Psyllid ID: psy2869
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 352 | ||||||
| 157112080 | 233 | proteasome subunit alpha type [Aedes aeg | 0.619 | 0.935 | 0.794 | 1e-100 | |
| 195391646 | 234 | GJ24473 [Drosophila virilis] gi|19415255 | 0.622 | 0.935 | 0.781 | 2e-99 | |
| 195110811 | 234 | GI24829 [Drosophila mojavensis] gi|19391 | 0.622 | 0.935 | 0.786 | 2e-99 | |
| 195055881 | 234 | GH13898 [Drosophila grimshawi] gi|193892 | 0.622 | 0.935 | 0.786 | 3e-99 | |
| 195500484 | 234 | GE26194 [Drosophila yakuba] gi|194183494 | 0.622 | 0.935 | 0.790 | 3e-99 | |
| 194901732 | 234 | GG18927 [Drosophila erecta] gi|190652108 | 0.622 | 0.935 | 0.786 | 4e-99 | |
| 389611553 | 233 | proteasome 25kD subunit, partial [Papili | 0.622 | 0.939 | 0.790 | 4e-99 | |
| 17737927 | 234 | proteasome 25kD subunit [Drosophila mela | 0.622 | 0.935 | 0.790 | 5e-99 | |
| 8394063 | 234 | proteasome subunit alpha type-2 [Rattus | 0.619 | 0.931 | 0.794 | 5e-99 | |
| 378792303 | 234 | Chain A, Mouse Constitutive 20s Proteaso | 0.619 | 0.931 | 0.794 | 5e-99 |
| >gi|157112080|ref|XP_001651784.1| proteasome subunit alpha type [Aedes aegypti] gi|108878177|gb|EAT42402.1| AAEL006061-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 372 bits (955), Expect = e-100, Method: Compositional matrix adjust.
Identities = 174/219 (79%), Positives = 199/219 (90%), Gaps = 1/219 (0%)
Query: 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILF-EDCIHKVEPITDYIGM 59
PSGKLVQIEYALAAV AGAPSVGIKASNG+V+ATE KQK+IL+ E +HKVE +T++IGM
Sbjct: 15 PSGKLVQIEYALAAVSAGAPSVGIKASNGVVIATENKQKSILYDEHSVHKVEMVTNHIGM 74
Query: 60 VYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSL 119
+YSGMGPDYRLLVK+ARKIAQ Y L Y+E IPT QLVQ++A +MQEYTQSGGVRPFGVSL
Sbjct: 75 IYSGMGPDYRLLVKQARKIAQNYYLTYREPIPTSQLVQKIANVMQEYTQSGGVRPFGVSL 134
Query: 120 LICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFLEKRYSEDLELDDAVHTAILT 179
LICGWD RPYL+QCDPSGAYFAWKATAMG+N +NGKTFLEKRYSEDLELDDAVHTAILT
Sbjct: 135 LICGWDEGRPYLFQCDPSGAYFAWKATAMGKNAINGKTFLEKRYSEDLELDDAVHTAILT 194
Query: 180 LKEGFEGQMTAENIEIGIADENGFRRLDVATVRDHLSNI 218
LKEGFEGQM A+NIE+GI D +GFRRL+ + V+D+L+NI
Sbjct: 195 LKEGFEGQMNADNIEVGICDASGFRRLNPSDVKDYLANI 233
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195391646|ref|XP_002054471.1| GJ24473 [Drosophila virilis] gi|194152557|gb|EDW67991.1| GJ24473 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195110811|ref|XP_001999973.1| GI24829 [Drosophila mojavensis] gi|193916567|gb|EDW15434.1| GI24829 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195055881|ref|XP_001994841.1| GH13898 [Drosophila grimshawi] gi|193892604|gb|EDV91470.1| GH13898 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195500484|ref|XP_002097393.1| GE26194 [Drosophila yakuba] gi|194183494|gb|EDW97105.1| GE26194 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194901732|ref|XP_001980405.1| GG18927 [Drosophila erecta] gi|190652108|gb|EDV49363.1| GG18927 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|389611553|dbj|BAM19378.1| proteasome 25kD subunit, partial [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|17737927|ref|NP_524328.1| proteasome 25kD subunit [Drosophila melanogaster] gi|195329530|ref|XP_002031463.1| GM24033 [Drosophila sechellia] gi|195571423|ref|XP_002103702.1| GD18834 [Drosophila simulans] gi|730372|sp|P40301.1|PSA2_DROME RecName: Full=Proteasome subunit alpha type-2; AltName: Full=PROS-Dm25; AltName: Full=Proteasome 25 kDa subunit gi|397850|emb|CAA49783.1| proteasome, 25kDa subunit [Drosophila melanogaster] gi|7299630|gb|AAF54814.1| proteasome 25kD subunit [Drosophila melanogaster] gi|17861896|gb|AAL39425.1| GM13604p [Drosophila melanogaster] gi|194120406|gb|EDW42449.1| GM24033 [Drosophila sechellia] gi|194199629|gb|EDX13205.1| GD18834 [Drosophila simulans] gi|220943850|gb|ACL84468.1| Pros25-PA [synthetic construct] gi|220953688|gb|ACL89387.1| Pros25-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|8394063|ref|NP_058975.1| proteasome subunit alpha type-2 [Rattus norvegicus] gi|134031994|ref|NP_032970.2| proteasome subunit alpha type-2 [Mus musculus] gi|130851|sp|P17220.3|PSA2_RAT RecName: Full=Proteasome subunit alpha type-2; AltName: Full=Macropain subunit C3; AltName: Full=Multicatalytic endopeptidase complex subunit C3; AltName: Full=Proteasome component C3 gi|410516940|sp|P49722.3|PSA2_MOUSE RecName: Full=Proteasome subunit alpha type-2; AltName: Full=Macropain subunit C3; AltName: Full=Multicatalytic endopeptidase complex subunit C3; AltName: Full=Proteasome component C3 gi|5757867|gb|AAD50623.1|AF099733_1 proteasome subunit C3 [Mus musculus] gi|203203|gb|AAA40838.1| proteasome component C3 protein [Rattus norvegicus] gi|12848669|dbj|BAB28045.1| unnamed protein product [Mus musculus] gi|20070847|gb|AAH26768.1| Proteasome (prosome, macropain) subunit, alpha type 2 [Mus musculus] gi|26330760|dbj|BAC29110.1| unnamed protein product [Mus musculus] gi|74150581|dbj|BAE32314.1| unnamed protein product [Mus musculus] gi|74198623|dbj|BAE39787.1| unnamed protein product [Mus musculus] gi|74207151|dbj|BAE30769.1| unnamed protein product [Mus musculus] gi|74225230|dbj|BAE31553.1| unnamed protein product [Mus musculus] gi|148700791|gb|EDL32738.1| proteasome (prosome, macropain) subunit, alpha type 2 [Mus musculus] gi|149032537|gb|EDL87415.1| rCG45322 [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|378792303|pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 gi|378792317|pdb|3UNB|O Chain O, Mouse Constitutive 20s Proteasome In Complex With Pr-957 gi|378792331|pdb|3UNB|CC Chain c, Mouse Constitutive 20s Proteasome In Complex With Pr-957 gi|378792345|pdb|3UNB|QQ Chain q, Mouse Constitutive 20s Proteasome In Complex With Pr-957 gi|378792359|pdb|3UNE|A Chain A, Mouse Constitutive 20s Proteasome gi|378792373|pdb|3UNE|O Chain O, Mouse Constitutive 20s Proteasome gi|378792387|pdb|3UNE|CC Chain c, Mouse Constitutive 20s Proteasome gi|378792401|pdb|3UNE|QQ Chain q, Mouse Constitutive 20s Proteasome gi|378792415|pdb|3UNF|A Chain A, Mouse 20s Immunoproteasome In Complex With Pr-957 gi|378792429|pdb|3UNF|O Chain O, Mouse 20s Immunoproteasome In Complex With Pr-957 gi|378792443|pdb|3UNH|A Chain A, Mouse 20s Immunoproteasome gi|378792457|pdb|3UNH|O Chain O, Mouse 20s Immunoproteasome gi|897784|emb|CAA49782.1| proteasome, 25 kDa subunit [Mus musculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 352 | ||||||
| ZFIN|ZDB-GENE-060503-941 | 234 | si:rp71-45k5.4 "si:rp71-45k5.4 | 0.619 | 0.931 | 0.808 | 1.9e-92 | |
| ZFIN|ZDB-GENE-050522-479 | 234 | psma2 "proteasome (prosome, ma | 0.619 | 0.931 | 0.808 | 2.4e-92 | |
| UNIPROTKB|O73672 | 234 | psma2 "Proteasome subunit alph | 0.619 | 0.931 | 0.803 | 3.9e-92 | |
| UNIPROTKB|P24495 | 234 | psma2 "Proteasome subunit alph | 0.619 | 0.931 | 0.799 | 2.1e-91 | |
| FB|FBgn0086134 | 234 | Prosalpha2 "Proteasome alpha2 | 0.622 | 0.935 | 0.790 | 2.7e-91 | |
| MGI|MGI:104885 | 234 | Psma2 "proteasome (prosome, ma | 0.619 | 0.931 | 0.789 | 2.7e-91 | |
| RGD|61842 | 234 | Psma2 "proteasome (prosome, ma | 0.619 | 0.931 | 0.789 | 2.7e-91 | |
| UNIPROTKB|Q3T0Y5 | 234 | PSMA2 "Proteasome subunit alph | 0.619 | 0.931 | 0.785 | 5.7e-91 | |
| UNIPROTKB|P25787 | 234 | PSMA2 "Proteasome subunit alph | 0.619 | 0.931 | 0.785 | 5.7e-91 | |
| UNIPROTKB|I3LAB6 | 234 | LOC100620420 "Proteasome subun | 0.619 | 0.931 | 0.785 | 5.7e-91 |
| ZFIN|ZDB-GENE-060503-941 si:rp71-45k5.4 "si:rp71-45k5.4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 921 (329.3 bits), Expect = 1.9e-92, P = 1.9e-92
Identities = 177/219 (80%), Positives = 199/219 (90%)
Query: 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILF-EDCIHKVEPITDYIGM 59
PSGKLVQIEYALAAV AGAPSVGIKASNG+VLATEKKQK+IL+ E +HKVEPIT +IGM
Sbjct: 15 PSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGM 74
Query: 60 VYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSL 119
VYSGMGPDYR+LV++ARK+AQQY LVYQE IPT QLVQRVA++MQEYTQSGGVRPFGVSL
Sbjct: 75 VYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSL 134
Query: 120 LICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFLEKRYSEDLELDDAVHTAILT 179
LI GWD RPYL+Q DPSGAYFAWKATAMG+NYVNGKTFLEKRY+EDLEL+DA+HTAILT
Sbjct: 135 LIAGWDEDRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILT 194
Query: 180 LKEGFEGQMTAENIEIGIADENGFRRLDVATVRDHLSNI 218
LKE FEGQMT +NIE+GI +E GFRRL A V+D+L+ I
Sbjct: 195 LKESFEGQMTEDNIEVGICNEAGFRRLSPAEVKDYLAAI 233
|
|
| ZFIN|ZDB-GENE-050522-479 psma2 "proteasome (prosome, macropain) subunit, alpha type, 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O73672 psma2 "Proteasome subunit alpha type-2" [Carassius auratus (taxid:7957)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P24495 psma2 "Proteasome subunit alpha type-2" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0086134 Prosalpha2 "Proteasome alpha2 subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104885 Psma2 "proteasome (prosome, macropain) subunit, alpha type 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61842 Psma2 "proteasome (prosome, macropain) subunit, alpha type 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0Y5 PSMA2 "Proteasome subunit alpha type-2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P25787 PSMA2 "Proteasome subunit alpha type-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LAB6 LOC100620420 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 352 | |||
| cd03750 | 227 | cd03750, proteasome_alpha_type_2, proteasome_alpha | 1e-141 | |
