Psyllid ID: psy2880

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK
cccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEccccccccEEEEEEcccccccEEEEEccEEEEEcccEEEcccccccccccccEEcccccEEEEEEcccccEEEEEEccEEHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHcc
cccccccccccHHHHcEcEccccccHHHHHHHHHHHHHHHHccccEEEHHHHcccEcEEEEEcccccccEEEEEEEEEEEccccEEEEEEcccccccccEEEEEEccEEEEEEcccccEEEEEEcHHHHHHHHHHHHHHEcccHHHHccHHHHHHHHHHHHHHHcc
mtllpiiyypdirlkkiaepiteFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKnnnqlqvfinpkiiwySKEKQiynegclslpgifnkikrskRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK
mtllpiiyypdirlkkiaepitefdiNLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK
MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK
**LLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLK****
MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKN***
MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK
*TLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKN***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
B1XSN2171 Peptide deformylase OS=Po yes N/A 1.0 0.970 0.524 2e-52
Q7VS88170 Peptide deformylase 2 OS= yes N/A 0.975 0.952 0.512 1e-51
Q7W1V3170 Peptide deformylase 1 OS= yes N/A 0.975 0.952 0.512 1e-51
Q7WQS9170 Peptide deformylase 1 OS= yes N/A 0.975 0.952 0.512 1e-51
Q8Y3B0169 Peptide deformylase 1 OS= yes N/A 0.939 0.923 0.512 4e-50
B0VNL8176 Peptide deformylase OS=Ac yes N/A 1.0 0.943 0.5 4e-50
A5WBG1176 Peptide deformylase OS=Ps yes N/A 1.0 0.943 0.508 5e-49
C1DFV8168 Peptide deformylase OS=Az yes N/A 1.0 0.988 0.481 1e-47
Q88RR1168 Peptide deformylase 1 OS= yes N/A 1.0 0.988 0.487 5e-47
Q7NQ75167 Peptide deformylase OS=Ch yes N/A 0.993 0.988 0.512 6e-47
>sp|B1XSN2|DEF_POLNS Peptide deformylase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=def PE=3 SV=1 Back     alignment and function desciption
 Score =  204 bits (520), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 127/166 (76%)

Query: 1   MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLI 60
           M LL ++ YPD RL K+A+P+ + D  +KKI+ +M +TMY A G+GLAA+QVDIH+++++
Sbjct: 1   MALLTVLCYPDSRLHKVAKPVAQVDARIKKIVADMADTMYEAPGVGLAATQVDIHERIVV 60

Query: 61  LDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMF 120
           +D+S   N+L VFINP+I+W S E + + EGCLS+P  +++++R   IRV AL+I+GK F
Sbjct: 61  IDVSDEQNELMVFINPEIVWTSSETKSWREGCLSVPEFYDEVERPAEIRVKALDIDGKEF 120

Query: 121 EIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK 166
           EI A+G LA+CLQHE+DHL GK+F+EYLS FK+ RI +K  K  K+
Sbjct: 121 EIEADGSLAVCLQHELDHLQGKVFVEYLSIFKRTRISQKMKKRAKE 166
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.
Polynucleobacter necessarius subsp. necessarius (strain STIR1) (taxid: 452638)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 8EC: 8
>sp|Q7VS88|DEF2_BORPE Peptide deformylase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=def2 PE=3 SV=1 Back     alignment and function description
>sp|Q7W1V3|DEF1_BORPA Peptide deformylase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=def1 PE=3 SV=1 Back     alignment and function description
>sp|Q7WQS9|DEF1_BORBR Peptide deformylase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=def1 PE=3 SV=1 Back     alignment and function description
>sp|Q8Y3B0|DEF1_RALSO Peptide deformylase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=def1 PE=3 SV=1 Back     alignment and function description
>sp|B0VNL8|DEF_ACIBS Peptide deformylase OS=Acinetobacter baumannii (strain SDF) GN=def PE=3 SV=1 Back     alignment and function description
>sp|A5WBG1|DEF_PSYWF Peptide deformylase OS=Psychrobacter sp. (strain PRwf-1) GN=def PE=3 SV=1 Back     alignment and function description
>sp|C1DFV8|DEF_AZOVD Peptide deformylase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=def PE=3 SV=1 Back     alignment and function description
>sp|Q88RR1|DEF1_PSEPK Peptide deformylase 1 OS=Pseudomonas putida (strain KT2440) GN=def1 PE=3 SV=1 Back     alignment and function description
>sp|Q7NQ75|DEF_CHRVO Peptide deformylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=def PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
340789288176 peptide deformylase [Collimonas fungivor 0.981 0.926 0.588 3e-56
399020096170 peptide deformylase [Herbaspirillum sp. 0.981 0.958 0.558 1e-54
329913547177 Peptide deformylase [Oxalobacteraceae ba 0.975 0.915 0.567 1e-53
445494841180 peptide deformylase 1 [Janthinobacterium 0.981 0.905 0.552 1e-52
409408453172 polypeptide deformylase [Herbaspirillum 0.981 0.947 0.546 2e-52
395760200180 peptide deformylase [Janthinobacterium l 0.993 0.916 0.557 2e-52
187476716170 peptide deformylase [Bordetella avium 19 0.975 0.952 0.530 3e-52
398837167172 peptide deformylase [Herbaspirillum sp. 0.981 0.947 0.521 3e-52
300313962172 polypeptide deformylase [Herbaspirillum 0.981 0.947 0.533 5e-52
422323718170 peptide deformylase 1 [Achromobacter xyl 0.975 0.952 0.543 6e-52
>gi|340789288|ref|YP_004754753.1| peptide deformylase [Collimonas fungivorans Ter331] gi|340554555|gb|AEK63930.1| Peptide deformylase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 96/163 (58%), Positives = 131/163 (80%)

Query: 1   MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLI 60
           M+LL I+ YPD+RL KIA+P+T FD  LKK+I +M ETMY A G+GLAASQVD+H+QL++
Sbjct: 1   MSLLNILRYPDVRLHKIAKPVTVFDTRLKKLIADMAETMYEAPGVGLAASQVDVHEQLVV 60

Query: 61  LDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMF 120
           +D S     L+VFINP+I+W S+EKQIY+EGCLS+PG+++ ++R  RI+V AL+ +GK F
Sbjct: 61  IDTSDTGTDLRVFINPEILWASEEKQIYDEGCLSVPGVYDGVERPARIKVRALDADGKPF 120

Query: 121 EIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKN 163
           E+ A+GLLA+C+QHE+DHL GK+F+EYLS  K+ RI  K LK 
Sbjct: 121 EVDADGLLAVCIQHEMDHLMGKVFVEYLSPLKRNRIKAKMLKE 163

Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|399020096|ref|ZP_10722236.1| peptide deformylase [Herbaspirillum sp. CF444] gi|398096106|gb|EJL86435.1| peptide deformylase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|329913547|ref|ZP_08275972.1| Peptide deformylase [Oxalobacteraceae bacterium IMCC9480] gi|327545311|gb|EGF30553.1| Peptide deformylase [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|445494841|ref|ZP_21461885.1| peptide deformylase 1 [Janthinobacterium sp. HH01] gi|444791002|gb|ELX12549.1| peptide deformylase 1 [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|409408453|ref|ZP_11256888.1| polypeptide deformylase [Herbaspirillum sp. GW103] gi|386431775|gb|EIJ44603.1| polypeptide deformylase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|395760200|ref|ZP_10440869.1| peptide deformylase [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|187476716|ref|YP_784740.1| peptide deformylase [Bordetella avium 197N] gi|115421302|emb|CAJ47807.1| peptide deformylase [Bordetella avium 197N] Back     alignment and taxonomy information
>gi|398837167|ref|ZP_10594477.1| peptide deformylase [Herbaspirillum sp. YR522] gi|398209158|gb|EJM95839.1| peptide deformylase [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|300313962|ref|YP_003778054.1| polypeptide deformylase [Herbaspirillum seropedicae SmR1] gi|300076747|gb|ADJ66146.1| polypeptide deformylase protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|422323718|ref|ZP_16404757.1| peptide deformylase 1 [Achromobacter xylosoxidans C54] gi|317401262|gb|EFV81903.1| peptide deformylase 1 [Achromobacter xylosoxidans C54] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
UNIPROTKB|P0A6K3169 def [Escherichia coli K-12 (ta 0.969 0.952 0.456 3.9e-37
TIGR_CMR|SO_0032168 SO_0032 "polypeptide deformyla 0.993 0.982 0.481 2.1e-36
TIGR_CMR|CPS_0020171 CPS_0020 "polypeptide deformyl 0.993 0.964 0.466 5.7e-36
UNIPROTKB|Q9KVU3169 def1 "Peptide deformylase 1" [ 0.987 0.970 0.445 2.8e-34
TIGR_CMR|VC_0046169 VC_0046 "polypeptide deformyla 0.987 0.970 0.445 2.8e-34
TIGR_CMR|SO_2530163 SO_2530 "polypeptide deformyla 0.963 0.981 0.429 6.2e-30
TIGR_CMR|SPO_3219172 SPO_3219 "peptide deformylase" 0.945 0.912 0.406 3.4e-29
TIGR_CMR|GSU_0129167 GSU_0129 "polypeptide deformyl 0.927 0.922 0.426 9.1e-29
TIGR_CMR|CPS_0407166 CPS_0407 "polypeptide deformyl 0.981 0.981 0.403 5e-28
UNIPROTKB|Q9KN16168 def2 "Peptide deformylase 2" [ 0.981 0.970 0.391 1.5e-26
UNIPROTKB|P0A6K3 def [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 399 (145.5 bits), Expect = 3.9e-37, P = 3.9e-37
 Identities = 74/162 (45%), Positives = 123/162 (75%)

Query:     1 MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLI 60
             M++L +++ PD RL+K+A+P+ E +  +++I+ +M ETMY   GIGLAA+QVDIH+++++
Sbjct:     1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIV 60

Query:    61 LDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMF 120
             +D+S+N ++  V INP+++  S E  I  EGCLS+P     + R++++++ AL+ +GK F
Sbjct:    61 IDVSENRDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPF 119

