999999999999999 99999 99999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHhchhhhhcCCcCCCCCCC
Q psy2834 90 TVKLQVYKTAVETAILLLRIDDIVSGSKKKKDENQ 124 (137)
Q Consensus 90 ~vK~~~i~~Ate~A~~ILrID~iI~~~~~~~~~~~ 124 (137)
.||++++..|+|+|++||.||+.|++++++++.+.
T Consensus 497 ~VK~Nai~aateAa~lIlsvDeTikn~~S~~~~p~ 531 (543)
T KOG0361|consen 497 IVKINAITAATEAACLILSVDETIKNPKSQSAPPS 531 (543)
T ss_pred HHHHHHHHHHHHhhhheEehhhhhcCCcccCCCCC
Confidence 99999999999999999999999999887776533
|
|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >KOG0363|consensus | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >KOG0362|consensus | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism | Back alignment and domain information |
|---|
| >KOG0358|consensus | Back alignment and domain information |
|---|
| >KOG0357|consensus | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >KOG0364|consensus | Back alignment and domain information |
|---|
| >KOG0359|consensus | Back alignment and domain information |
|---|
| >KOG0360|consensus | Back alignment and domain information |
|---|
| >KOG0356|consensus | Back alignment and domain information |
|---|
| >KOG0361|consensus | Back alignment and domain information |
|---|
| >KOG0364|consensus | Back alignment and domain information |
|---|
| >KOG0358|consensus | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 137 | ||||
| 3iyg_G | 515 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 3e-20 | ||
| 3p9d_C | 590 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 4e-13 | ||
| 3ko1_A | 553 | Cystal Structure Of Thermosome From Acidianus Tengc | 9e-08 | ||
| 1a6d_B | 543 | Thermosome From T. Acidophilum Length = 543 | 2e-07 | ||
| 3aq1_B | 500 | Open State Monomer Of A Group Ii Chaperonin From Me | 2e-06 | ||
| 3rus_A | 543 | Crystal Structure Of Cpn-Rls In Complex With Adp Fr | 2e-06 | ||
| 3iyf_A | 521 | Atomic Model Of The Lidless Mm-Cpn In The Open Stat | 2e-06 | ||
| 3los_A | 543 | Atomic Model Of Mm-Cpn In The Closed State Length = | 2e-06 | ||
| 1a6d_A | 545 | Thermosome From T. Acidophilum Length = 545 | 5e-06 | ||
| 3j02_A | 491 | Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Boun | 6e-06 | ||
| 3izk_A | 491 | Mm-Cpn Rls Deltalid With Atp Length = 491 | 6e-06 | ||
| 3izi_A | 513 | Mm-Cpn Rls With Atp Length = 513 | 6e-06 | ||
| 3izn_A | 491 | Mm-Cpn Deltalid With Atp Length = 491 | 6e-06 | ||
| 3izh_A | 513 | Mm-Cpn D386a With Atp Length = 513 | 7e-06 | ||
| 1q2v_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 8e-06 | ||
| 1q3s_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 8e-06 | ||
| 1q3r_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 8e-06 | ||
| 3iyg_B | 513 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 2e-05 | ||
| 3p9d_B | 527 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 3e-04 |
| >pdb|3IYG|G Chain G, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 | Back alignment and structure |
|
| >pdb|3P9D|C Chain C, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 590 | Back alignment and structure |
| >pdb|3KO1|A Chain A, Cystal Structure Of Thermosome From Acidianus Tengchongensis Strain S5 Length = 553 | Back alignment and structure |
| >pdb|1A6D|B Chain B, Thermosome From T. Acidophilum Length = 543 | Back alignment and structure |
| >pdb|3AQ1|B Chain B, Open State Monomer Of A Group Ii Chaperonin From Methanococcoides Burtonii Length = 500 | Back alignment and structure |
| >pdb|3RUS|A Chain A, Crystal Structure Of Cpn-Rls In Complex With Adp From Methanococcus Maripaludis Length = 543 | Back alignment and structure |
| >pdb|3IYF|A Chain A, Atomic Model Of The Lidless Mm-Cpn In The Open State Length = 521 | Back alignment and structure |
| >pdb|3LOS|A Chain A, Atomic Model Of Mm-Cpn In The Closed State Length = 543 | Back alignment and structure |
| >pdb|1A6D|A Chain A, Thermosome From T. Acidophilum Length = 545 | Back alignment and structure |
| >pdb|3J02|A Chain A, Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Bound State Length = 491 | Back alignment and structure |
| >pdb|3IZK|A Chain A, Mm-Cpn Rls Deltalid With Atp Length = 491 | Back alignment and structure |
| >pdb|3IZI|A Chain A, Mm-Cpn Rls With Atp Length = 513 | Back alignment and structure |
| >pdb|3IZN|A Chain A, Mm-Cpn Deltalid With Atp Length = 491 | Back alignment and structure |
| >pdb|3IZH|A Chain A, Mm-Cpn D386a With Atp Length = 513 | Back alignment and structure |
| >pdb|1Q2V|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form) Length = 548 | Back alignment and structure |
| >pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548 | Back alignment and structure |
| >pdb|1Q3R|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form Of Single Mutant) Length = 548 | Back alignment and structure |
| >pdb|3IYG|B Chain B, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 513 | Back alignment and structure |
| >pdb|3P9D|B Chain B, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 527 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 137 | |||