| cd01911 | 209 | cd01911, proteasome_alpha, proteasome alpha subuni | 1e-103 | |
| PRK03996 | 241 | PRK03996, PRK03996, proteasome subunit alpha; Prov | 4e-74 | |
| TIGR03633 | 224 | TIGR03633, arc_protsome_A, proteasome endopeptidas | 1e-70 | |
| cd03756 | 211 | cd03756, proteasome_alpha_archeal, proteasome_alph | 1e-69 | |
| COG0638 | 236 | COG0638, PRE1, 20S proteasome, alpha and beta subu | 2e-64 | |
| pfam00227 | 188 | pfam00227, Proteasome, Proteasome subunit | 8e-61 | |
| cd03755 | 207 | cd03755, proteasome_alpha_type_7, proteasome_alpha | 2e-57 | |
| cd03752 | 213 | cd03752, proteasome_alpha_type_4, proteasome_alpha | 5e-57 | |
| cd01906 | 182 | cd01906, proteasome_protease_HslV, proteasome_prot | 1e-55 | |
| cd03750 | 227 | cd03750, proteasome_alpha_type_2, proteasome_alpha | 1e-47 | |
| cd03749 | 211 | cd03749, proteasome_alpha_type_1, proteasome_alpha | 9e-47 | |
| cd03751 | 212 | cd03751, proteasome_alpha_type_3, proteasome_alpha | 3e-46 | |
| cd03754 | 215 | cd03754, proteasome_alpha_type_6, proteasome_alpha | 5e-45 | |
| cd03753 | 213 | cd03753, proteasome_alpha_type_5, proteasome_alpha | 1e-44 | |
| PTZ00246 | 253 | PTZ00246, PTZ00246, proteasome subunit alpha; Prov | 2e-44 | |
| cd01911 | 209 | cd01911, proteasome_alpha, proteasome alpha subuni | 1e-37 | |
| cd01901 | 164 | cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term | 3e-36 | |
| cd03752 | 213 | cd03752, proteasome_alpha_type_4, proteasome_alpha | 2e-25 | |
| PRK03996 | 241 | PRK03996, PRK03996, proteasome subunit alpha; Prov | 5e-24 | |
| cd03756 | 211 | cd03756, proteasome_alpha_archeal, proteasome_alph | 6e-24 | |
| cd03755 | 207 | cd03755, proteasome_alpha_type_7, proteasome_alpha | 1e-23 | |
| TIGR03633 | 224 | TIGR03633, arc_protsome_A, proteasome endopeptidas | 6e-23 | |
| cd03764 | 188 | cd03764, proteasome_beta_archeal, Archeal proteaso | 3e-22 | |
| pfam00227 | 188 | pfam00227, Proteasome, Proteasome subunit | 8e-22 | |
| cd01906 | 182 | cd01906, proteasome_protease_HslV, proteasome_prot | 3e-21 | |
| cd01912 | 189 | cd01912, proteasome_beta, proteasome beta subunit | 4e-20 | |
| TIGR03634 | 185 | TIGR03634, arc_protsome_B, proteasome endopeptidas | 9e-20 | |
| COG0638 | 236 | COG0638, PRE1, 20S proteasome, alpha and beta subu | 1e-19 | |
| PTZ00246 | 253 | PTZ00246, PTZ00246, proteasome subunit alpha; Prov | 1e-18 | |
| cd03749 | 211 | cd03749, proteasome_alpha_type_1, proteasome_alpha | 5e-18 | |
| cd03751 | 212 | cd03751, proteasome_alpha_type_3, proteasome_alpha | 8e-18 | |
| cd03754 | 215 | cd03754, proteasome_alpha_type_6, proteasome_alpha | 2e-16 | |
| cd01901 | 164 | cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term | 7e-14 | |
| cd03753 | 213 | cd03753, proteasome_alpha_type_5, proteasome_alpha | 8e-09 | |
| cd03763 | 189 | cd03763, proteasome_beta_type_7, proteasome beta t | 2e-06 | |
| cd03758 | 193 | cd03758, proteasome_beta_type_2, proteasome beta t | 2e-04 | |
| cd01912 | 189 | cd01912, proteasome_beta, proteasome beta subunit | 3e-04 | |
| cd03757 | 212 | cd03757, proteasome_beta_type_1, proteasome beta t | 7e-04 | |
| cd03761 | 188 | cd03761, proteasome_beta_type_5, proteasome beta t | 7e-04 | |
| PTZ00488 | 247 | PTZ00488, PTZ00488, Proteasome subunit beta type-5 | 0.002 |
| >gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 | Back alignment and domain information |
|---|
Score = 399 bits (1028), Expect = e-141
Identities = 160/218 (73%), Positives = 186/218 (85%), Gaps = 2/218 (0%)
Query: 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILFEDC-IHKVEPITDYIGM 59
PSGKLVQIEYALAAV +GAPSVGIKA+NG+VLATEKK + L ++ +HKVE IT +IGM
Sbjct: 10 PSGKLVQIEYALAAVSSGAPSVGIKAANGVVLATEKKVPSPLIDESSVHKVEQITPHIGM 69
Query: 60 VYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSL 119
VYSGMGPD+R+LVKKARKIAQQY LVY E IP QLV+ +A++MQEYTQSGGVRPFGVSL
Sbjct: 70 VYSGMGPDFRVLVKKARKIAQQYYLVYGEPIPVSQLVREIASVMQEYTQSGGVRPFGVSL 129
Query: 120 LICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFLEKRYSEDLELDDAVHTAILT 179
LI GWD PYLYQ DPSG+YF WKATA+G+NY N KTFLEKRY+EDLEL+DA+HTAILT
Sbjct: 130 LIAGWDEGGPYLYQVDPSGSYFTWKATAIGKNYSNAKTFLEKRYNEDLELEDAIHTAILT 189
Query: 180 LKEGFEGQMTAENIEIGIA-DENGFRRLDVATVRDHLS 216
LKEGFEGQMT +NIEIGI + GFR L A ++D+L+
Sbjct: 190 LKEGFEGQMTEKNIEIGICGETKGFRLLTPAEIKDYLA 227
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 227 |
| >gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV | Back alignment and domain information |
|---|
| >gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 | Back alignment and domain information |
|---|
| >gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV | Back alignment and domain information |
|---|
| >gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >gnl|CDD|239732 cd03763, proteasome_beta_type_7, proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239730 cd03761, proteasome_beta_type_5, proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185666 PTZ00488, PTZ00488, Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| cd03750 | 227 | proteasome_alpha_type_2 proteasome_alpha_type_2. T | 100.0 | |
| KOG0176|consensus | 241 | 100.0 | ||
| PTZ00246 | 253 | proteasome subunit alpha; Provisional | 100.0 | |
| PRK03996 | 241 | proteasome subunit alpha; Provisional | 100.0 | |
| TIGR03633 | 224 | arc_protsome_A proteasome endopeptidase complex, a | 100.0 | |
| cd03751 | 212 | proteasome_alpha_type_3 proteasome_alpha_type_3. T | 100.0 | |
| COG0638 | 236 | PRE1 20S proteasome, alpha and beta subunits [Post | 100.0 | |
| cd03752 | 213 | proteasome_alpha_type_4 proteasome_alpha_type_4. T | 100.0 | |
| cd03755 | 207 | proteasome_alpha_type_7 proteasome_alpha_type_7. T | 100.0 | |
| cd03749 | 211 | proteasome_alpha_type_1 proteasome_alpha_type_1. T | 100.0 | |
| cd03756 | 211 | proteasome_alpha_archeal proteasome_alpha_archeal. | 100.0 | |
| KOG0178|consensus | 249 | 100.0 | ||
| cd03754 | 215 | proteasome_alpha_type_6 proteasome_alpha_type_6. T | 100.0 | |
| KOG0183|consensus | 249 | 100.0 | ||
| KOG0184|consensus | 254 | 100.0 | ||
| cd03753 | 213 | proteasome_alpha_type_5 proteasome_alpha_type_5. T | 100.0 | |
| cd01911 | 209 | proteasome_alpha proteasome alpha subunit. The 20S | 100.0 | |
| KOG0181|consensus | 233 | 100.0 | ||
| KOG0182|consensus | 246 | 100.0 | ||
| PTZ00488 | 247 | Proteasome subunit beta type-5; Provisional | 100.0 | |
| TIGR03690 | 219 | 20S_bact_beta proteasome, beta subunit, bacterial | 100.0 | |
| TIGR03691 | 228 | 20S_bact_alpha proteasome, alpha subunit, bacteria | 100.0 | |
| cd03761 | 188 | proteasome_beta_type_5 proteasome beta type-5 subu | 100.0 | |
| cd03758 | 193 | proteasome_beta_type_2 proteasome beta type-2 subu | 100.0 | |
| KOG0863|consensus | 264 | 100.0 | ||
| cd03759 | 195 | proteasome_beta_type_3 proteasome beta type-3 subu | 100.0 | |
| cd03760 | 197 | proteasome_beta_type_4 proteasome beta type-4 subu | 100.0 | |
| TIGR03634 | 185 | arc_protsome_B proteasome endopeptidase complex, a | 100.0 | |
| cd03757 | 212 | proteasome_beta_type_1 proteasome beta type-1 subu | 100.0 | |
| cd03764 | 188 | proteasome_beta_archeal Archeal proteasome, beta s | 100.0 | |
| cd03765 | 236 | proteasome_beta_bacterial Bacterial proteasome, be | 100.0 | |
| cd03763 | 189 | proteasome_beta_type_7 proteasome beta type-7 subu | 100.0 | |
| cd03762 | 188 | proteasome_beta_type_6 proteasome beta type-6 subu | 100.0 | |
| cd01912 | 189 | proteasome_beta proteasome beta subunit. The 20S p | 100.0 | |
| PF00227 | 190 | Proteasome: Proteasome subunit; InterPro: IPR00135 | 100.0 | |
| cd01906 | 182 | proteasome_protease_HslV proteasome_protease_HslV. | 100.0 | |
| KOG0177|consensus | 200 | 100.0 | ||
| KOG0174|consensus | 224 | 100.0 | ||
| KOG0175|consensus | 285 | 100.0 | ||
| KOG0173|consensus | 271 | 100.0 | ||
| KOG0179|consensus | 235 | 100.0 | ||
| KOG0185|consensus | 256 | 100.0 | ||
| KOG0181|consensus | 233 | 99.97 | ||
| PRK05456 | 172 | ATP-dependent protease subunit HslV; Provisional | 99.97 | |
| KOG0180|consensus | 204 | 99.97 | ||
| KOG0183|consensus | 249 | 99.97 | ||
| cd01913 | 171 | protease_HslV Protease HslV and the ATPase/chapero | 99.96 | |
| cd01901 | 164 | Ntn_hydrolase The Ntn hydrolases (N-terminal nucle | 99.96 | |
| TIGR03692 | 171 | ATP_dep_HslV ATP-dependent protease HslVU, peptida | 99.96 | |
| KOG0178|consensus | 249 | 99.96 | ||
| KOG0176|consensus | 241 | 99.96 | ||
| cd03751 | 212 | proteasome_alpha_type_3 proteasome_alpha_type_3. T | 99.95 | |
| COG0638 | 236 | PRE1 20S proteasome, alpha and beta subunits [Post | 99.95 | |
| cd03749 | 211 | proteasome_alpha_type_1 proteasome_alpha_type_1. T | 99.95 | |
| cd03752 | 213 | proteasome_alpha_type_4 proteasome_alpha_type_4. T | 99.94 | |
| cd03755 | 207 | proteasome_alpha_type_7 proteasome_alpha_type_7. T | 99.94 | |
| KOG0863|consensus | 264 | 99.94 | ||
| cd03750 | 227 | proteasome_alpha_type_2 proteasome_alpha_type_2. T | 99.94 | |
| cd03754 | 215 | proteasome_alpha_type_6 proteasome_alpha_type_6. T | 99.94 | |
| KOG0182|consensus | 246 | 99.93 | ||
| PTZ00246 | 253 | proteasome subunit alpha; Provisional | 99.93 | |
| KOG0184|consensus | 254 | 99.93 | ||
| cd03758 | 193 | proteasome_beta_type_2 proteasome beta type-2 subu | 99.93 | |
| cd03756 | 211 | proteasome_alpha_archeal proteasome_alpha_archeal. | 99.92 | |
| PRK03996 | 241 | proteasome subunit alpha; Provisional | 99.92 | |
| cd03761 | 188 | proteasome_beta_type_5 proteasome beta type-5 subu | 99.92 | |