Query:   121 EIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLK 162
             E+ A+GLLAIC+QHE+DHL GK+F++YLS  K++RI +K  K
Sbjct:   120 ELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK 161
GO:0008270 "zinc ion binding" evidence=IDA
GO:0042586 "peptide deformylase activity" evidence=IEA;IDA
GO:0016787 "hydrolase activity" evidence=IDA
GO:0031365 "N-terminal protein amino acid modification" evidence=IDA
GO:0008198 "ferrous iron binding" evidence=IDA
GO:0043686 "co-translational protein modification" evidence=IPI
GO:0006412 "translation" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
TIGR_CMR|SO_0032 SO_0032 "polypeptide deformylase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0020 CPS_0020 "polypeptide deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVU3 def1 "Peptide deformylase 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0046 VC_0046 "polypeptide deformylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2530 SO_2530 "polypeptide deformylase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3219 SPO_3219 "peptide deformylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0129 GSU_0129 "polypeptide deformylase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0407 CPS_0407 "polypeptide deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KN16 def2 "Peptide deformylase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4VFH8DEF_PSEU53, ., 5, ., 1, ., 8, 80.46910.97590.9642yesN/A
Q2NQQ4DEF_SODGM3, ., 5, ., 1, ., 8, 80.45670.96980.9415yesN/A
Q1CCX6DEF_YERPN3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
Q7WQS9DEF1_BORBR3, ., 5, ., 1, ., 8, 80.51230.97590.9529yesN/A
A5WBG1DEF_PSYWF3, ., 5, ., 1, ., 8, 80.50881.00.9431yesN/A
C5BKQ0DEF_TERTT3, ., 5, ., 1, ., 8, 80.49391.00.9880yesN/A
Q92SH6DEF_RHIME3, ., 5, ., 1, ., 8, 80.45500.99390.9482yesN/A
A4XNB3DEF_PSEMY3, ., 5, ., 1, ., 8, 80.47530.97590.9642yesN/A
Q8Y3B0DEF1_RALSO3, ., 5, ., 1, ., 8, 80.51280.93970.9230yesN/A
B0VNL8DEF_ACIBS3, ., 5, ., 1, ., 8, 80.51.00.9431yesN/A
Q5F5P6DEF_NEIG13, ., 5, ., 1, ., 8, 80.46660.98790.9820yesN/A
B1XSN2DEF_POLNS3, ., 5, ., 1, ., 8, 80.52401.00.9707yesN/A
Q664V4DEF_YERPS3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
A4TH23DEF_YERPP3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
B4S291DEF_ALTMD3, ., 5, ., 1, ., 8, 80.46660.98790.9704yesN/A
Q1C2X9DEF_YERPA3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
Q7NQ75DEF_CHRVO3, ., 5, ., 1, ., 8, 80.51200.99390.9880yesN/A
Q8ZJ79DEF_YERPE3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
Q8PG20DEF2_XANAC3, ., 5, ., 1, ., 8, 80.47020.98790.9647yesN/A
A7FNK2DEF_YERP33, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
A8GKG5DEF_SERP53, ., 5, ., 1, ., 8, 80.46660.98790.9704yesN/A
Q0VTE1DEF_ALCBS3, ., 5, ., 1, ., 8, 80.49380.97590.9642yesN/A
A1JRZ1DEF_YERE83, ., 5, ., 1, ., 8, 80.46660.98790.9647yesN/A
Q7VS88DEF2_BORPE3, ., 5, ., 1, ., 8, 80.51230.97590.9529yesN/A
Q88B43DEF1_PSESM3, ., 5, ., 1, ., 8, 80.48480.99390.9821yesN/A
Q9I7A8DEF_PSEAE3, ., 5, ., 1, ., 8, 80.45781.00.9880yesN/A
Q0T016DEF_SHIF83, ., 5, ., 1, ., 8, 80.46290.96980.9526yesN/A
B3PGY7DEF_CELJU3, ., 5, ., 1, ., 8, 80.47870.99390.9763yesN/A
A9R927DEF_YERPG3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
Q2SQX1DEF_HAHCH3, ., 5, ., 1, ., 8, 80.46060.99390.9821yesN/A
Q1QET1DEF_PSYCK3, ., 5, ., 1, ., 8, 80.50300.99390.8967yesN/A
P63916DEF_NEIMB3, ., 5, ., 1, ., 8, 80.47270.98790.9820yesN/A
C1DFV8DEF_AZOVD3, ., 5, ., 1, ., 8, 80.48191.00.9880yesN/A
Q83PZ1DEF_SHIFL3, ., 5, ., 1, ., 8, 80.46290.96980.9526yesN/A
A9M464DEF_NEIM03, ., 5, ., 1, ., 8, 80.47270.98790.9820yesN/A
B2K504DEF_YERPB3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
P63915DEF_NEIMA3, ., 5, ., 1, ., 8, 80.47270.98790.9820yesN/A
Q7W1V3DEF1_BORPA3, ., 5, ., 1, ., 8, 80.51230.97590.9529yesN/A
A9ILK4DEF_BART13, ., 5, ., 1, ., 8, 80.45881.00.9325yesN/A
Q5QXI5DEF_IDILO3, ., 5, ., 1, ., 8, 80.50.96980.9252yesN/A
Q8P4F9DEF2_XANCP3, ., 5, ., 1, ., 8, 80.46660.96980.9470yesN/A
Q4FVQ4DEF_PSYA23, ., 5, ., 1, ., 8, 80.50300.99390.8967yesN/A