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 2e-22 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 8e-06 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 4e-22 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 9e-06 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 5e-22 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 8e-06 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 6e-22 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 8e-06 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 1e-21 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 1e-05 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 1e-21 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 8e-06 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 2e-21 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 8e-06 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 2e-21 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 9e-06 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 2e-20 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 8e-06 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 3e-20 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 9e-06 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 6e-20 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 1e-05 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 9e-20 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 1e-05 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 1e-19 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 1e-05 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 2e-19 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 4e-06 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 3e-19 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 1e-05 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 4e-19 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 9e-06 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 1e-18 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 7e-06 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 2e-18 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 8e-06 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 4e-18 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 1e-05 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 9e-18 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 1e-05 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 2e-16 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 5e-05 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 5e-16 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 5e-05 |
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 | Back alignment and structure |
|---|
Score = 90.7 bits (226), Expect = 2e-22
Identities = 26/72 (36%), Positives = 41/72 (56%)
Query: 63 DGETTFGINGETGDLVDMKTLGIWEPLTVKLQVYKTAVETAILLLRIDDIVSGSKKKKDE 122
G T+GIN TG++ DM G+ EP+ V Q ++A E AI++LRIDD+++
Sbjct: 470 KGNKTYGINVFTGEIEDMVKNGVIEPIRVGKQAIESATEAAIMILRIDDVIATKSSSSSS 529
Query: 123 NQNQAAQPTEES 134
N ++ +E S
Sbjct: 530 NPPKSGSSSESS 541
|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 99.93 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 99.92 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 99.92 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 99.92 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 99.92 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 99.92 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 99.91 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 99.91 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 99.91 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 99.91 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 99.91 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 99.91 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 99.91 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 99.91 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 99.91 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 99.9 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 99.9 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 99.9 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 99.9 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 99.89 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 99.89 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 99.89 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 99.88 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 99.86 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 99.84 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 99.83 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 93.69 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 93.67 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 93.21 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 93.07 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 93.03 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 92.98 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 92.96 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 92.55 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 92.54 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 92.42 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 92.2 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 92.09 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 91.85 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 91.77 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 91.67 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 91.59 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 91.36 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 90.79 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 90.19 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 90.19 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 89.55 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 89.32 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 87.15 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 86.39 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 85.55 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 81.95 |