| cd03753 | 213 | proteasome_alpha_type_5 proteasome_alpha_type_5. T | 99.92 | |
| TIGR03633 | 224 | arc_protsome_A proteasome endopeptidase complex, a | 99.92 | |
| cd03765 | 236 | proteasome_beta_bacterial Bacterial proteasome, be | 99.91 | |
| cd03760 | 197 | proteasome_beta_type_4 proteasome beta type-4 subu | 99.91 | |
| TIGR03690 | 219 | 20S_bact_beta proteasome, beta subunit, bacterial | 99.91 | |
| TIGR03691 | 228 | 20S_bact_alpha proteasome, alpha subunit, bacteria | 99.91 | |
| TIGR03634 | 185 | arc_protsome_B proteasome endopeptidase complex, a | 99.9 | |
| cd01911 | 209 | proteasome_alpha proteasome alpha subunit. The 20S | 99.9 | |
| KOG0175|consensus | 285 | 99.9 | ||
| cd03764 | 188 | proteasome_beta_archeal Archeal proteasome, beta s | 99.9 | |
| cd03759 | 195 | proteasome_beta_type_3 proteasome beta type-3 subu | 99.9 | |
| cd03763 | 189 | proteasome_beta_type_7 proteasome beta type-7 subu | 99.89 | |
| PTZ00488 | 247 | Proteasome subunit beta type-5; Provisional | 99.89 | |
| cd03762 | 188 | proteasome_beta_type_6 proteasome beta type-6 subu | 99.89 | |
| cd01906 | 182 | proteasome_protease_HslV proteasome_protease_HslV. | 99.88 | |
| PF00227 | 190 | Proteasome: Proteasome subunit; InterPro: IPR00135 | 99.87 | |
| cd03757 | 212 | proteasome_beta_type_1 proteasome beta type-1 subu | 99.87 | |
| cd01912 | 189 | proteasome_beta proteasome beta subunit. The 20S p | 99.87 | |
| KOG0173|consensus | 271 | 99.74 | ||
| cd01901 | 164 | Ntn_hydrolase The Ntn hydrolases (N-terminal nucle | 99.74 | |
| KOG0179|consensus | 235 | 99.63 | ||
| COG3484 | 255 | Predicted proteasome-type protease [Posttranslatio | 99.47 | |
| PRK05456 | 172 | ATP-dependent protease subunit HslV; Provisional | 99.46 | |
| cd01913 | 171 | protease_HslV Protease HslV and the ATPase/chapero | 99.45 | |
| KOG0174|consensus | 224 | 99.43 | ||
| TIGR03692 | 171 | ATP_dep_HslV ATP-dependent protease HslVU, peptida | 99.35 | |
| COG5405 | 178 | HslV ATP-dependent protease HslVU (ClpYQ), peptida | 99.35 | |
| KOG0177|consensus | 200 | 99.27 | ||
| KOG0180|consensus | 204 | 99.14 | ||
| PF10584 | 23 | Proteasome_A_N: Proteasome subunit A N-terminal si | 98.53 | |
| KOG0185|consensus | 256 | 98.2 | ||
| PF09894 | 194 | DUF2121: Uncharacterized protein conserved in arch | 96.25 | |
| COG5405 | 178 | HslV ATP-dependent protease HslVU (ClpYQ), peptida | 95.25 | |
| COG4079 | 293 | Uncharacterized protein conserved in archaea [Func | 92.46 | |
| COG3484 | 255 | Predicted proteasome-type protease [Posttranslatio | 91.61 |
| >cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-55 Score=396.43 Aligned_cols=215 Identities=75% Similarity=1.171 Sum_probs=209.2
Q ss_pred CCcceehhhhHHHHhcCCCcEEEEEeCCEEEEEEecCCCCCcC-ccccccEEEecCcEEEEEecChhhHHHHHHHHHHHH
Q psy2869 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILF-EDCIHKVEPITDYIGMVYSGMGPDYRLLVKKARKIA 79 (352)
Q Consensus 1 p~Grl~QveYa~~av~~G~tvIgi~~~dgVvlaad~~~~~~~~-~~~~~KI~~i~~~i~~~~sG~~~D~~~l~~~~~~~~ 79 (352)
|||||+|||||++|+++|+|+|||+++||||||+|++.++++. +++.+||++|++|++|+++|+.+|++.+.++++.++
T Consensus 10 p~Grl~QveyA~~av~~G~t~igik~~dgVvlaad~~~~~~l~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~ 89 (227)
T cd03750 10 PSGKLVQIEYALAAVSSGAPSVGIKAANGVVLATEKKVPSPLIDESSVHKVEQITPHIGMVYSGMGPDFRVLVKKARKIA 89 (227)
T ss_pred CCCeEhHHHHHHHHHHcCCCEEEEEeCCEEEEEEeecCCccccCCCCcceEEEEcCCEEEEEeEcHHhHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999997777 788999999999999999999999999999999999
Q ss_pred HHHHHHhCCCCCHHHHHHHHHHHHHHHhhcCCCccceEEEeEEEEeCCCCEEEEECCCCcEEecceEEecCCCchhHHHH
Q psy2869 80 QQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSLLICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFL 159 (352)
Q Consensus 80 ~~~~~~~~~~i~~~~la~~l~~~~~~~~~~~~~rP~~v~~ivaG~D~~gp~Ly~iDp~G~~~~~~~~a~G~gs~~~~~~L 159 (352)
+.|++.++++++++.++++|++++|.|+++++.|||+|++||+|||++||+||.+||+|++.+++++|+|+|+..++++|
T Consensus 90 ~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v~~li~G~D~~g~~Ly~~d~~G~~~~~~~~a~G~g~~~~~~~L 169 (227)
T cd03750 90 QQYYLVYGEPIPVSQLVREIASVMQEYTQSGGVRPFGVSLLIAGWDEGGPYLYQVDPSGSYFTWKATAIGKNYSNAKTFL 169 (227)
T ss_pred HHHHHHHCCCCCHHHHHHHHHHHHHHhcCCCCCCChheEEEEEEEeCCCCEEEEECCCCCEEeeeEEEECCCCHHHHHHH
Confidence 99999999999999999999999999999999999999999999998899999999999999999999999999999999
Q ss_pred HhhcCCCCCHHHHHHHHHHHHHHhhccCCCCCceEEEEEeCC-CeEEcChhHHHHHH
Q psy2869 160 EKRYSEDLELDDAVHTAILTLKEGFEGQMTAENIEIGIADEN-GFRRLDVATVRDHL 215 (352)
Q Consensus 160 e~~~~~~~s~~eai~l~~~~l~~~~~~d~~~~~iei~ii~~~-g~~~l~~~ei~~~l 215 (352)
|++|+++||++||++++++||+.+.++++++.+++|++|+++ |++.++++||++++
T Consensus 170 e~~~~~~ms~eeai~l~~~~l~~~~~~~l~~~~iev~iv~~~~~~~~~~~~ei~~~~ 226 (227)
T cd03750 170 EKRYNEDLELEDAIHTAILTLKEGFEGQMTEKNIEIGICGETKGFRLLTPAEIKDYL 226 (227)
T ss_pred HhhccCCCCHHHHHHHHHHHHHHHhcccCCCCcEEEEEEECCCCEEECCHHHHHHHh
Confidence 999999999999999999999999998899999999999985 79999999999876
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. |
| >KOG0176|consensus | Back alignment and domain information |
|---|
| >PTZ00246 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK03996 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >cd03756 proteasome_alpha_archeal proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >KOG0178|consensus | Back alignment and domain information |
|---|
| >cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >KOG0183|consensus | Back alignment and domain information |
|---|
| >KOG0184|consensus | Back alignment and domain information |
|---|
| >cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >cd01911 proteasome_alpha proteasome alpha subunit | Back alignment and domain information |
|---|
| >KOG0181|consensus | Back alignment and domain information |
|---|
| >KOG0182|consensus | Back alignment and domain information |
|---|
| >PTZ00488 Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
| >TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type | Back alignment and domain information |
|---|
| >cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >KOG0863|consensus | Back alignment and domain information |
|---|
| >cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit | Back alignment and domain information |
|---|
| >TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >cd01912 proteasome_beta proteasome beta subunit | Back alignment and domain information |
|---|
| >PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins | Back alignment and domain information |
|---|
| >cd01906 proteasome_protease_HslV proteasome_protease_HslV | Back alignment and domain information |
|---|
| >KOG0177|consensus | Back alignment and domain information |
|---|
| >KOG0174|consensus | Back alignment and domain information |
|---|
| >KOG0175|consensus | Back alignment and domain information |
|---|
| >KOG0173|consensus | Back alignment and domain information |
|---|
| >KOG0179|consensus | Back alignment and domain information |
|---|
| >KOG0185|consensus | Back alignment and domain information |
|---|
| >KOG0181|consensus | Back alignment and domain information |
|---|
| >PRK05456 ATP-dependent protease subunit HslV; Provisional | Back alignment and domain information |
|---|
| >KOG0180|consensus | Back alignment and domain information |
|---|
| >KOG0183|consensus | Back alignment and domain information |
|---|
| >cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome | Back alignment and domain information |
|---|
| >cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit | Back alignment and domain information |
|---|
| >KOG0178|consensus | Back alignment and domain information |
|---|
| >KOG0176|consensus | Back alignment and domain information |
|---|
| >cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >KOG0863|consensus | Back alignment and domain information |
|---|
| >cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 | Back alignment and domain information |
|---|
| >cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >KOG0182|consensus | Back alignment and domain information |
|---|
| >PTZ00246 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0184|consensus | Back alignment and domain information |
|---|
| >cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >cd03756 proteasome_alpha_archeal proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >PRK03996 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit | Back alignment and domain information |
|---|
| >TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
| >TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type | Back alignment and domain information |
|---|
| >TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >cd01911 proteasome_alpha proteasome alpha subunit | Back alignment and domain information |
|---|
| >KOG0175|consensus | Back alignment and domain information |
|---|
| >cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >PTZ00488 Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >cd01906 proteasome_protease_HslV proteasome_protease_HslV | Back alignment and domain information |
|---|
| >PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins | Back alignment and domain information |
|---|
| >cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >cd01912 proteasome_beta proteasome beta subunit | Back alignment and domain information |
|---|
| >KOG0173|consensus | Back alignment and domain information |
|---|
| >cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >KOG0179|consensus | Back alignment and domain information |