Q3YWX3DEF_SHISS3, ., 5, ., 1, ., 8, 80.46290.96980.9526yesN/A
B1JJH8DEF_YERPY3, ., 5, ., 1, ., 8, 80.47270.98790.9647yesN/A
C4K6Y0DEF_HAMD53, ., 5, ., 1, ., 8, 80.49380.96980.9415yesN/A
A1KRE5DEF_NEIMF3, ., 5, ., 1, ., 8, 80.47270.98790.9820yesN/A
Q82TC8DEF2_NITEU3, ., 5, ., 1, ., 8, 80.48790.99390.8918yesN/A
Q6G5F0DEF_BARHE3, ., 5, ., 1, ., 8, 80.48211.00.9431yesN/A
Q88RR1DEF1_PSEPK3, ., 5, ., 1, ., 8, 80.48791.00.9880yesN/A
Q21PV5DEF_SACD23, ., 5, ., 1, ., 8, 80.51.00.9651yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.10.963
3rd Layer3.5.1.880.946

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
PRK00150165 PRK00150, def, peptide deformylase; Reviewed 7e-77
PRK12846165 PRK12846, PRK12846, peptide deformylase; Reviewed 8e-72
COG0242168 COG0242, Def, N-formylmethionyl-tRNA deformylase [ 1e-70
pfam01327155 pfam01327, Pep_deformylase, Polypeptide deformylas 4e-63
cd00487141 cd00487, Pep_deformylase, Polypeptide or peptide d 6e-63
PRK14597166 PRK14597, PRK14597, peptide deformylase; Provision 3e-44
TIGR00079161 TIGR00079, pept_deformyl, peptide deformylase 8e-41
PRK14596199 PRK14596, PRK14596, peptide deformylase; Provision 1e-37
PRK14598187 PRK14598, PRK14598, peptide deformylase; Provision 7e-32
PRK14595162 PRK14595, PRK14595, peptide deformylase; Provision 2e-26
PRK09218136 PRK09218, PRK09218, peptide deformylase; Validated 3e-13
>gnl|CDD|234668 PRK00150, def, peptide deformylase; Reviewed Back     alignment and domain information 
 Score =  225 bits (577), Expect = 7e-77
 Identities = 80/163 (49%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 1   MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLI 60
           M +LPI+ Y D  L+K+A+P+ E D  L+K+I +M ETMY A G+GLAA QV + K++++
Sbjct: 1   MAILPILRYGDPVLRKVAKPVEEVDDELRKLIDDMFETMYAAPGVGLAAPQVGVSKRIIV 60

Query: 61  LDISKNNNQLQVFINPKIIWYSK-EKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKM 119
           +D+     +  V INP+II  S  E   Y EGCLS+PG++ ++ R +R+ V AL+ +GK 
Sbjct: 61  IDVEDKEGEPLVLINPEIISESSEEYLTYEEGCLSVPGVYGEVPRPERVTVKALDRDGKP 120

Query: 120 FEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLK 162
           FE+ A+GLLA C+QHEIDHLNG +FI+ LS  K+ RI KK  K
Sbjct: 121 FELEADGLLARCIQHEIDHLNGVLFIDRLSPLKRFRIKKKLKK 163

Length = 165
>gnl|CDD|237227 PRK12846, PRK12846, peptide deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|223320 COG0242, Def, N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216435 pfam01327, Pep_deformylase, Polypeptide deformylase Back     alignment and domain information
>gnl|CDD|238271 cd00487, Pep_deformylase, Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes Back     alignment and domain information
>gnl|CDD|237761 PRK14597, PRK14597, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|232815 TIGR00079, pept_deformyl, peptide deformylase Back     alignment and domain information
>gnl|CDD|184758 PRK14596, PRK14596, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|237762 PRK14598, PRK14598, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|184757 PRK14595, PRK14595, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|181704 PRK09218, PRK09218, peptide deformylase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
COG0242168 Def N-formylmethionyl-tRNA deformylase [Translatio 100.0
PRK12846165 peptide deformylase; Reviewed 100.0
PRK00150165 def peptide deformylase; Reviewed 100.0
PRK14595162 peptide deformylase; Provisional 100.0
PRK14598187 peptide deformylase; Provisional 100.0
PRK14597166 peptide deformylase; Provisional 100.0
TIGR00079161 pept_deformyl peptide deformylase. Peptide deformy 100.0
PRK14596199 peptide deformylase; Provisional 100.0
PF01327156 Pep_deformylase: Polypeptide deformylase; InterPro 100.0
cd00487141 Pep_deformylase Polypeptide or peptide deformylase 100.0
PRK09218136 peptide deformylase; Validated 100.0
KOG3137|consensus267 100.0
COG4740176 Predicted metalloprotease [General function predic 98.1
>COG0242 Def N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=5e-67  Score=409.63  Aligned_cols=164  Identities=46%  Similarity=0.767  Sum_probs=157.3