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
Probab=99.93 E-value=8.9e-26 Score=195.92 Aligned_cols=104 Identities=21% Similarity=0.236 Sum_probs=98.6
Q ss_pred hhHHHHhhcCCChhHHHHHHH--HHhhh-HHHHhccCccHHHHHHHHHHHhhCCC--------ceeeeeccCcchhhhhh
Q psy2834 14 KDENQNQAAQPTEEQYPASLV--ILEGK-TAAGKYTGKSMIEIARTQDEEVGDGE--------TTFGINGETGDLVDMKT 82 (137)
Q Consensus 14 ~~~~~~a~~~~g~e~~~i~af--aLe~I-k~La~NaG~d~ieil~~l~~~~~~G~--------~~~GVdl~~g~i~d~~e 82 (137)
+-|.+++.+++|++|+++++| |||+| ++||+|||+|+++++.+|+..|..|+ .++|+|+.+|++.||.+
T Consensus 415 ~~L~~~~~~~~g~eq~~i~~fa~ALe~ip~~La~NaG~d~~~~v~~l~~~h~~~~~~~~~~~~~~~G~d~~~g~~~d~~~ 494 (529)
T 3iyg_A 415 IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQ 494 (529)
T ss_pred HHHHHHhhhcCChHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhccccccccccCceeeeeCCCCCccChhh
Confidence 467889999999999999999 99999 99999999999999999999998765 67999999999999999
Q ss_pred hCccccHHHHHHHHHHHHHHHHHHhchhhhhcCCc
Q psy2834 83 LGIWEPLTVKLQVYKTAVETAILLLRIDDIVSGSK 117 (137)
Q Consensus 83 ~gV~dP~~vK~~~i~~Ate~A~~ILrID~iI~~~~ 117 (137)
.|||||+.||.++|++|+|+|++|||||+||+.+|
T Consensus 495 ~gV~dp~~vk~~al~~A~e~a~~iL~iD~ii~~~~ 529 (529)
T 3iyg_A 495 AGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHP 529 (529)
T ss_pred ccCEecHHHHHHHHHHHHHHHHHHHhHHhhhcCCC
Confidence 99999999999999999999999999999998853
|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 137 | ||||
| d1a6db1 | 243 | a.129.1.2 (B:20-144,B:404-521) Thermosome, E domai | 9e-17 | |
| d1a6da1 | 245 | a.129.1.2 (A:17-145,A:404-519) Thermosome, E domai | 3e-15 | |
| d1q3qa1 | 258 | a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain | 6e-13 | |
| d1we3a1 | 255 | a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {The | 2e-08 | |
| d1sjpa1 | 180 | a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {My | 2e-05 |
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Length = 243 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GroEL equatorial domain-like superfamily: GroEL equatorial domain-like family: Group II chaperonin (CCT, TRIC), ATPase domain domain: Thermosome, E domain species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]
Score = 71.7 bits (175), Expect = 9e-17
Identities = 27/68 (39%), Positives = 40/68 (58%)
Query: 47 GKSMIEIARTQDEEVGDGETTFGINGETGDLVDMKTLGIWEPLTVKLQVYKTAVETAILL 106
G I+I E G T+GIN TG++ DM G+ EP+ V Q ++A E AI++
Sbjct: 176 GLDPIDILLKLRAEHAKGNKTYGINVFTGEIEDMVKNGVIEPIRVGKQAIESATEAAIMI 235
Query: 107 LRIDDIVS 114
LRIDD+++
Sbjct: 236 LRIDDVIA 243
|
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Length = 245 | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Length = 258 | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Length = 255 | Back information, alignment and structure |
|---|
| >d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| d1a6db1 | 243 | Thermosome, E domain {Archaeon Thermoplasma acidop | 99.92 | |
| d1a6da1 | 245 | Thermosome, E domain {Archaeon Thermoplasma acidop | 99.89 | |
| d1q3qa1 | 258 | Thermosome, E domain {Archaeon Thermococcus sp. ks | 99.78 | |
| d1we3a1 | 255 | GroEL, E domain {Thermus thermophilus [TaxId: 274] | 99.62 | |
| d1sjpa1 | 180 | GroEL, E domain {Mycobacterium tuberculosis, GroEL | 99.54 | |
| d1ioka1 | 252 | GroEL, E domain {Paracoccus denitrificans [TaxId: | 99.01 | |
| d1kp8a1 | 252 | GroEL, E domain {Escherichia coli [TaxId: 562]} | 98.4 |
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GroEL equatorial domain-like superfamily: GroEL equatorial domain-like family: Group II chaperonin (CCT, TRIC), ATPase domain domain: Thermosome, E domain species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]
Probab=99.92 E-value=5.8e-26 Score=178.63 Aligned_cols=101 Identities=30% Similarity=0.395 Sum_probs=97.7
Q ss_pred hhHHHHhhcCCChhHHHHHHH--HHhhh-HHHHhccCccHHHHHHHHHHHhhCCCceeeeeccCcchhhhhhhCccccHH
Q psy2834 14 KDENQNQAAQPTEEQYPASLV--ILEGK-TAAGKYTGKSMIEIARTQDEEVGDGETTFGINGETGDLVDMKTLGIWEPLT 90 (137)
Q Consensus 14 ~~~~~~a~~~~g~e~~~i~af--aLe~I-k~La~NaG~d~ieil~~l~~~~~~G~~~~GVdl~~g~i~d~~e~gV~dP~~ 90 (137)
.-+.+++++++|++||++++| ||+.| ++||+|+|+|+++++.+++..|..|+.++|||+.+|++.||.+.|||||+.
T Consensus 140 ~~l~~~a~~~~g~~q~~i~~~a~Ale~ip~~LaeNaG~d~~~~i~~l~~~h~~~~~~~Gvd~~~g~i~d~~~~gV~dp~~ 219 (243)
T d1a6db1 140 FRLRSYAQKIGGRQQLAIEKFADAIEEIPRALAENAGLDPIDILLKLRAEHAKGNKTYGINVFTGEIEDMVKNGVIEPIR 219 (243)
T ss_dssp HHHHHHHHHTCSSHHHHHHHHHHHHTHHHHHHHHHHTCCHHHHHHHHHHHHHTTCTTEEEETTTTEEEETTTTTCEEEHH
T ss_pred HHHhhhhhccCCHHHHHHHHHHHHhhccCccccccCCCChhHHHHHHHHHHhCCCCceeEECcCCEEeehHhcccEecHH
Confidence 568899999999999999999 99999 999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHhchhhhhc
Q psy2834 91 VKLQVYKTAVETAILLLRIDDIVS 114 (137)
Q Consensus 91 vK~~~i~~Ate~A~~ILrID~iI~ 114 (137)
||+++|++|+|+|++|||||+||.
T Consensus 220 vk~~ai~~A~e~a~~iL~iD~iis 243 (243)
T d1a6db1 220 VGKQAIESATEAAIMILRIDDVIA 243 (243)
T ss_dssp HHHHHHHHHHHHHHHHHHEEEEEC
T ss_pred HHHHHHHHHHHHHHHHHHHHHhcC
Confidence 999999999999999999999874
|
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|