|---|
| >COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05456 ATP-dependent protease subunit HslV; Provisional | Back alignment and domain information |
|---|
| >cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome | Back alignment and domain information |
|---|
| >KOG0174|consensus | Back alignment and domain information |
|---|
| >TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit | Back alignment and domain information |
|---|
| >COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0177|consensus | Back alignment and domain information |
|---|
| >KOG0180|consensus | Back alignment and domain information |
|---|
| >PF10584 Proteasome_A_N: Proteasome subunit A N-terminal signature; InterPro: IPR000426 The proteasome (or macropain) (3 | Back alignment and domain information |
|---|
| >KOG0185|consensus | Back alignment and domain information |
|---|
| >PF09894 DUF2121: Uncharacterized protein conserved in archaea (DUF2121); InterPro: IPR016754 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4079 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 352 | ||||
| 3unb_A | 234 | Mouse Constitutive 20s Proteasome In Complex With P | 1e-102 | ||
| 3unb_A | 234 | Mouse Constitutive 20s Proteasome In Complex With P | 9e-36 | ||
| 1iru_B | 233 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-101 | ||
| 1iru_B | 233 | Crystal Structure Of The Mammalian 20s Proteasome A | 8e-36 | ||
| 1ryp_B | 250 | Crystal Structure Of The 20s Proteasome From Yeast | 4e-62 | ||
| 1ryp_B | 250 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-22 | ||
| 1vsy_B | 231 | Proteasome Activator Complex Length = 231 | 3e-59 | ||
| 1vsy_B | 231 | Proteasome Activator Complex Length = 231 | 4e-22 | ||
| 1j2q_A | 237 | 20s Proteasome In Complex With Calpain-inhibitor I | 5e-40 | ||
| 1j2q_A | 237 | 20s Proteasome In Complex With Calpain-inhibitor I | 4e-14 | ||
| 1j2p_A | 246 | Alpha-Ring From The Proteasome From Archaeoglobus F | 8e-39 | ||
| 1j2p_A | 246 | Alpha-Ring From The Proteasome From Archaeoglobus F | 2e-13 | ||
| 2ku2_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 8e-38 | ||
| 2ku2_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 1e-14 | ||
| 1pma_A | 233 | Proteasome From Thermoplasma Acidophilum Length = 2 | 8e-38 | ||
| 1pma_A | 233 | Proteasome From Thermoplasma Acidophilum Length = 2 | 1e-14 | ||
| 2ku1_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 8e-38 | ||
| 2ku1_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 1e-14 | ||
| 1yar_A | 233 | Structure Of Archeabacterial 20s Proteasome Mutant | 8e-38 | ||
| 1yar_A | 233 | Structure Of Archeabacterial 20s Proteasome Mutant | 1e-14 | ||
| 3jrm_A | 227 | Crystal Structure Of Archaeal 20s Proteasome In Com | 8e-38 | ||
| 3jrm_A | 227 | Crystal Structure Of Archaeal 20s Proteasome In Com | 1e-14 | ||
| 1yau_A | 233 | Structure Of Archeabacterial 20s Proteasome- Pa26 C | 9e-38 | ||
| 1yau_A | 233 | Structure Of Archeabacterial 20s Proteasome- Pa26 C | 1e-14 | ||
| 1g0u_B | 245 | A Gated Channel Into The Proteasome Core Particle L | 1e-37 | ||
| 1g0u_B | 245 | A Gated Channel Into The Proteasome Core Particle L | 9e-15 | ||
| 1ryp_C | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-37 | ||
| 1ryp_C | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-14 | ||
| 3oeu_B | 235 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 1e-37 | ||
| 3oeu_B | 235 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 1e-14 | ||
| 1vsy_C | 232 | Proteasome Activator Complex Length = 232 | 1e-37 | ||
| 1vsy_C | 232 | Proteasome Activator Complex Length = 232 | 1e-14 | ||
| 1z7q_C | 258 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-37 | ||
| 1z7q_C | 258 | Crystal Structure Of The 20s Proteasome From Yeast | 9e-15 | ||
| 3h4p_A | 264 | Proteasome 20s Core Particle From Methanocaldococcu | 2e-36 | ||
| 3h4p_A | 264 | Proteasome 20s Core Particle From Methanocaldococcu | 9e-14 | ||
| 1fnt_D | 254 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-35 | ||
| 1fnt_D | 254 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-15 | ||
| 1ryp_D | 241 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-35 | ||
| 1ryp_D | 241 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-15 | ||
| 1g0u_C | 243 | A Gated Channel Into The Proteasome Core Particle L | 6e-35 | ||
| 1g0u_C | 243 | A Gated Channel Into The Proteasome Core Particle L | 1e-15 | ||
| 3une_C | 248 | Mouse Constitutive 20s Proteasome Length = 248 | 3e-34 | ||
| 3une_C | 248 | Mouse Constitutive 20s Proteasome Length = 248 | 6e-15 | ||
| 1iru_D | 248 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-33 | ||
| 1iru_D | 248 | Crystal Structure Of The Mammalian 20s Proteasome A | 6e-15 | ||
| 1iru_C | 261 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-33 | ||
| 1iru_C | 261 | Crystal Structure Of The Mammalian 20s Proteasome A | 7e-15 | ||
| 1vsy_D | 227 | Proteasome Activator Complex Length = 227 | 2e-33 | ||
| 1vsy_D | 227 | Proteasome Activator Complex Length = 227 | 1e-15 | ||
| 3unb_C | 248 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-33 | ||
| 3unb_C | 248 | Mouse Constitutive 20s Proteasome In Complex With P | 7e-15 | ||
| 3unb_B | 261 | Mouse Constitutive 20s Proteasome In Complex With P | 7e-33 | ||
| 3unb_B | 261 | Mouse Constitutive 20s Proteasome In Complex With P | 7e-15 | ||
| 3unb_D | 241 | Mouse Constitutive 20s Proteasome In Complex With P | 6e-29 | ||
| 3unb_D | 241 | Mouse Constitutive 20s Proteasome In Complex With P | 5e-05 | ||
| 3unb_G | 246 | Mouse Constitutive 20s Proteasome In Complex With P | 7e-29 | ||
| 3unb_G | 246 | Mouse Constitutive 20s Proteasome In Complex With P | 4e-12 | ||
| 1iru_A | 246 | Crystal Structure Of The Mammalian 20s Proteasome A | 9e-29 | ||
| 1iru_A | 246 | Crystal Structure Of The Mammalian 20s Proteasome A | 4e-12 | ||
| 1iru_E | 241 | Crystal Structure Of The Mammalian 20s Proteasome A | 3e-28 | ||
| 1iru_E | 241 | Crystal Structure Of The Mammalian 20s Proteasome A | 5e-05 | ||
| 3unb_E | 263 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-27 | ||
| 3unb_E | 263 | Mouse Constitutive 20s Proteasome In Complex With P | 1e-09 | ||
| 1z7q_G | 288 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-27 | ||
| 1z7q_G | 288 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-08 | ||
| 1fnt_G | 287 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-27 | ||
| 1fnt_G | 287 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-08 | ||
| 1g0u_F | 248 | A Gated Channel Into The Proteasome Core Particle L | 3e-27 | ||
| 1g0u_F | 248 | A Gated Channel Into The Proteasome Core Particle L | 2e-08 | ||
| 3oeu_F | 242 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 4e-27 | ||
| 3oeu_F | 242 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 2e-08 | ||
| 1ryp_G | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 4e-27 | ||
| 1ryp_G | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-08 | ||
| 1iru_F | 263 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-26 | ||
| 1iru_F | 263 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-09 | ||
| 1g0u_D | 241 | A Gated Channel Into The Proteasome Core Particle L | 2e-26 | ||
| 1g0u_D | 241 | A Gated Channel Into The Proteasome Core Particle L | 5e-05 | ||
| 1ryp_E | 242 | Crystal Structure Of The 20s Proteasome From Yeast | 6e-26 | ||
| 1ryp_E | 242 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-04 | ||
| 1vsy_E | 250 | Proteasome Activator Complex Length = 250 | 6e-26 | ||
| 1vsy_E | 250 | Proteasome Activator Complex Length = 250 | 1e-04 | ||
| 4g4s_E | 261 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 6e-26 | ||
| 4g4s_E | 261 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 1e-04 | ||
| 1fnt_E | 260 | Crystal Structure Of The 20s Proteasome From Yeast | 6e-26 | ||
| 1fnt_E | 260 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-04 | ||
| 2z5c_C | 262 | Crystal Structure Of A Novel Chaperone Complex For | 7e-26 | ||
| 2z5c_C | 262 | Crystal Structure Of A Novel Chaperone Complex For | 1e-04 | ||
| 3unb_F | 255 | Mouse Constitutive 20s Proteasome In Complex With P | 6e-22 | ||
| 3unb_F | 255 | Mouse Constitutive 20s Proteasome In Complex With P | 1e-07 | ||
| 1iru_G | 254 | Crystal Structure Of The Mammalian 20s Proteasome A | 7e-22 | ||
| 1iru_G | 254 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-07 | ||
| 1g0u_E | 234 | A Gated Channel Into The Proteasome Core Particle L | 1e-19 | ||
| 1g0u_E | 234 | A Gated Channel Into The Proteasome Core Particle L | 2e-06 | ||
| 3sdi_E | 233 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 1e-19 | ||
| 3sdi_E | 233 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 2e-06 | ||
| 1ryp_F | 233 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-19 | ||
| 1ryp_F | 233 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-06 | ||
| 1fnt_F | 234 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-19 | ||
| 1fnt_F | 234 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-06 | ||
| 4g4s_F | 235 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 3e-19 | ||
| 4g4s_F | 235 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 5e-06 | ||
| 1g0u_G | 252 | A Gated Channel Into The Proteasome Core Particle L | 5e-18 | ||
| 1g0u_G | 252 | A Gated Channel Into The Proteasome Core Particle L | 1e-06 | ||
| 1ryp_A | 243 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-18 | ||