Q ss_pred             CccccceecCCccccccccccccCCHHHHHHHHHHHHHHhhcCCceeecccccccccEEEEEecCC---CCceEEEEeee
Q psy2880           1 MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKN---NNQLQVFINPK   77 (166)
Q Consensus         1 M~~~~I~~~~dp~Lr~~~~~V~~~~~~~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~---~~~~~v~INP~   77 (166)
                      |++++|+.+|||+||++|+||..+|++++++++||++||++++|+||||||||+++|+||+++.++   ...+.+||||+
T Consensus         1 m~i~~Iv~~~~p~Lr~~a~~V~~~d~~l~~li~dM~etm~~~~GVGLAApQIGi~kri~vi~~~~~~~~~~~~~vlINP~   80 (168)
T COG0242           1 MAIREIVKYPDPRLRQVAKPVEEVDDELRQLIDDMLETMYAAEGVGLAAPQIGISKRIFVIDVEEDGRPKEPPLVLINPE   80 (168)
T ss_pred             CCcccceeCCCHHHhcccccccccCHHHHHHHHHHHHHHHhCCCeeeeehhcCceeeEEEEEccCccCcCcCceEEECCE
Confidence            899999999999999999999999999999999999999999999999999999999999999875   23578999999


Q ss_pred             EEeecceEEcCeecCcccCCCCccccccCceEEEEECCCCCEEEEEEechhhhHHHHHhhhhCCceeeccCCHHHHHHHH
Q psy2880          78 IIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERII  157 (166)
Q Consensus        78 I~~~s~~~~~~~EgCLS~p~~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~D~~~~~~~~~~~  157 (166)
                      |++.|.+..+.+|||||+||+++.|+||++|+|+|+|.+|++++++++||+|||+|||+|||||+||+||+++.++..+.
T Consensus        81 I~~~~~~~~~~~EGCLSvP~~~~~V~R~~~I~V~~~D~~G~~~~~~a~G~lA~~iQHEiDHLnGvlf~D~l~~~k~~~~~  160 (168)
T COG0242          81 IISKSEETLTGEEGCLSVPGVRGEVERPERITVKYLDRNGKPQELEAEGLLARCIQHEIDHLNGVLFIDRLSPLKRDRLK  160 (168)
T ss_pred             EeecCCcccccCcceEeecCceeeeecccEEEEEEEcCCCCEEEEEEcCceeEEeEeeccccCcEEeeeecChhhhhhHH
Confidence            99998888889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhh
Q psy2880         158 KKFLKNI  164 (166)
Q Consensus       158 ~~~~~~~  164 (166)
                      +++++..
T Consensus       161 ~~~~~~~  167 (168)
T COG0242         161 KKLKKLK  167 (168)
T ss_pred             HHHHHhc
Confidence            9998864

>PRK12846 peptide deformylase; Reviewed Back     alignment and domain information
>PRK00150 def peptide deformylase; Reviewed Back     alignment and domain information
>PRK14595 peptide deformylase; Provisional Back     alignment and domain information
>PRK14598 peptide deformylase; Provisional Back     alignment and domain information
>PRK14597 peptide deformylase; Provisional Back     alignment and domain information
>TIGR00079 pept_deformyl peptide deformylase Back     alignment and domain information
>PRK14596 peptide deformylase; Provisional Back     alignment and domain information
>PF01327 Pep_deformylase: Polypeptide deformylase; InterPro: IPR023635 Peptide deformylase (PDF) is an essential metalloenzyme required for the removal of the formyl group at the N terminus of nascent polypeptide chains in eubacteria: 3 Back     alignment and domain information
>cd00487 Pep_deformylase Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes Back     alignment and domain information
>PRK09218 peptide deformylase; Validated Back     alignment and domain information
>KOG3137|consensus Back     alignment and domain information
>COG4740 Predicted metalloprotease [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1n5n_A180 Crystal Structure Of Peptide Deformylase From Pseud 5e-46
1ix1_A171 Crystal Structure Of P.Aeruginosa Peptide Deformyla 2e-45
1lry_A167 Crystal Structure Of P. Aeruginosa Peptide Deformyl 6e-45
3k6l_A169 The Structure Of E.Coli Peptide Deformylase (Pdf) I 1e-41
4al2_A186 Peptide Deformylase (Ni-Form) With Hydrosulfide Len 4e-41
2w3t_A188 Chloro Complex Of The Ni-Form Of E.Coli Deformylase 4e-41
1icj_A168 Pdf Protein Is Crystallized As Ni2+ Containing Form 5e-41
1dff_A164 Peptide Deformylase Length = 164 6e-41
4az4_A186 E.Coli Deformylase With Co(Ii) And Hydrosulfide Len 8e-40
4al3_A186 Peptide Deformylase (Co-Form) With Mercaptoethanol 8e-40
1def_A147 Peptide Deformylase Catalytic Core (Residues 1-147) 2e-38
2def_A147 Peptide Deformylase Catalytic Core (Residues 1-147) 3e-38
3fwx_A169 The Crystal Structure Of The Peptide Deformylase Fr 6e-37
3oca_A209 Crystal Structure Of Peptide Deformylase From Ehrli 3e-32
3u04_A190 Crystal Structure Of Peptide Deformylase From Ehrli 4e-32
3qu1_A171 Peptide Deformylase From Vibrio Cholerae Length = 1 3e-29
1lme_A176 Crystal Structure Of Peptide Deformylase From Therm 2e-28
4dr9_A192 Crystal Structure Of A Peptide Deformylase From Syn 1e-27
1ws0_A156 Structure Analysis Of Peptide Deformylase From Baci 4e-24
1rl4_A188 Plasmodium Falciparum Peptide Deformylase Complex W 4e-24
3cpm_A193 Plant Peptide Deformylase Pdf1b Crystal Structure L 9e-24
2ew5_A181 Structure Of Helicobacter Pylori Peptide Deformylas 2e-23
3m6o_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 4e-23
1y6h_A177 Crystal Structure Of Lipdf Length = 177 5e-23
1szz_A177 Crystal Structure Of Peptide Deformylase From Lepto 1e-22
1rqc_A185 Crystals Of Peptide Deformylase From Plasmodium Fal 3e-22
3m6q_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 4e-22
3m6r_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 6e-22
3uwa_A154 Crystal Structure Of A Probable Peptide Deformylase 2e-20
1v3y_A192 The Crystal Structure Of Peptide Deformylase From T 6e-20
1jym_A183 Crystals Of Peptide Deformylase From Plasmodium Fal 1e-18
3e3u_A197 Crystal Structure Of Mycobacterium Tuberculosis Pep 1e-17
3dld_A171 Crystal Structure Of Peptide Deformylase, Xoo1075, 7e-17
2okl_A185 Crystal Structure Of Peptide Deformylase 2 With Act 4e-15
1zxz_A197 X-Ray Structure Of Peptide Deformylase From Arabido 2e-14
1lqy_A184 Crystal Structure Of Bacillus Stearothermophilus Pe 2e-13
1lqw_A183 Crystal Structure Of S.Aureus Peptide Deformylase L 3e-13
1lmh_A184 Crystal Structure Of S. Aureus Peptide Deformylase 4e-12
3g5k_A183 Structure And Activity Of Human Mitochondrial Pepti 7e-12
1q1y_A191 Crystal Structures Of Peptide Deformylase From Stap 7e-12
1lm4_A194 Structure Of Peptide Deformylase From Staphylococcu 7e-12
3g6n_A191 Crystal Structure Of An Efpdf Complex With Met-Ala- 2e-11
3cmd_A196 Crystal Structure Of Peptide Deformylase From Vre-E 2e-11
2os1_A188 Structures Of Actinonin Bound Peptide Deformylases 3e-11
2os3_A205 Structures Of Actinonin Bound Peptide Deformylases 8e-11
2os0_A188 Structures Of Actinonin Bound Peptide Deformylases 3e-10
2aie_P203 S.Pneumoniae Polypeptide Deformylase Complexed With 4e-10
3str_P203 Strep Peptide Deformylase With A Time Dependent Thi 4e-10
2ai7_A203 S.Pneumoniae Polypeptide Deformylase Complexed With 5e-10
3svj_P203 Strep Peptide Deformylase With A Time Dependent Thi 8e-09
1lm6_A215 Crystal Structure Of Peptide Deformylase From Strep 8e-09
3l87_A238 The Crystal Structure Of Smu.143c From Streptococcu 3e-06
>pdb|1N5N|A Chain A, Crystal Structure Of Peptide Deformylase From Pseudomonas Aeruginosa Length = 180 Back     alignment and structure 
Iteration: 1

 Score =  179 bits (455), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 124/166 (74%)
Query: 1   MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLI 60
           M +L I+ +PD RL+ IA+P+   D  ++++I +M ETMY A GIGLAA+QV++HK++++
Sbjct: 13  MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVV 72
Query: 61  LDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMF 120
           +D+S++ ++ +VFINP+    ++E   Y EGCLS+PG +  + R +++R+ AL+ +G  F
Sbjct: 73  MDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPF 132
Query: 121 EIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK 166
           E +AEGLLA+C+QHE DHLNGK+F++YLS  K++RI KK  K  ++
Sbjct: 133 EEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQ 178
>pdb|1IX1|A Chain A, Crystal Structure Of P.Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 171 Back     alignment and structure
>pdb|1LRY|A Chain A, Crystal Structure Of P. Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 167 Back     alignment and structure
>pdb|3K6L|A Chain A, The Structure Of E.Coli Peptide Deformylase (Pdf) In Complex With Peptidomimetic Ligand Bb2827 Length = 169 Back     alignment and structure
>pdb|4AL2|A Chain A, Peptide Deformylase (Ni-Form) With Hydrosulfide Length = 186 Back     alignment and structure
>pdb|2W3T|A Chain A, Chloro Complex Of The Ni-Form Of E.Coli Deformylase Length = 188 Back     alignment and structure
>pdb|1ICJ|A Chain A, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) Length = 168 Back     alignment and structure
>pdb|1DFF|A Chain A, Peptide Deformylase Length = 164 Back     alignment and structure
>pdb|4AZ4|A Chain A, E.Coli Deformylase With Co(Ii) And Hydrosulfide Length = 186 Back     alignment and structure
>pdb|4AL3|A Chain A, Peptide Deformylase (Co-Form) With Mercaptoethanol Length = 186 Back     alignment and structure
>pdb|1DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 9 Structures Length = 147 Back     alignment and structure
>pdb|2DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 20 Structures Length = 147 Back     alignment and structure
>pdb|3FWX|A Chain A, The Crystal Structure Of The Peptide Deformylase From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 169 Back     alignment and structure
>pdb|3OCA|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis Length = 209 Back     alignment and structure
>pdb|3U04|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis In Complex With Actinonin Length = 190 Back     alignment and structure
>pdb|3QU1|A Chain A, Peptide Deformylase From Vibrio Cholerae Length = 171 Back     alignment and structure
>pdb|1LME|A Chain A, Crystal Structure Of Peptide Deformylase From Thermotoga Maritima Length = 176 Back     alignment and structure
>pdb|4DR9|A Chain A, Crystal Structure Of A Peptide Deformylase From Synechococcus Elongatus In Complex With Actinonin Length = 192 Back     alignment and structure
>pdb|1WS0|A Chain A, Structure Analysis Of Peptide Deformylase From Bacillus Cereus Length = 156 Back     alignment and structure
>pdb|1RL4|A Chain A, Plasmodium Falciparum Peptide Deformylase Complex With Inhibitor Length = 188 Back     alignment and structure
>pdb|3CPM|A Chain A, Plant Peptide Deformylase Pdf1b Crystal Structure Length = 193 Back     alignment and structure
>pdb|2EW5|A Chain A, Structure Of Helicobacter Pylori Peptide Deformylase In Complex With Inhibitor Length = 181 Back     alignment and structure
>pdb|3M6O|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) Length = 193 Back     alignment and structure
>pdb|1Y6H|A Chain A, Crystal Structure Of Lipdf Length = 177 Back     alignment and structure
>pdb|1SZZ|A Chain A, Crystal Structure Of Peptide Deformylase From Leptospira Interrogans Complexed With Inhibitor Actinonin Length = 177 Back     alignment and structure
>pdb|1RQC|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 185 Back     alignment and structure
>pdb|3M6Q|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41q Mutant In Complex With Actinonin Length = 193 Back     alignment and structure
>pdb|3M6R|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41m Mutant In Complex With Actinonin Length = 193 Back     alignment and structure
>pdb|3UWA|A Chain A, Crystal Structure Of A Probable Peptide Deformylase From Synechococcus Phage S-Ssm7 Length = 154 Back     alignment and structure
>pdb|1V3Y|A Chain A, The Crystal Structure Of Peptide Deformylase From Thermus Thermophilus Hb8 Length = 192 Back     alignment and structure
>pdb|1JYM|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 183 Back     alignment and structure
>pdb|3E3U|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Peptide Deformylase In Complex With Inhibitor Length = 197 Back     alignment and structure
>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 171 Back     alignment and structure
>pdb|2OKL|A Chain A, Crystal Structure Of Peptide Deformylase 2 With Actinonin From Bacillus Cereus Length = 185 Back     alignment and structure
>pdb|1ZXZ|A Chain A, X-Ray Structure Of Peptide Deformylase From Arabidopsis Thaliana (Atpdf1a); Crystals Grown In Peg-5000 Mme As Precipitant Length = 197 Back     alignment and structure
>pdb|1LQY|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Peptide Deformylase Complexed With Antibiotic Actinonin Length = 184 Back     alignment and structure
>pdb|1LQW|A Chain A, Crystal Structure Of S.Aureus Peptide Deformylase Length = 183 Back     alignment and structure
>pdb|1LMH|A Chain A, Crystal Structure Of S. Aureus Peptide Deformylase Length = 184 Back     alignment and structure
>pdb|3G5K|A Chain A, Structure And Activity Of Human Mitochondrial Peptide Deformylase, A Novel Cancer Target Length = 183 Back     alignment and structure
>pdb|1Q1Y|A Chain A, Crystal Structures Of Peptide Deformylase From Staphylococcus Aureus Complexed With Actinonin Length = 191 Back     alignment and structure
>pdb|1LM4|A Chain A, Structure Of Peptide Deformylase From Staphylococcus Aureus At 1.45 A Length = 194 Back     alignment and structure
>pdb|3G6N|A Chain A, Crystal Structure Of An Efpdf Complex With Met-Ala-Ser Length = 191 Back     alignment and structure
>pdb|3CMD|A Chain A, Crystal Structure Of Peptide Deformylase From Vre-E.Faecium Length = 196 Back     alignment and structure
>pdb|2OS1|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 Back     alignment and structure
>pdb|2OS3|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 205 Back     alignment and structure
>pdb|2OS0|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 Back     alignment and structure
>pdb|2AIE|P Chain P, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 505684 Length = 203 Back     alignment and structure
>pdb|3STR|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Hydroxamic Acid Length = 203 Back     alignment and structure
>pdb|2AI7|A Chain A, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 485345 Length = 203 Back     alignment and structure
>pdb|3SVJ|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Amide Length = 203 Back     alignment and structure
>pdb|1LM6|A Chain A, Crystal Structure Of Peptide Deformylase From Streptococcus Pneumoniae Length = 215 Back     alignment and structure
>pdb|3L87|A Chain A, The Crystal Structure Of Smu.143c From Streptococcus Mutans Ua159 Length = 238 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1n5n_A180 Peptide deformylase; metalloenzyme, drug design, d 2e-91
2w3t_A188 Peptide deformylase; protein biosynthesis, iron, n 2e-87
1xeo_A168 Peptide deformylase; cobalt deformylase, formate, 2e-87
3qu1_A171 Peptide deformylase 2; structural genomics, center 3e-86
3pn3_A193 Peptide deformylase 1B, chloroplastic; PDF, N-term 4e-86
1lme_A176 PDF, peptide deformylase; thermophIle, metalloenzy 5e-86
3u04_A190 Peptide deformylase 1; ssgcid, actinonin, ehrlichi 1e-85
1rl4_A188 Formylmethionine deformylase; crystal engineering, 4e-85
1ws0_A156 Peptide deformylase 1; alpha + beta topology, hydr 1e-83
2ew5_A181 Peptide deformylase; inhibitor, hydrolase; HET: Y1 2e-82
1y6h_A177 Peptide deformylase; open and close conformation, 9e-81
3e3u_A197 Peptide deformylase; metallo-enzyme, hydrolase, ir 2e-80
3dld_A171 Peptide deformylase; bacterial blight, XOO1075, xa 1e-78
1v3y_A192 Peptide deformylase; protein synthesis, riken stru 3e-78
1zxz_A197 PDF, peptide deformylase, mitochondrial; PDF1A, eu 5e-78
3g5k_A183 Peptide deformylase, mitochondrial; actinonin, hyd 8e-76
2okl_A185 Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. 3e-70
3l87_A238 Peptide deformylase; hydrolase, iron, metal-bindin 3e-67
3svj_P203 Peptide deformylase 3; alpha-beta, metal binding p 3e-66
2os0_A188 Peptide deformylase; PDF, hydrolase; 1.30A {Entero 3e-66
1lm4_A194 Peptide deformylase PDF1; metalloenzyme, hydrolase 5e-66
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Length = 180 Back     alignment and structure
 Score =  262 bits (673), Expect = 2e-91
 Identities = 77/166 (46%), Positives = 124/166 (74%)