| 1ryp_A | 243 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-06 | ||
| 1ya7_H | 217 | Implications For Interactions Of Proteasome With Pa | 7e-11 | ||
| 1pma_B | 211 | Proteasome From Thermoplasma Acidophilum Length = 2 | 7e-11 | ||
| 3c91_H | 203 | Thermoplasma Acidophilum 20s Proteasome With An Ope | 2e-09 | ||
| 1j2q_H | 202 | 20s Proteasome In Complex With Calpain-inhibitor I | 2e-08 | ||
| 3h4p_a | 219 | Proteasome 20s Core Particle From Methanocaldococcu | 1e-07 | ||
| 3unb_K | 205 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-06 | ||
| 1iru_L | 204 | Crystal Structure Of The Mammalian 20s Proteasome A | 4e-06 | ||
| 3unf_K | 204 | Mouse 20s Immunoproteasome In Complex With Pr-957 L | 2e-05 | ||
| 1ryp_K | 198 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-05 |
| >pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
|
| >pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
| >pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 | Back alignment and structure |
| >pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 | Back alignment and structure |
| >pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 | Back alignment and structure |
| >pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 | Back alignment and structure |
| >pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 | Back alignment and structure |
| >pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 | Back alignment and structure |
| >pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 | Back alignment and structure |
| >pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 | Back alignment and structure |
| >pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 | Back alignment and structure |
| >pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 | Back alignment and structure |
| >pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 | Back alignment and structure |
| >pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 | Back alignment and structure |
| >pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 | Back alignment and structure |
| >pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 | Back alignment and structure |
| >pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 | Back alignment and structure |
| >pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 | Back alignment and structure |
| >pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 | Back alignment and structure |
| >pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 | Back alignment and structure |
| >pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 | Back alignment and structure |
| >pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 | Back alignment and structure |
| >pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 | Back alignment and structure |
| >pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 | Back alignment and structure |
| >pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 | Back alignment and structure |
| >pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 | Back alignment and structure |
| >pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 | Back alignment and structure |
| >pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 | Back alignment and structure |
| >pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 | Back alignment and structure |
| >pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 | Back alignment and structure |
| >pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 | Back alignment and structure |
| >pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 | Back alignment and structure |
| >pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 | Back alignment and structure |
| >pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 | Back alignment and structure |
| >pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 | Back alignment and structure |
| >pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 | Back alignment and structure |
| >pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 | Back alignment and structure |
| >pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 | Back alignment and structure |
| >pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 | Back alignment and structure |
| >pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 | Back alignment and structure |
| >pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 | Back alignment and structure |
| >pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 | Back alignment and structure |
| >pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 | Back alignment and structure |
| >pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 | Back alignment and structure |
| >pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 | Back alignment and structure |
| >pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 | Back alignment and structure |
| >pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 | Back alignment and structure |
| >pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 | Back alignment and structure |
| >pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 | Back alignment and structure |
| >pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 | Back alignment and structure |
| >pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 | Back alignment and structure |
| >pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 | Back alignment and structure |
| >pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 | Back alignment and structure |
| >pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 | Back alignment and structure |
| >pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 | Back alignment and structure |
| >pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 | Back alignment and structure |
| >pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 | Back alignment and structure |
| >pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 | Back alignment and structure |
| >pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 | Back alignment and structure |
| >pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 | Back alignment and structure |
| >pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 | Back alignment and structure |
| >pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 | Back alignment and structure |
| >pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 | Back alignment and structure |
| >pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 | Back alignment and structure |
| >pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 | Back alignment and structure |
| >pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 | Back alignment and structure |
| >pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 | Back alignment and structure |
| >pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 | Back alignment and structure |
| >pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 | Back alignment and structure |
| >pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 | Back alignment and structure |
| >pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 | Back alignment and structure |
| >pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 | Back alignment and structure |
| >pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 | Back alignment and structure |
| >pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 | Back alignment and structure |
| >pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 | Back alignment and structure |
| >pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 | Back alignment and structure |
| >pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 | Back alignment and structure |
| >pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 | Back alignment and structure |
| >pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 | Back alignment and structure |
| >pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 | Back alignment and structure |
| >pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 | Back alignment and structure |
| >pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 | Back alignment and structure |
| >pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 | Back alignment and structure |
| >pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 | Back alignment and structure |
| >pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 | Back alignment and structure |
| >pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 | Back alignment and structure |
| >pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 | Back alignment and structure |
| >pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 | Back alignment and structure |
| >pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 | Back alignment and structure |
| >pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 | Back alignment and structure |
| >pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 | Back alignment and structure |
| >pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 | Back alignment and structure |
| >pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 | Back alignment and structure |
| >pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 | Back alignment and structure |
| >pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 | Back alignment and structure |
| >pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 | Back alignment and structure |
| >pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 | Back alignment and structure |
| >pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 202 | Back alignment and structure |
| >pdb|3H4P|AA Chain a, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 219 | Back alignment and structure |
| >pdb|3UNB|K Chain K, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 205 | Back alignment and structure |
| >pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 204 | Back alignment and structure |
| >pdb|3UNF|K Chain K, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 204 | Back alignment and structure |
| >pdb|1RYP|K Chain K, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 198 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 352 | |||
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 1e-105 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 7e-36 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 1e-101 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 6e-34 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 4e-99 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 2e-36 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 5e-98 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 2e-34 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 2e-97 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 2e-34 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 1e-96 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 6e-36 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 4e-96 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 5e-34 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 5e-96 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 2e-33 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 1e-95 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 5e-31 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 9e-95 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 5e-36 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 2e-94 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 1e-33 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 4e-94 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 7e-35 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 6e-94 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 3e-34 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 2e-92 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 3e-34 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 3e-91 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 2e-33 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 4e-91 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 4e-33 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 1e-88 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 5e-35 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 4e-87 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 1e-34 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 1e-58 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 9e-15 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 4e-53 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 2e-12 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 2e-41 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 2e-13 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 6e-37 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 2e-10 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 6e-35 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 3e-10 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 3e-34 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 8e-09 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 5e-33 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 4e-09 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 1e-25 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 7e-04 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 2e-25 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 1e-06 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 4e-25 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 5e-25 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 1e-05 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 7e-25 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 4e-06 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 2e-24 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 2e-05 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 1e-23 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 1e-04 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 8e-23 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 5e-04 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 1e-22 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 2e-04 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 3e-21 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 4e-04 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 5e-19 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 9e-04 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 1e-17 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 3e-17 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 3e-17 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 2e-05 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 1e-16 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 2e-15 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 2e-04 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 3e-15 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 9e-15 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 2e-14 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 8e-04 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 2e-14 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 |
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 | Back alignment and structure |
|---|
Score = 306 bits (786), Expect = e-105
Identities = 172/219 (78%), Positives = 197/219 (89%), Gaps = 1/219 (0%)
Query: 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILFE-DCIHKVEPITDYIGM 59
PSGKLVQIEYALAAV GAPSVGIKA+NG+VLATEKKQK+IL++ +HKVEPIT +IG+
Sbjct: 14 PSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGL 73
Query: 60 VYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSL 119
VYSGMGPDYR+LV +ARK+AQQY LVYQE IPT QLVQRVA++MQEYTQSGGVRPFGVSL
Sbjct: 74 VYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSL 133
Query: 120 LICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFLEKRYSEDLELDDAVHTAILT 179
LICGW+ RPYL+Q DPSGAYFAWKATAMG+NYVNGKTFLEKRY+EDLEL+DA+HTAILT
Sbjct: 134 LICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILT 193
Query: 180 LKEGFEGQMTAENIEIGIADENGFRRLDVATVRDHLSNI 218
LKE FEGQMT +NIE+GI +E GFRRL V+D+L+ I
Sbjct: 194 LKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 232
|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 | Back alignment and structure |
|---|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 | Back alignment and structure |
|---|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 100.0 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 100.0 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 100.0 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 100.0 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 100.0 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 100.0 | |
| 3h4p_a | 219 | Proteasome subunit beta; core particle, cytoplasm, | 100.0 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 100.0 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 100.0 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 100.0 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 100.0 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 100.0 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 100.0 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 100.0 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 100.0 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 100.0 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 100.0 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 100.0 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 99.93 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 99.93 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 99.93 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 99.93 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 99.93 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 99.93 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 99.93 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 99.93 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 99.93 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 99.93 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 99.92 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 99.92 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 99.92 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 99.92 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 99.92 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 99.92 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 99.92 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 99.92 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 99.91 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 99.91 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 99.91 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 99.91 | |