Query: 1   MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLI 60
           M +L I+ +PD RL+ IA+P+   D  ++++I +M ETMY A GIGLAA+QV++HK++++
Sbjct: 13  MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVV 72

Query: 61  LDISKNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMF 120
           +D+S++ ++ +VFINP+    ++E   Y EGCLS+PG +  + R +++R+ AL+ +G  F
Sbjct: 73  MDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPF 132

Query: 121 EIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK 166
           E +AEGLLA+C+QHE DHLNGK+F++YLS  K++RI KK  K  ++
Sbjct: 133 EEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQ 178
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Length = 188 Back     alignment and structure
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Length = 168 Back     alignment and structure
>3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} Length = 171 Back     alignment and structure
>3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Length = 193 Back     alignment and structure
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Length = 176 Back     alignment and structure
>3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} PDB: 3oca_A Length = 190 Back     alignment and structure
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Length = 188 Back     alignment and structure
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Length = 156 Back     alignment and structure
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Length = 181 Back     alignment and structure
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Length = 177 Back     alignment and structure
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Length = 197 Back     alignment and structure
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} Length = 171 Back     alignment and structure
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Length = 192 Back     alignment and structure
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Length = 197 Back     alignment and structure
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Length = 183 Back     alignment and structure
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Length = 185 Back     alignment and structure
>3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Length = 238 Back     alignment and structure
>3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} PDB: 3str_P* 3sw8_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Length = 203 Back     alignment and structure
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Length = 188 Back     alignment and structure
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Length = 194 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
3u04_A190 Peptide deformylase 1; ssgcid, actinonin, ehrlichi 100.0
1n5n_A180 Peptide deformylase; metalloenzyme, drug design, d 100.0
3qu1_A171 Peptide deformylase 2; structural genomics, center 100.0
1xeo_A168 Peptide deformylase; cobalt deformylase, formate, 100.0
2w3t_A188 Peptide deformylase; protein biosynthesis, iron, n 100.0
1rl4_A188 Formylmethionine deformylase; crystal engineering, 100.0
2ew5_A181 Peptide deformylase; inhibitor, hydrolase; HET: Y1 100.0
1ws0_A156 Peptide deformylase 1; alpha + beta topology, hydr 100.0
3e3u_A197 Peptide deformylase; metallo-enzyme, hydrolase, ir 100.0
3pn3_A193 Peptide deformylase 1B, chloroplastic; PDF, N-term 100.0
1lme_A176 PDF, peptide deformylase; thermophIle, metalloenzy 100.0
1y6h_A177 Peptide deformylase; open and close conformation, 100.0
4dr9_A192 Peptide deformylase; hydrolase-hydrolase inhibitor 100.0
1v3y_A192 Peptide deformylase; protein synthesis, riken stru 100.0
3dld_A171 Peptide deformylase; bacterial blight, XOO1075, xa 100.0
3uwb_A154 RIIA-RIIB membrane-associated protein; actinonin, 100.0
3g5k_A183 Peptide deformylase, mitochondrial; actinonin, hyd 100.0
1zxz_A197 PDF, peptide deformylase, mitochondrial; PDF1A, eu 100.0
2okl_A185 Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. 100.0
2os0_A188 Peptide deformylase; PDF, hydrolase; 1.30A {Entero 100.0
3svj_P203 Peptide deformylase 3; alpha-beta, metal binding p 100.0
1lm4_A194 Peptide deformylase PDF1; metalloenzyme, hydrolase 100.0
3l87_A238 Peptide deformylase; hydrolase, iron, metal-bindin 100.0
>3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} SCOP: d.167.1.0 PDB: 3oca_A Back     alignment and structure
Probab=100.00  E-value=2.2e-68  Score=424.64  Aligned_cols=165  Identities=44%  Similarity=0.714  Sum_probs=157.8

Q ss_pred             CccccceecCCccccccccccccCCHHHHHHHHHHHHHHhhcCCceeecccccccccEEEEEecCC--------------
Q psy2880           1 MTLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKN--------------   66 (166)
Q Consensus         1 M~~~~I~~~~dp~Lr~~~~~V~~~~~~~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~--------------   66 (166)
                      |++++|+++|||+||++|+||+.+|+++++|++||++||++++|+||||||||+++|+||++.++.              
T Consensus         3 M~i~~I~~~gdpvLr~~a~pV~~~d~~l~~Li~dM~eTM~~~~GvGLAApQIGv~~Ri~vid~~~~~~~~~~~~~~~~~~   82 (190)
T 3u04_A            3 MSVLSIVTVPDKRLSLCSEEVEKVDQSIRKLVDDMFETMHANQGLGLAAVQVGVHKRILVMNVPEEFEDSEDIENVEDKI   82 (190)
T ss_dssp             CCCCCCCCTTCGGGGSCCBCCSCCCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEEECCC-------------C
T ss_pred             CcccchhhCCCHHHhccceeCCCCCHHHHHHHHHHHHHHHHcCCeEEehhhcCCceeEEEEEcCcccccccccccccccc
Confidence            899999999999999999999999999999999999999999999999999999999999999753              


Q ss_pred             -----CCceEEEEeeeEEeecceEEcCeecCcccCCCCccccccCceEEEEECCCCCEEEEEEechhhhHHHHHhhhhCC
Q psy2880          67 -----NNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNG  141 (166)
Q Consensus        67 -----~~~~~v~INP~I~~~s~~~~~~~EgCLS~p~~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  141 (166)
                           ...+.+||||+|+..|++....+|||||+||+++.|+||.+|+|+|+|++|++++++++||+|||||||+|||+|
T Consensus        83 ~~~~~~~~~~vlINP~I~~~s~~~~~~~EGCLSvPg~~~~V~R~~~I~V~~~D~~G~~~~~~~~G~~Ar~iQHEiDHL~G  162 (190)
T 3u04_A           83 EGYELYGGPYCIINPKIVDISQEKVKLKEGCLSVPGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNG  162 (190)
T ss_dssp             TTCBSSEEEEEEEEEEEEEECSCEEEEEECCTTSTTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTT
T ss_pred             ccccccCCCEEEECCEEEecCCCEeeccCCCCCcCCcceeeccchheEEEEECCCCCEEEEEEEChhhhhhhhHHHhcCC
Confidence                 124789999999999999877899999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeccCCHHHHHHHHHHHHhhhh
Q psy2880         142 KIFIEYLSNFKKERIIKKFLKNIK  165 (166)
Q Consensus       142 ~l~~D~~~~~~~~~~~~~~~~~~~  165 (166)
                      +||+||+++.+|.++.++++|..+
T Consensus       163 iLfiDrl~~~~r~~~~~~~~k~~~  186 (190)
T 3u04_A          163 TVFLKYLSKFKRDFAIEKVKKKER  186 (190)
T ss_dssp             CCGGGGSCHHHHHHHHHHHHHHHC
T ss_pred             EeeeeecCHHHHHHHHHHHHHHHH
Confidence            999999999999999999998764
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Back     alignment and structure
>3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} SCOP: d.167.1.0 Back     alignment and structure
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Back     alignment and structure
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Back     alignment and structure
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Back     alignment and structure
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Back     alignment and structure
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Back     alignment and structure
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Back     alignment and structure
>3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Back     alignment and structure
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Back     alignment and structure
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Back     alignment and structure
>4dr9_A Peptide deformylase; hydrolase-hydrolase inhibitor complex; HET: BB2; 1.90A {Synechococcus elongatus} Back     alignment and structure
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Back     alignment and structure
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} SCOP: d.167.1.0 Back     alignment and structure
>3uwb_A RIIA-RIIB membrane-associated protein; actinonin, probable peptide deformylase hydrolase-antibiotic complex; HET: BB2; 1.70A {Synechococcus phage s-ssm7} PDB: 3uwa_A* Back     alignment and structure
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Back     alignment and structure
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Back     alignment and structure
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Back     alignment and structure
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Back     alignment and structure
>3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} SCOP: d.167.1.1 PDB: 3str_P* 3sw8_P* 4eox_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Back     alignment and structure
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Back     alignment and structure
>3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d1v3ya_182 d.167.1.1 (A:) Peptide deformylase {Thermus thermo 8e-43
d1ix1a_169 d.167.1.1 (A:) Peptide deformylase {Pseudomonas ae 5e-42
d1lmea_154 d.167.1.1 (A:) Peptide deformylase {Thermotoga mar 4e-41
d1y6ha_177 d.167.1.1 (A:) Peptide deformylase {Leptospira int 1e-40
d1xeoa1164 d.167.1.1 (A:1-164) Peptide deformylase {Escherich 2e-39
d1rl4a_165 d.167.1.1 (A:) Peptide deformylase {Malaria parasi 2e-33
d1lqya_184 d.167.1.1 (A:) Peptide deformylase {Bacillus stear 3e-31
d1lm6a_202 d.167.1.1 (A:) Peptide deformylase {Streptococcus 1e-30
d1lm4a_194 d.167.1.1 (A:) Peptide deformylase {Staphylococcus 7e-29
>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Thermus thermophilus [TaxId: 274]