| 3h4p_a | 219 | Proteasome subunit beta; core particle, cytoplasm, | 99.91 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 99.91 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 99.91 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 99.9 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 99.9 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 99.9 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 99.9 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 99.9 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 99.89 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 99.89 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 99.89 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 99.89 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 99.89 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 99.89 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 99.88 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 99.88 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 99.88 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 99.88 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 99.88 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 99.88 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 99.88 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 99.87 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 99.85 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 99.76 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 99.74 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 99.73 |
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=7.7e-56 Score=403.99 Aligned_cols=219 Identities=29% Similarity=0.483 Sum_probs=213.2
Q ss_pred CCcceehhhhHHHHhcC-CCcEEEEEeCCEEEEEEecCCCCCcC-ccccccEEEecCcEEEEEecChhhHHHHHHHHHHH
Q psy2869 1 PSGKLVQIEYALAAVEA-GAPSVGIKASNGIVLATEKKQKTILF-EDCIHKVEPITDYIGMVYSGMGPDYRLLVKKARKI 78 (352)
Q Consensus 1 p~Grl~QveYa~~av~~-G~tvIgi~~~dgVvlaad~~~~~~~~-~~~~~KI~~i~~~i~~~~sG~~~D~~~l~~~~~~~ 78 (352)
|||||||||||+||+++ |+|+|||+++||||||+|+|.+.+++ +++.+|||+|++||+|+++|+.+|++.++++++.+
T Consensus 12 p~Grl~QvEYA~~av~~~Gtt~vgi~~~dgVvlaad~r~~~~l~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~r~~ 91 (243)
T 1ryp_A 12 PEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAE 91 (243)
T ss_dssp TTSCCHHHHHHHHHTTTTCCCEEEEECSSEEEEEEECCCCCTTBCGGGCCSEEECSSSCEEEEESCHHHHHHHHHHHHHH
T ss_pred CCCeeHHHHHHHHHHhcCCCcEEEEEeCCEEEEEEEecCCccccCCCcCCceEEECCCEEEEEEecHHHHHHHHHHHHHH
Confidence 99999999999999999 99999999999999999999997777 88999999999999999999999999999999999
Q ss_pred HHHHHHHhCCCCCHHHHHHHHHHHHHHHhhcCCCccceEEEeEEEEeC-CCCEEEEECCCCcEEecceEEecCCCchhHH
Q psy2869 79 AQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSLLICGWDN-KRPYLYQCDPSGAYFAWKATAMGRNYVNGKT 157 (352)
Q Consensus 79 ~~~~~~~~~~~i~~~~la~~l~~~~~~~~~~~~~rP~~v~~ivaG~D~-~gp~Ly~iDp~G~~~~~~~~a~G~gs~~~~~ 157 (352)
++.|+++++++++++.+++++++++|.|++++++|||+|++||||||+ +||+||.+||+|++.+++++++|+|++.+++
T Consensus 92 ~~~~~~~~~~~~~v~~la~~l~~~l~~y~~~~~~rP~~v~~lvaG~D~~~gp~Ly~~dp~G~~~~~~~~a~G~gs~~a~~ 171 (243)
T 1ryp_A 92 AAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITT 171 (243)
T ss_dssp HHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBTTSCCCSCEEEEEEEETTTEEEEEEECTTSCEEEBSEEEESTTHHHHHH
T ss_pred HHHHHHHHCCCCCHHHHHHHHHHHHHHHhccCCccccceEEEEEEEcCCCCcEEEEEcCCCCEEEEEEEEECCCcHHHHH
Confidence 999999999999999999999999999999999999999999999997 6999999999999999999999999999999
Q ss_pred HHHhhcCC-------CCCHHHHHHHHHHHHHHhhccCCCCCceEEEEEeCCCeEEcChhHHHHHHhhCc
Q psy2869 158 FLEKRYSE-------DLELDDAVHTAILTLKEGFEGQMTAENIEIGIADENGFRRLDVATVRDHLSNIP 219 (352)
Q Consensus 158 ~Le~~~~~-------~~s~~eai~l~~~~l~~~~~~d~~~~~iei~ii~~~g~~~l~~~ei~~~l~~i~ 219 (352)
+||+.|++ +||++||++++++||..+.++|.++++++|++|+++|+++++++|++++++++.
T Consensus 172 ~Le~~~~~~~~~~~~~ms~eea~~l~~~al~~~~~rd~s~~~iev~vi~~~g~~~l~~~ei~~~~~~~~ 240 (243)
T 1ryp_A 172 NLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIA 240 (243)
T ss_dssp HHHHHHHHHCSSSCCCSSHHHHHHHHHHHHHHHHTCCCCTTSEEEEEEETTEEEECCHHHHHHHHHHHT
T ss_pred HHHHHhhhcccccccCCCHHHHHHHHHHHHHHHhcccCCCCcEEEEEEECCCeEECCHHHHHHHHHHhh
Confidence 99999999 999999999999999999999988999999999999999999999999998874
|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D | Back alignment and structure |
|---|
| >3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... | Back alignment and structure |
|---|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K | Back alignment and structure |
|---|
| >3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 352 | ||||
| d1irue_ | 234 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 3e-60 | |
| d1irue_ | 234 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 3e-15 | |
| d1irua_ | 244 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 3e-60 | |
| d1irua_ | 244 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 2e-15 | |
| d1yara1 | 221 | d.153.1.4 (A:13-233) Proteasome alpha subunit (non | 4e-59 | |
| d1yara1 | 221 | d.153.1.4 (A:13-233) Proteasome alpha subunit (non | 2e-15 | |
| d1iruf_ | 238 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 5e-59 | |
| d1iruf_ | 238 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 7e-18 | |
| d1rypg_ | 244 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 1e-58 | |
| d1rypg_ | 244 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 2e-17 | |
| d1irug_ | 245 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 1e-58 | |
| d1irug_ | 245 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 1e-15 | |
| d1rypb_ | 250 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 4e-58 | |
| d1rypb_ | 250 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 3e-15 | |
| d1rypa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 5e-58 | |
| d1rypa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 6e-14 | |
| d1rypf_ | 233 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 5e-58 | |
| d1rypf_ | 233 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 1e-14 | |
| d1rypd_ | 241 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 1e-57 | |
| d1rypd_ | 241 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 4e-14 | |
| d1irub_ | 233 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 3e-57 | |
| d1irub_ | 233 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 3e-10 | |
| d1j2pa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 1e-56 | |
| d1j2pa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 5e-09 | |
| d1rype_ | 242 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 9e-55 | |
| d1rype_ | 242 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 2e-09 | |
| d1iruc_ | 250 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 2e-54 | |
| d1iruc_ | 250 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 2e-12 | |
| d1rypc_ | 244 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 1e-53 | |
| d1rypc_ | 244 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 6e-12 | |
| d1irud_ | 243 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 1e-53 | |
| d1irud_ | 243 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 4e-14 | |
| d1q5qa_ | 227 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 8e-51 | |
| d1q5qa_ | 227 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 9e-10 | |
| d1irul_ | 201 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 4e-33 | |
| d1irul_ | 201 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 6e-06 | |
| d1rypk_ | 198 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 7e-33 | |
| d1rypk_ | 198 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 3e-05 | |
| d1ryp1_ | 222 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 3e-32 | |
| d1ryp1_ | 222 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 5e-09 | |
| d1yarh1 | 203 | d.153.1.4 (H:1-203) Proteasome beta subunit (catal | 6e-31 | |
| d1yarh1 | 203 | d.153.1.4 (H:1-203) Proteasome beta subunit (catal | 1e-04 | |
| d1j2qh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 1e-30 | |
| d1j2qh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 1e-04 | |
| d1irui_ | 220 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 8e-30 | |
| d1irui_ | 220 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 2e-05 | |
| d1ryp2_ | 233 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 2e-29 | |
| d1ryp2_ | 233 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 7e-06 | |
| d1rypl_ | 212 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 4e-29 | |
| d1rypl_ | 212 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 7e-05 | |
| d1rypi_ | 222 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 7e-28 | |
| d1rypi_ | 222 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 8e-05 | |
| d1iruj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 6e-27 | |
| d1iruj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 2e-04 | |
| d1iruh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 2e-26 | |
| d1iruh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 1e-04 | |
| d1iru2_ | 217 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 4e-26 | |
| d1iru2_ | 217 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 5e-04 | |
| d1iruk_ | 199 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 2e-25 | |
| d1q5qh_ | 224 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 2e-24 | |
| d1rypj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 1e-22 | |
| d1ryph_ | 205 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 1e-22 | |
| d1iru1_ | 213 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 2e-18 | |
| d2z3ba1 | 180 | d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus | 4e-04 |
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome alpha subunit (non-catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Score = 191 bits (487), Expect = 3e-60
Identities = 67/225 (29%), Positives = 117/225 (52%), Gaps = 7/225 (3%)
Query: 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILFED-CIHKVEPITDYIGM 59
P G+L Q+EY + A++ G+ ++GI+ S G+ LA EK+ + L E I K+ I +IG
Sbjct: 10 PEGRLFQVEYDIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGC 69
Query: 60 VYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGG-----VRP 114
SG+ D + L+ KAR Q + Y E + + + Q V+ + ++ + RP
Sbjct: 70 AMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRP 129
Query: 115 FGVSLLICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFLEKRYSEDLELDDAVH 174
FGV+LL G D K P L+ DPSG + A A+G ++ L++ Y + + L +A+
Sbjct: 130 FGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQELYHKSMTLKEAIK 189
Query: 175 TAILTLKEGFEGQMTAENIEIGIADEN-GFRRLDVATVRDHLSNI 218
++++ LK+ E ++ A NIE+ F + + + +I
Sbjct: 190 SSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI 234
|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| d1yara1 | 221 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1iruc_ | 250 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1irue_ | 234 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypb_ | 250 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1j2pa_ | 243 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1irua_ | 244 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1irub_ | 233 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypc_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypa_ | 243 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypf_ | 233 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1iruf_ | 238 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1irug_ | 245 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rype_ | 242 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypg_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypd_ | 241 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irud_ | 243 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1irul_ | 201 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1q5qa_ | 227 | Proteasome alpha subunit (non-catalytic) {Rhodococ | 100.0 | |
| d1yarh1 | 203 | Proteasome beta subunit (catalytic) {Archaeon Ther | 100.0 | |
| d1j2qh_ | 202 | Proteasome beta subunit (catalytic) {Archaeon Arch | 100.0 | |
| d1rypk_ | 198 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1rypl_ | 212 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1ryph_ | 205 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruh_ | 202 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1irui_ | 220 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1ryp2_ | 233 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1rypi_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iru2_ | 217 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iruj_ | 204 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1q5qh_ | 224 | Proteasome beta subunit (catalytic) {Rhodococcus e | 100.0 | |
| d1rypj_ | 204 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1ryp1_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruk_ | 199 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iru1_ | 213 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1irug_ | 245 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.94 | |
| d1rypf_ | 233 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.93 | |
| d1irua_ | 244 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.93 | |
| d1irud_ | 243 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.93 | |
| d1iruf_ | 238 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.92 | |
| d1yara1 | 221 | Proteasome alpha subunit (non-catalytic) {Archaeon | 99.92 | |
| d1irue_ | 234 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.92 | |
| d1iruc_ | 250 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.92 | |
| d1rypg_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.92 | |
| d1j2pa_ | 243 | Proteasome alpha subunit (non-catalytic) {Archaeon | 99.91 | |
| d1rypb_ | 250 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.91 | |
| d2z3ba1 | 180 | HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 | 99.9 | |
| d1rypa_ | 243 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.9 | |
| d1rype_ | 242 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.9 | |
| d1rypc_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.89 | |
| d1rypd_ | 241 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.89 | |
| d1rypk_ | 198 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.88 | |
| d1m4ya_ | 171 | HslV (ClpQ) protease {Thermotoga maritima [TaxId: | 99.88 | |
| d1irul_ | 201 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.87 | |
| d1irub_ | 233 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.87 | |
| d1yarh1 | 203 | Proteasome beta subunit (catalytic) {Archaeon Ther | 99.86 | |
| d1q5qa_ | 227 | Proteasome alpha subunit (non-catalytic) {Rhodococ | 99.86 | |
| d1g3ka_ | 173 | HslV (ClpQ) protease {Haemophilus influenzae [TaxI | 99.86 | |
| d1j2qh_ | 202 | Proteasome beta subunit (catalytic) {Archaeon Arch | 99.85 | |
| d1irui_ | 220 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.84 | |
| d1rypi_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.84 | |
| d1rypl_ | 212 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.84 | |
| d1ryph_ | 205 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.83 | |
| d1iruh_ | 202 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.82 | |
| d1rypj_ | 204 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.79 | |
| d1ryp2_ | 233 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.78 | |
| d1iru2_ | 217 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.78 | |
| d1ryp1_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.78 | |
| d1iruj_ | 204 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.76 | |
| d1q5qh_ | 224 | Proteasome beta subunit (catalytic) {Rhodococcus e | 99.75 | |
| d1iruk_ | 199 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.73 | |
| d1iru1_ | 213 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.66 | |
| d2z3ba1 | 180 | HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 | 98.65 | |
| d1m4ya_ | 171 | HslV (ClpQ) protease {Thermotoga maritima [TaxId: | 98.44 | |
| d1g3ka_ | 173 | HslV (ClpQ) protease {Haemophilus influenzae [TaxI | 98.15 |
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome alpha subunit (non-catalytic) species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=100.00 E-value=1.5e-55 Score=394.42 Aligned_cols=215 Identities=40% Similarity=0.638 Sum_probs=207.9
Q ss_pred CCcceehhhhHHHHhcCCCcEEEEEeCCEEEEEEecCCCCCcC-ccccccEEEecCcEEEEEecChhhHHHHHHHHHHHH
Q psy2869 1 PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILF-EDCIHKVEPITDYIGMVYSGMGPDYRLLVKKARKIA 79 (352)
Q Consensus 1 p~Grl~QveYa~~av~~G~tvIgi~~~dgVvlaad~~~~~~~~-~~~~~KI~~i~~~i~~~~sG~~~D~~~l~~~~~~~~ 79 (352)
|||||+|||||+||+++|+|+|||+++||||||+|+|.++++. +++.+|||+|++|++|+++|..+|++.+.++++.++
T Consensus 5 p~G~l~QvEYa~~av~~G~t~vgi~~~dgVvlaad~r~~~~~~~~~~~~Ki~~I~~~i~~~~sG~~~D~~~l~~~~~~~~ 84 (221)
T d1yara1 5 PDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAAVTSGLVADARVLVDFARISA 84 (221)
T ss_dssp TTSCCHHHHHHHHHHTTSCCEEEEEETTEEEEEECCCCCCTTBCSTTCCSEEEEETTEEEEEEEBHHHHHHHHHHHHHHH
T ss_pred CCCcchHHHHHHHHHhcCCcEEEEEeCCEEEEEEecccCCcccccCccceEEEecCCceEEeeeccchHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999987777 888899999999999999999999999999999999
Q ss_pred HHHHHHhCCCCCHHHHHHHHHHHHHHHhhcCCCccceEEEeEEEEeCCCCEEEEECCCCcEEecceEEecCCCchhHHHH
Q psy2869 80 QQYKLVYQENIPTQQLVQRVAAIMQEYTQSGGVRPFGVSLLICGWDNKRPYLYQCDPSGAYFAWKATAMGRNYVNGKTFL 159 (352)
Q Consensus 80 ~~~~~~~~~~i~~~~la~~l~~~~~~~~~~~~~rP~~v~~ivaG~D~~gp~Ly~iDp~G~~~~~~~~a~G~gs~~~~~~L 159 (352)
+.|+++++++++++.++++++.+++.+++++++|||++++||||+|++||+||.+||+|++.+++++|+|+|+..++++|
T Consensus 85 ~~~~~~~~~~~~~~~l~~~~a~~~~~~~~~~~~rP~~~~~li~G~d~~gp~Ly~id~~G~~~~~~~~a~G~g~~~~~~~L 164 (221)
T d1yara1 85 QQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIGPRLFDCDPAGTINEYKATAIGSGKDAVVSFL 164 (221)
T ss_dssp HHHHHHHSSCCCHHHHHHHHHHHHHHTTTBTTBCCCCEEEEEEEECSSCEEEEEECTTCCEEEBSEEEESTTHHHHHHHH
T ss_pred HHHHHHcCCcchHHHHHHHHHHHHHHHhhhccCCCcceEEEEEEEecCCCeEEEEcCCccEEEeeEEEECCchHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhcCCCCCHHHHHHHHHHHHHHhhccCCCCCceEEEEEeCC-CeEEcChhHHHHHH
Q psy2869 160 EKRYSEDLELDDAVHTAILTLKEGFEGQMTAENIEIGIADEN-GFRRLDVATVRDHL 215 (352)
Q Consensus 160 e~~~~~~~s~~eai~l~~~~l~~~~~~d~~~~~iei~ii~~~-g~~~l~~~ei~~~l 215 (352)
|+.|+++||++||++++++||+.+.+++.+.++++|++++++ +++.++++||+++|
T Consensus 165 e~~~~~~ms~~ea~~la~~~l~~~~~~~~~~~~~ei~~i~~~~~~r~l~~~ei~~~l 221 (221)
T d1yara1 165 EREYKENLPEKEAVTLGIKALKSSLEEGEELKAPEIASITVGNKYRIYDQEEVKKFL 221 (221)
T ss_dssp HHHCCTTCCHHHHHHHHHHHHHHTSCSSCCCCCCEEEEEETTSCCEECCHHHHHTTC
T ss_pred HHHhhccccHHHHHHHHHHHHHHHHhccCCCCCcEEEEEEcCCCEEECCHHHHHHhC
Confidence 999999999999999999999999988888889999999864 69999999998753
|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|