 Score =  138 bits (349), Expect = 8e-43
 Identities = 54/176 (30%), Positives = 91/176 (51%), Gaps = 14/176 (7%)

Query: 4   LPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDI 63
            PI  Y D  L++ A P+ +F   +K++  +M ETM+ A G+GLAA Q+ + ++L +   
Sbjct: 3   YPIRLYGDPVLRRKARPVEDFS-GIKRLAEDMLETMFEAKGVGLAAPQIGLSQRLFVAVE 61

Query: 64  S------------KNNNQLQVFINPKIIWYSKEKQIYNEGCLSLPGIF-NKIKRSKRIRV 110
                        +   +    +   +I Y +      EGCLSLPG++  ++ R++RIRV
Sbjct: 62  YADEPEGEEERPLRELVRRVYVVANPVITYREGLVEGTEGCLSLPGLYSEEVPRAERIRV 121

Query: 111 HALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFLKNIKK 166
              + EG+   +  EG +A   QHEIDHL+G +F E L   K+E  ++     + +
Sbjct: 122 EYQDEEGRGRVLELEGYMARVFQHEIDHLDGILFFERLPKPKREAFLEANRAELVR 177
>d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 169 Back     information, alignment and structure
>d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Length = 154 Back     information, alignment and structure
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Length = 177 Back     information, alignment and structure
>d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 184 Back     information, alignment and structure
>d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Length = 202 Back     information, alignment and structure
>d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1xeoa1164 Peptide deformylase {Escherichia coli [TaxId: 562] 100.0
d1ix1a_169 Peptide deformylase {Pseudomonas aeruginosa [TaxId 100.0
d1lmea_154 Peptide deformylase {Thermotoga maritima [TaxId: 2 100.0
d1rl4a_165 Peptide deformylase {Malaria parasite (Plasmodium 100.0
d1y6ha_177 Peptide deformylase {Leptospira interrogans [TaxId 100.0
d1v3ya_182 Peptide deformylase {Thermus thermophilus [TaxId: 100.0
d1lqya_184 Peptide deformylase {Bacillus stearothermophilus [ 100.0
d1lm4a_194 Peptide deformylase {Staphylococcus aureus [TaxId: 100.0
d1lm6a_202 Peptide deformylase {Streptococcus pneumoniae [Tax 100.0
>d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.7e-65  Score=396.81  Aligned_cols=163  Identities=44%  Similarity=0.791  Sum_probs=156.3

Q ss_pred             ccccceecCCccccccccccccCCHHHHHHHHHHHHHHhhcCCceeecccccccccEEEEEecCCCCceEEEEeeeEEee
Q psy2880           2 TLLPIIYYPDIRLKKIAEPITEFDINLKKIIFNMTETMYHAMGIGLAASQVDIHKQLLILDISKNNNQLQVFINPKIIWY   81 (166)
Q Consensus         2 ~~~~I~~~~dp~Lr~~~~~V~~~~~~~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~v~INP~I~~~   81 (166)
                      ++++|++||||+||++|.||+.+|+++++++++|++||++++|+||||||||+++|+||++..+..+.+.+||||+|++.
T Consensus         1 ~v~~I~~~~dp~Lr~~a~~v~~~~~~~~~li~dm~~tm~~~~GvGLAApQIG~~~rifvv~~~~~~~~~~v~iNP~I~~~   80 (164)
T d1xeoa1           1 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK   80 (164)
T ss_dssp             CCCCCCCTTCGGGGCCCBCCSCCCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCCTTSCCCEEEEEEEEEEE
T ss_pred             CccchhcCCChHHhCcCeeCCCCCHHHHHHHHHHHHHhhhcCcceeeehhhccccceEEEEeecccCceEEecCcEEeee
Confidence            58999999999999999999999999999999999999999999999999999999999998876667899999999998


Q ss_pred             cceEEcCeecCcccCCCCccccccCceEEEEECCCCCEEEEEEechhhhHHHHHhhhhCCceeeccCCHHHHHHHHHHHH
Q psy2880          82 SKEKQIYNEGCLSLPGIFNKIKRSKRIRVHALNIEGKMFEIIAEGLLAICLQHEIDHLNGKIFIEYLSNFKKERIIKKFL  161 (166)
Q Consensus        82 s~~~~~~~EgCLS~p~~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~D~~~~~~~~~~~~~~~  161 (166)
                      |++. ..+|||||+||+++.|+||.+|+|+|+|.+|++++.+++||.|||+|||+|||+|+||+||+++.++..+.++++
T Consensus        81 ~~~~-~~~EgCLS~Pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Dr~~~~~~~~~~kk~~  159 (164)
T d1xeoa1          81 SGET-GIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVE  159 (164)
T ss_dssp             ECCB-CCEECCTTSTTCCEECCBCSEEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHHHHHHHH
T ss_pred             ccee-eecCCcccccccccccccccEEEEEEEcCCCCEEEEEEeeeeeehHHHHHHHhCCEehhhhcCHHHHHHHHHHHH
Confidence            8775 699999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhh
Q psy2880         162 KNIK  165 (166)
Q Consensus       162 ~~~~  165 (166)
                      |+.+
T Consensus       160 k~~r  163 (164)
T d1xeoa1         160 KLDR  163 (164)
T ss_dssp             HHHH
T ss_pred             Hhhc
Confidence            8754
>d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure