Psyllid ID: psy2894

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-----
MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDAKI
ccccHHHHHHHHHHHHHcccccccEEEEEEEEEEcccEEEEEccccccccccEEcccccEEEEEEcccccEEEEEEcccccccccccEEEcccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHHHHccccccEEEEEEcccccccHHHcccccccHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccccccccccEEEEcHHHHHHHHHccHHHHcccccccccccccccccccEEEcccccEEEEcccccEEEccccEEEcccccccccccccccccEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccc
ccccHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEccccEccEEEEEccccEEEEEEEccccEEEEEcccHHHcccccEEEEEEEEcEEEccHHHcccEEcccccEcccccccccccEEEccccccccccEcccccEcccccHHHHHHcccEcccEcEEEEcccccHHHHHHHHHHHcHHHHcEEEEEEEcccHHHHHHHHHHHHHHccHHHEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHHccccccHHHccccHHHHHHHHHccccEEcHHHHHHHHcccEcccccEEEEEEEEEccccccccHHHHHHHccccEEEEEcHHHHHHcccccEcccccEEccHHHHccHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc
MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYglsnamqgemlefpgnvFGLALNLERDSIGAVILgkyehitegdivkctgrilevpigpelcGRVINalgdpidgkgpiktkltapiekvapgvisrqsvseplqtgikaidsivpigkgqreliigdrqtgkssiAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLlkrppgreaypgdiFYLHSRLLERSARVNIKYVenytngkvtgktgsltaipiietqagdisafvptnvisitdgqifldsslfnsgirpainagisvsrvGGAAQIKFIKKLSSNIRTDLAQYRELAAfsqfssdlDLVTRKQLDRGARVTELLkqkqysplpvSLIAVILFAINkgflddieIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDAKI
MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKyehitegdivkcTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEkvapgvisrqsvseplqtgikaidsivpigkgQRELIigdrqtgkssiaIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISlllkrppgreayPGDIFYLHSRLLERSARVNIKYVenytngkvtgktgSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAfsqfssdldlVTRKQLDRGARVTellkqkqysplpVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILInfkksydaki
MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDAKI
********STIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYG***********FPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISR*****PLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFK*******
***NASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTN****GKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDAK*
MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDAKI
*KINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDA**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQNSILEKIKNVNEFNADIEDSLTTILINFKKSYDAKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query515 2.2.26 [Sep-21-2011]
A6T472511 ATP synthase subunit alph yes N/A 0.992 1.0 0.743 0.0
A4GAH1511 ATP synthase subunit alph yes N/A 0.992 1.0 0.739 0.0
A9BPU5517 ATP synthase subunit alph yes N/A 0.992 0.988 0.699 0.0
B1Y3S9512 ATP synthase subunit alph yes N/A 0.992 0.998 0.708 0.0
Q223D4517 ATP synthase subunit alph yes N/A 0.992 0.988 0.699 0.0
A1K1S0512 ATP synthase subunit alph yes N/A 0.992 0.998 0.690 0.0
A1TJ39519 ATP synthase subunit alph yes N/A 0.992 0.984 0.706 0.0
C5CNB3517 ATP synthase subunit alph yes N/A 0.992 0.988 0.705 0.0
A2SC68517 ATP synthase subunit alph yes N/A 0.992 0.988 0.697 0.0
A1VIV0517 ATP synthase subunit alph yes N/A 0.992 0.988 0.707 0.0
>sp|A6T472|ATPA_JANMA ATP synthase subunit alpha OS=Janthinobacterium sp. (strain Marseille) GN=atpA PE=3 SV=1 Back     alignment and function desciption
 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/511 (74%), Positives = 446/511 (87%)

Query: 1   MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVF 60
           M++N SEIS +I+ +I+   +T EI NQG VISV DGIC+I+GLS+ MQGEMLEFPGN F
Sbjct: 1   MQLNPSEISELIKSRIQGLGDTAEIRNQGTVISVSDGICRIHGLSDVMQGEMLEFPGNTF 60

Query: 61  GLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGP 120
           GLALNLERDS+GAVILG+YEHI+EGD VKCTGRILEVPIGPELCGRV+NALG PIDGKGP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPIGPELCGRVVNALGQPIDGKGP 120

Query: 121 IKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAI 180
           I TKLT PIEK+APGVI+RQSV +P+QTGIKAID++VPIG+GQRELIIGDRQTGK+++AI
Sbjct: 121 INTKLTTPIEKIAPGVIARQSVDQPMQTGIKAIDAMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 181 DIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY 240
           D IINQK + VTCIYVAIGQK SSIK     LE++GAM YTI+VAATAS+SA+MQF+SAY
Sbjct: 181 DAIINQKGQGVTCIYVAIGQKASSIKNIVRALEQHGAMEYTIVVAATASESAAMQFVSAY 240

Query: 241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLER 300
           SGC +GEYFRD G+DAL+VYDDLSKQAVAYRQ+SLLL+RPPGREA+PGD+FYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 301 SARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLF 360
           +ARVN  YVE +T G V GKTGSLTA+PIIETQAGD+SAFVPTNVISITDGQIFL++SLF
Sbjct: 301 AARVNADYVEAFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLF 360

Query: 361 NSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQ 420
           NSG+RPAINAGISVSRVGGAAQ K IK LS  IRTDLAQYRELAAF+QF+SDLD  TRKQ
Sbjct: 361 NSGVRPAINAGISVSRVGGAAQTKVIKGLSGGIRTDLAQYRELAAFAQFASDLDASTRKQ 420

Query: 421 LDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN 480
           LDRGARVTELLKQ QY+PL  SL+AV LFA+NKG+ DD+E+K++L FES L+ FMK+   
Sbjct: 421 LDRGARVTELLKQAQYAPLSTSLMAVSLFAVNKGYFDDLEVKQVLAFESGLHGFMKSSHA 480

Query: 481 SILEKIKNVNEFNADIEDSLTTILINFKKSY 511
           ++L+KI++  +   D E  L   + +FKKS+
Sbjct: 481 ALLQKIEDTKKLEKDDEAVLAAAIADFKKSF 511
Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 4
>sp|A4GAH1|ATPA_HERAR ATP synthase subunit alpha OS=Herminiimonas arsenicoxydans GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|A9BPU5|ATPA_DELAS ATP synthase subunit alpha OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|B1Y3S9|ATPA_LEPCP ATP synthase subunit alpha OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|Q223D4|ATPA1_RHOFD ATP synthase subunit alpha 1 OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=atpA1 PE=3 SV=1 Back     alignment and function description
>sp|A1K1S0|ATPA_AZOSB ATP synthase subunit alpha OS=Azoarcus sp. (strain BH72) GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|A1TJ39|ATPA_ACIAC ATP synthase subunit alpha OS=Acidovorax citrulli (strain AAC00-1) GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|C5CNB3|ATPA_VARPS ATP synthase subunit alpha OS=Variovorax paradoxus (strain S110) GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|A2SC68|ATPA_METPP ATP synthase subunit alpha OS=Methylibium petroleiphilum (strain PM1) GN=atpA PE=3 SV=1 Back     alignment and function description
>sp|A1VIV0|ATPA1_POLNA ATP synthase subunit alpha 1 OS=Polaromonas naphthalenivorans (strain CJ2) GN=atpA1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
398832326513 proton translocating ATP synthase, F1 al 0.990 0.994 0.750 0.0
152980082511 ATP synthase F0F1 subunit alpha [Janthin 0.992 1.0 0.743 0.0
300313648513 F0F1-type ATP synthase subunit alpha [He 0.990 0.994 0.743 0.0
409408153513 F0F1-type ATP synthase subunit alpha [He 0.990 0.994 0.743 0.0
134096554511 F0F1 ATP synthase subunit alpha [Hermini 0.992 1.0 0.739 0.0
340789573513 ATP synthase subunit alpha [Collimonas f 0.996 1.0 0.752 0.0
399021082513 proton translocating ATP synthase, F1 al 0.990 0.994 0.749 0.0
237747185516 membrane-bound ATP synthase [Oxalobacter 0.988 0.986 0.722 0.0
237749344516 F0F1-type ATP synthase [Oxalobacter form 0.988 0.986 0.721 0.0
329913259511 ATP synthase alpha chain [Oxalobacterace 0.992 1.0 0.727 0.0
>gi|398832326|ref|ZP_10590487.1| proton translocating ATP synthase, F1 alpha subunit [Herbaspirillum sp. YR522] gi|398223423|gb|EJN09767.1| proton translocating ATP synthase, F1 alpha subunit [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/510 (75%), Positives = 452/510 (88%)

Query: 1   MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVF 60
           M++NASEIS +I+ +I+   +T EI NQG VISV DGIC+I+GLS+ MQGEMLEFPGN F
Sbjct: 1   MQLNASEISELIKSRIQGLGDTAEIRNQGTVISVSDGICRIHGLSDVMQGEMLEFPGNTF 60

Query: 61  GLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGP 120
           GLALNLERDS+GAVILG+YEHI+EGD+VKCTGRILEVPIGPELCGRV+NALG PIDGKGP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDVVKCTGRILEVPIGPELCGRVVNALGQPIDGKGP 120

Query: 121 IKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAI 180
           I TKLTAPIEK+APGVI+RQSVS+P+QTG+K+IDS+VP+G+GQRELIIGDRQTGKS++AI
Sbjct: 121 INTKLTAPIEKIAPGVIARQSVSQPMQTGLKSIDSMVPVGRGQRELIIGDRQTGKSAVAI 180

Query: 181 DIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY 240
           D IINQK +N+TCIYVAIGQK SSIK     LE +GAM YTI+VAATAS+SA+MQ++SAY
Sbjct: 181 DAIINQKGQNMTCIYVAIGQKASSIKNVVRALEAHGAMEYTIVVAATASESAAMQYVSAY 240

Query: 241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLER 300
           SGC +GEYFRD G+DAL+VYDDLSKQAVAYRQ+SLLL+RPPGREAYPGD+FYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGQDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 301 SARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLF 360
           +ARVN  YVE +TNG+V G+TGSLTA+PIIETQAGD+SAFVPTNVISITDGQIFL++SLF
Sbjct: 301 AARVNADYVEKFTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLF 360

Query: 361 NSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQ 420
           N+G+RPAINAGISVSRVGGAAQ K IK LS  IRTDLAQYRELAAF+QF+SDLD  TRKQ
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKGLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 421 LDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN 480
           LDRGARVTELLKQ QYSP  +SL+AV LFA+NKGF+DD+E+KKIL FE+ L  F+KT   
Sbjct: 421 LDRGARVTELLKQAQYSPQSISLMAVSLFAVNKGFMDDVEVKKILAFEAGLLNFVKTSHA 480

Query: 481 SILEKIKNVNEFNADIEDSLTTILINFKKS 510
            +L+KI++  + + D E +L   + +FKKS
Sbjct: 481 DLLKKIEDTKQLDKDAEAALAAAIADFKKS 510

Source: Herbaspirillum sp. YR522

Species: Herbaspirillum sp. YR522

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|152980082|ref|YP_001355319.1| ATP synthase F0F1 subunit alpha [Janthinobacterium sp. Marseille] gi|166201668|sp|A6T472.1|ATPA_JANMA RecName: Full=ATP synthase subunit alpha; AltName: Full=ATP synthase F1 sector subunit alpha; AltName: Full=F-ATPase subunit alpha gi|151280159|gb|ABR88569.1| F-type H+-transporting ATPase alpha chain [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|300313648|ref|YP_003777740.1| F0F1-type ATP synthase subunit alpha [Herbaspirillum seropedicae SmR1] gi|124483608|emb|CAM32677.1| F0F1-type ATP synthase, alpha subunit protein [Herbaspirillum seropedicae] gi|300076433|gb|ADJ65832.1| F0F1-type ATP synthase, alpha subunit protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|409408153|ref|ZP_11256597.1| F0F1-type ATP synthase subunit alpha [Herbaspirillum sp. GW103] gi|386432609|gb|EIJ45436.1| F0F1-type ATP synthase subunit alpha [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|134096554|ref|YP_001101629.1| F0F1 ATP synthase subunit alpha [Herminiimonas arsenicoxydans] gi|158513611|sp|A4GAH1.1|ATPA_HERAR RecName: Full=ATP synthase subunit alpha; AltName: Full=ATP synthase F1 sector subunit alpha; AltName: Full=F-ATPase subunit alpha gi|133740457|emb|CAL63508.1| ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|340789573|ref|YP_004755038.1| ATP synthase subunit alpha [Collimonas fungivorans Ter331] gi|340554840|gb|AEK64215.1| ATP synthase alpha chain [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|399021082|ref|ZP_10723201.1| proton translocating ATP synthase, F1 alpha subunit [Herbaspirillum sp. CF444] gi|398093066|gb|EJL83456.1| proton translocating ATP synthase, F1 alpha subunit [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|237747185|ref|ZP_04577665.1| membrane-bound ATP synthase [Oxalobacter formigenes HOxBLS] gi|229378536|gb|EEO28627.1| membrane-bound ATP synthase [Oxalobacter formigenes HOxBLS] Back     alignment and taxonomy information
>gi|237749344|ref|ZP_04579824.1| F0F1-type ATP synthase [Oxalobacter formigenes OXCC13] gi|229380706|gb|EEO30797.1| F0F1-type ATP synthase [Oxalobacter formigenes OXCC13] Back     alignment and taxonomy information
>gi|329913259|ref|ZP_08275910.1| ATP synthase alpha chain [Oxalobacteraceae bacterium IMCC9480] gi|327545403|gb|EGF30620.1| ATP synthase alpha chain [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
TIGR_CMR|CPS_0060513 CPS_0060 "ATP synthase F1, alp 0.990 0.994 0.639 2e-175
UNIPROTKB|P0ABB0513 atpA [Escherichia coli K-12 (t 0.986 0.990 0.624 1.3e-173
UNIPROTKB|Q9KNH3513 atpA "ATP synthase subunit alp 0.986 0.990 0.620 1.1e-172
TIGR_CMR|VC_2766513 VC_2766 "ATP synthase F1, alph 0.986 0.990 0.620 1.1e-172
TIGR_CMR|SO_4749513 SO_4749 "ATP synthase F1, alph 0.984 0.988 0.625 1.8e-172
TIGR_CMR|CBU_1943515 CBU_1943 "ATP synthase F1, alp 0.986 0.986 0.623 1.2e-170
TIGR_CMR|CHY_2547501 CHY_2547 "ATP synthase F1, alp 0.970 0.998 0.579 5.5e-157
TIGR_CMR|DET_0562503 DET_0562 "ATP synthase F1, alp 0.966 0.990 0.578 5.6e-155
TIGR_CMR|GSU_0111503 GSU_0111 "ATP synthase F1, alp 0.974 0.998 0.570 5.6e-155
TIGR_CMR|CJE_0100501 CJE_0100 "ATP synthase F1, alp 0.970 0.998 0.575 2e-152
TIGR_CMR|CPS_0060 CPS_0060 "ATP synthase F1, alpha subunit" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
 Score = 1704 (604.9 bits), Expect = 2.0e-175, P = 2.0e-175
 Identities = 326/510 (63%), Positives = 414/510 (81%)

Query:     1 MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVF 60
             M++N++EI+ +I+ +I+ FN  +E  N+G ++SV DGI +I GL++ MQGEM+E PG+ F
Sbjct:     1 MQLNSTEIAELIKNRIEQFNVVSEARNEGTIVSVTDGIIRINGLADVMQGEMIELPGSRF 60

Query:    61 GLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGP 120
              +ALNL+RDS+GAV++G Y  + EG  VK TGRILEVP+G  L GRV+N LG+PIDGKGP
Sbjct:    61 AIALNLDRDSVGAVVMGPYADLAEGQKVKGTGRILEVPVGRGLLGRVVNTLGEPIDGKGP 120

Query:   121 IKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAI 180
             I+    +P+E +APGVI R+SV EP+QTGIK+ID+++PIG+GQRELIIGDRQ GKS+IA+
Sbjct:   121 IENDGFSPVEVIAPGVIDRKSVDEPVQTGIKSIDAMIPIGRGQRELIIGDRQIGKSAIAL 180

Query:   181 DIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY 240
             D IINQKN  +  IYVAIGQK S++      LE++GA+  TI+V A+AS++A++Q+++ Y
Sbjct:   181 DAIINQKNTGIKSIYVAIGQKASTVANVVRSLEEHGALSNTIVVVASASEAAALQYLAPY 240

Query:   241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLER 300
             +GC++GEYFRD G+DAL+VYDDLSKQAVAYRQISLLL+RPPGREAYPGD+FYLHSRLLER
Sbjct:   241 AGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query:   301 SARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLF 360
             +ARVN  YVE +TNG+V GKTGSLTA+PIIETQAGD+SAFVPTNVISITDGQIFL S LF
Sbjct:   301 AARVNEAYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQSDLF 360

Query:   361 NSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQ 420
             NSGIRPA+NAGISVSRVGGAAQ K IKKL   IR  LAQY ELAAF+QF+SDLD  TR Q
Sbjct:   361 NSGIRPAVNAGISVSRVGGAAQTKIIKKLGGGIRLALAQYAELAAFAQFASDLDDATRAQ 420

Query:   421 LDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN 480
             L+ G RVTEL+KQKQYSPL ++  AV LFA  KGFL+D+ I K+++FE +L+ +M   Q 
Sbjct:   421 LEHGQRVTELMKQKQYSPLSIAETAVSLFAAEKGFLNDVAINKVVDFEEALHAYMSNEQA 480

Query:   481 SILEKIKNVNEFNADIEDSLTTILINFKKS 510
             +++  I    ++N DIE SL T L NFK +
Sbjct:   481 ALMATINEKGDYNKDIEASLKTALENFKST 510
GO:0015986 "ATP synthesis coupled proton transport" evidence=ISS
GO:0045261 "proton-transporting ATP synthase complex, catalytic core F(1)" evidence=ISS
GO:0046933 "proton-transporting ATP synthase activity, rotational mechanism" evidence=ISS
UNIPROTKB|P0ABB0 atpA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNH3 atpA "ATP synthase subunit alpha" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2766 VC_2766 "ATP synthase F1, alpha subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4749 SO_4749 "ATP synthase F1, alpha subunit" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1943 CBU_1943 "ATP synthase F1, alpha subunit" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2547 CHY_2547 "ATP synthase F1, alpha subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0562 DET_0562 "ATP synthase F1, alpha subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0111 GSU_0111 "ATP synthase F1, alpha subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0100 CJE_0100 "ATP synthase F1, alpha subunit" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4GAH1ATPA_HERAR3, ., 6, ., 3, ., 1, 40.73970.99221.0yesN/A
A1V8T3ATPA1_BURMS3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A0K2Y1ATPA_BURCH3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
Q477Z3ATPA_DECAR3, ., 6, ., 3, ., 1, 40.64970.99220.9980yesN/A
Q0K5M5ATPA_CUPNH3, ., 6, ., 3, ., 1, 40.68230.99020.9941yesN/A
Q46VX8ATPA_CUPPJ3, ., 6, ., 3, ., 1, 40.68430.99020.9941yesN/A
B9MBA1ATPA_ACIET3, ., 6, ., 3, ., 1, 40.69880.99220.9845yesN/A
Q39KX8ATPA_BURS33, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
Q7W3A8ATPA_BORPA3, ., 6, ., 3, ., 1, 40.68170.98830.9922yesN/A
A1WF56ATPA_VEREI3, ., 6, ., 3, ., 1, 40.71340.94560.9068yesN/A
Q82XQ0ATPA_NITEU3, ., 6, ., 3, ., 1, 40.67250.99020.9941yesN/A
Q7WEM7ATPA_BORBR3, ., 6, ., 3, ., 1, 40.68170.98830.9922yesN/A
A4SUT2ATPA_POLSQ3, ., 6, ., 3, ., 1, 40.68230.99020.9941yesN/A
Q0AJB2ATPA1_NITEC3, ., 6, ., 3, ., 1, 40.66860.99020.9941yesN/A
Q13SQ0ATPA2_BURXL3, ., 6, ., 3, ., 1, 40.68230.99020.9941yesN/A
A3P0Z2ATPA1_BURP03, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A6T472ATPA_JANMA3, ., 6, ., 3, ., 1, 40.74360.99221.0yesN/A
Q1BRA8ATPA_BURCA3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A4JA33ATPA_BURVG3, ., 6, ., 3, ., 1, 40.67840.99020.9941yesN/A
B2UGV1ATPA_RALPJ3, ., 6, ., 3, ., 1, 40.68620.99020.9941yesN/A
Q62FR7ATPA1_BURMA3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
Q12GQ2ATPA_POLSJ3, ., 6, ., 3, ., 1, 40.70610.97470.9709yesN/A
B4EEY7ATPA_BURCJ3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A3MQJ7ATPA1_BURM73, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A1TJ39ATPA_ACIAC3, ., 6, ., 3, ., 1, 40.70650.99220.9845yesN/A
C5CNB3ATPA_VARPS3, ., 6, ., 3, ., 1, 40.70540.99220.9883yesN/A
Q2YCA5ATPA1_NITMU3, ., 6, ., 3, ., 1, 40.69410.99020.9941yesN/A
A9AJG2ATPA_BURM13, ., 6, ., 3, ., 1, 40.68230.99020.9941yesN/A
A2SC68ATPA_METPP3, ., 6, ., 3, ., 1, 40.69760.99220.9883yesN/A
A9BPU5ATPA_DELAS3, ., 6, ., 3, ., 1, 40.69960.99220.9883yesN/A
Q2STE7ATPA1_BURTA3, ., 6, ., 3, ., 1, 40.67840.99020.9941yesN/A
Q5P4E4ATPA_AROAE3, ., 6, ., 3, ., 1, 40.68490.99220.9980yesN/A
A2S6K0ATPA_BURM93, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A1VIV0ATPA1_POLNA3, ., 6, ., 3, ., 1, 40.70730.99220.9883yesN/A
Q63PH8ATPA1_BURPS3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A3NF42ATPA1_BURP63, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
A1K1S0ATPA_AZOSB3, ., 6, ., 3, ., 1, 40.69080.99220.9980yesN/A
Q0BJL7ATPA_BURCM3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
B1JSV5ATPA_BURCC3, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
B1YQL2ATPA_BURA43, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
Q223D4ATPA1_RHOFD3, ., 6, ., 3, ., 1, 40.69960.99220.9883yesN/A
Q1LHK8ATPA_RALME3, ., 6, ., 3, ., 1, 40.68620.99020.9941yesN/A
A1W2T5ATPA_ACISJ3, ., 6, ., 3, ., 1, 40.69880.99220.9845yesN/A
Q1GXM8ATPA_METFK3, ., 6, ., 3, ., 1, 40.69410.99020.9941yesN/A
B1Y3S9ATPA_LEPCP3, ., 6, ., 3, ., 1, 40.70840.99220.9980yesN/A
B8GRC0ATPA_THISH3, ., 6, ., 3, ., 1, 40.64180.99220.9961yesN/A
Q3JXV6ATPA1_BURP13, ., 6, ., 3, ., 1, 40.68030.99020.9941yesN/A
Q1QSC8ATPA_CHRSD3, ., 6, ., 3, ., 1, 40.66400.98830.9902yesN/A
Q2KU34ATPA_BORA13, ., 6, ., 3, ., 1, 40.67970.98830.9922yesN/A
Q8XU74ATPA_RALSO3, ., 6, ., 3, ., 1, 40.68430.99020.9941yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3.140.979
3rd Layer3.6.30.983

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
PRK09281502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 0.0
COG0056504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 0.0
TIGR00962501 TIGR00962, atpA, proton translocating ATP synthase 0.0
PRK13343502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 0.0
CHL00059485 CHL00059, atpA, ATP synthase CF1 alpha subunit 0.0
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 0.0
TIGR03324497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 0.0
PTZ00185574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisio 1e-119
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 1e-98
PRK07165507 PRK07165, PRK07165, F0F1 ATP synthase subunit alph 1e-96
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III sec 3e-57
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flag 1e-52
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export A 5e-52
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion appara 2e-51
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export A 3e-48
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 1e-47
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export A 5e-47
PRK06936439 PRK06936, PRK06936, type III secretion system ATPa 1e-44
PRK06820440 PRK06820, PRK06820, type III secretion system ATPa 1e-44
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; V 2e-44
PRK09099441 PRK09099, PRK09099, type III secretion system ATPa 2e-43
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; V 8e-42
PRK06315442 PRK06315, PRK06315, type III secretion system ATPa 1e-40
PRK07594433 PRK07594, PRK07594, type III secretion system ATPa 1e-38
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; V 1e-36
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; V 2e-36
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 3e-36
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; V 4e-36
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; V 8e-36
TIGR01041458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 1e-34
COG1156463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 1e-33
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 4e-33
TIGR01039461 TIGR01039, atpD, ATP synthase, F1 beta subunit 6e-32
PRK04196460 PRK04196, PRK04196, V-type ATP synthase subunit B; 8e-31
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; V 2e-30
PRK05922434 PRK05922, PRK05922, type III secretion system ATPa 2e-30
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; V 1e-28
TIGR01040466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 2e-28
TIGR03305449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 5e-28
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subu 1e-27
PRK12597461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 4e-27
COG0055468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 4e-27
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; V 4e-26
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catal 2e-21
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 2e-21
COG1155588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su 1e-20
TIGR01043578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, 7e-20
PRK09280463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 5e-18
pfam00306110 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta 1e-17
PRK04192586 PRK04192, PRK04192, V-type ATP synthase subunit A; 3e-16
PRK02118436 PRK02118, PRK02118, V-type ATP synthase subunit B; 3e-15
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta 3e-14
PRK146981017 PRK14698, PRK14698, V-type ATP synthase subunit A; 1e-13
TIGR01042591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A 2e-13
CHL00060494 CHL00060, atpB, ATP synthase CF1 beta subunit 3e-12
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information 
 Score =  950 bits (2459), Expect = 0.0
 Identities = 324/513 (63%), Positives = 405/513 (78%), Gaps = 11/513 (2%)

Query: 1   MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVF 60
           M+IN  EIS II++QI+NF+   E+   G VISV DGI ++YGL N M GE+LEFPG V+
Sbjct: 1   MQINPEEISAIIKQQIENFDAEAEVEEVGTVISVGDGIARVYGLDNVMAGELLEFPGGVY 60

Query: 61  GLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGP 120
           G+ALNLE D++GAVILG YE I EGD VK TGRILEVP+G  L GRV+N LG PIDGKGP
Sbjct: 61  GIALNLEEDNVGAVILGDYEDIKEGDTVKRTGRILEVPVGEALLGRVVNPLGQPIDGKGP 120

Query: 121 IKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAI 180
           I+   T P+E+ APGVI R+SV EPLQTGIKAID+++PIG+GQRELIIGDRQTGK++IAI
Sbjct: 121 IEATETRPVERKAPGVIDRKSVHEPLQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAI 180

Query: 181 DIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY 240
           D IINQK K+V CIYVAIGQK S++ +    LE++GAM YTI+VAATASD A +Q+++ Y
Sbjct: 181 DTIINQKGKDVICIYVAIGQKASTVAQVVRKLEEHGAMEYTIVVAATASDPAPLQYLAPY 240

Query: 241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLER 300
           +GC +GEYF D+GKDAL+VYDDLSKQAVAYRQ+SLLL+RPPGREAYPGD+FYLHSRLLER
Sbjct: 241 AGCAMGEYFMDNGKDALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 301 SARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLF 360
           +A+++ +              GSLTA+PIIETQAGD+SA++PTNVISITDGQIFL+S LF
Sbjct: 301 AAKLSDE-----------LGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLF 349

Query: 361 NSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQ 420
           N+GIRPAIN GISVSRVGGAAQIK +KK++  +R DLAQYREL AF+QF SDLD  TR Q
Sbjct: 350 NAGIRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELEAFAQFGSDLDEATRAQ 409

Query: 421 LDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN 480
           L+RG R+ ELLKQ QYSPLPV    VIL+A   G+LDD+ ++K+  FE+ L  ++++   
Sbjct: 410 LERGQRLVELLKQPQYSPLPVEEQVVILYAGTNGYLDDVPVEKVRRFEAELLAYLRSNHA 469

Query: 481 SILEKIKNVNEFNADIEDSLTTILINFKKSYDA 513
            +LE+I+   + + +IE  L   +  FKK++ A
Sbjct: 470 DLLEEIRETKDLSDEIEAKLKAAIEEFKKTFAA 502

Length = 502
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|235951 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|215848 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain, C terminal domain Back     alignment and domain information
>gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 515
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 100.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 100.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 100.0
CHL00059485 atpA ATP synthase CF1 alpha subunit 100.0
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 100.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 100.0
PTZ00185574 ATPase alpha subunit; Provisional 100.0
PRK04196460 V-type ATP synthase subunit B; Provisional 100.0
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
CHL00060494 atpB ATP synthase CF1 beta subunit 100.0
PRK09280463 F0F1 ATP synthase subunit beta; Validated 100.0
PRK08972444 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 100.0
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 100.0
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 100.0
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 100.0
PRK08927442 fliI flagellum-specific ATP synthase; Validated 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06820440 type III secretion system ATPase; Validated 100.0
TIGR01043578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 100.0
PRK07594433 type III secretion system ATPase SsaN; Validated 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 100.0
PRK02118436 V-type ATP synthase subunit B; Provisional 100.0
TIGR01042591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 100.0
PRK08472434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK04192586 V-type ATP synthase subunit A; Provisional 100.0
PRK08149428 ATP synthase SpaL; Validated 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 100.0
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
PRK07721438 fliI flagellum-specific ATP synthase; Validated 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 100.0
PRK146981017 V-type ATP synthase subunit A; Provisional 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 100.0
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy 100.0
COG1156463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 100.0
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 100.0
KOG1353|consensus340 100.0
KOG1351|consensus489 100.0
KOG1352|consensus618 100.0
KOG1350|consensus521 100.0
PRK12608380 transcription termination factor Rho; Provisional 100.0
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 100.0
PRK12678672 transcription termination factor Rho; Provisional 100.0
PRK09376416 rho transcription termination factor Rho; Provisio 100.0
TIGR00767415 rho transcription termination factor Rho. Members 100.0
cd01128249 rho_factor Transcription termination factor rho is 100.0
COG1158422 Rho Transcription termination factor [Transcriptio 100.0
PF00306113 ATP-synt_ab_C: ATP synthase alpha/beta chain, C te 99.4
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.17
PF0287469 ATP-synt_ab_N: ATP synthase alpha/beta family, bet 98.55
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 98.48
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 98.43
PRK09302509 circadian clock protein KaiC; Reviewed 98.23
cd01394218 radB RadB. The archaeal protein radB shares simila 98.18
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 98.09
PRK06067234 flagellar accessory protein FlaH; Validated 98.0
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.0
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.98
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.95
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.95
PRK04328249 hypothetical protein; Provisional 97.94
PRK09354349 recA recombinase A; Provisional 97.93
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.91
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.91
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.9
smart00382148 AAA ATPases associated with a variety of cellular 97.89
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.88
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.88
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.87
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.68
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.66
PRK09302 509 circadian clock protein KaiC; Reviewed 97.65
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.65
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.62
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.58
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.52
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.49
PRK09519 790 recA DNA recombination protein RecA; Reviewed 97.49
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.49
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.43
PTZ00035337 Rad51 protein; Provisional 97.35
PLN03186342 DNA repair protein RAD51 homolog; Provisional 97.33
PF00154322 RecA: recA bacterial DNA recombination protein; In 97.31
PRK11823446 DNA repair protein RadA; Provisional 97.23
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 97.21
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.21
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.89
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.88
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.74
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 96.73
PRK05973237 replicative DNA helicase; Provisional 96.66
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.45
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.43
PF13173128 AAA_14: AAA domain 96.37
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.37
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.25
PF05729166 NACHT: NACHT domain 96.15
cd03115173 SRP The signal recognition particle (SRP) mediates 96.09
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.03
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.95
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.83
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.82
PRK08181269 transposase; Validated 95.67
PRK09183259 transposase/IS protein; Provisional 95.6
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.56
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.55
PRK04296190 thymidine kinase; Provisional 95.48
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.48
TIGR02688449 conserved hypothetical protein TIGR02688. Members 95.47
PF00004132 AAA: ATPase family associated with various cellula 95.31
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.27
PRK14974336 cell division protein FtsY; Provisional 95.18
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.16
PRK06526254 transposase; Provisional 95.12
PRK10416318 signal recognition particle-docking protein FtsY; 95.04
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 94.99
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 94.86
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.8
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 94.7
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.67
PRK13342413 recombination factor protein RarA; Reviewed 94.65
PRK12377248 putative replication protein; Provisional 94.53
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.52
TIGR00665434 DnaB replicative DNA helicase. This model describe 94.48
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.47
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.42
TIGR00064272 ftsY signal recognition particle-docking protein F 94.35
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 94.32
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.3
PRK07261171 topology modulation protein; Provisional 94.29
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.26
PRK08727233 hypothetical protein; Validated 94.18
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.12
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.08
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.05
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.05
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.03
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.02
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 93.98
PRK05748448 replicative DNA helicase; Provisional 93.93
PRK10867433 signal recognition particle protein; Provisional 93.92
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 93.92
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 93.92
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 93.9
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.9
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 93.89
cd03269210 ABC_putative_ATPase This subfamily is involved in 93.85
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 93.82
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 93.78
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 93.78
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 93.78
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 93.77
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 93.74
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 93.74
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 93.73
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 93.68
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 93.67
PHA02542473 41 41 helicase; Provisional 93.65
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 93.64
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 93.63
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 93.63
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.61
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 93.61
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 93.61
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 93.6
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.57
PF1324576 AAA_19: Part of AAA domain 93.57
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 93.55
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 93.53
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 93.52
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 93.52
PRK06921266 hypothetical protein; Provisional 93.5
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 93.49
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.48
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 93.48
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 93.43
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 93.42
PRK08084235 DNA replication initiation factor; Provisional 93.41
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.39
cd03216163 ABC_Carb_Monos_I This family represents the domain 93.38
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 93.37
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 93.36
PRK09165497 replicative DNA helicase; Provisional 93.36
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 93.34
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 93.34
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 93.31
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 93.28
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 93.28
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 93.28
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 93.27
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 93.27
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 93.27
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 93.24
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 93.23
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.23
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 93.21
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 93.2
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 93.2
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.2
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 93.2
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 93.15
cd03215182 ABC_Carb_Monos_II This family represents domain II 93.15
PRK09435332 membrane ATPase/protein kinase; Provisional 93.13
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 93.11
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 93.1
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 93.09
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 93.08
COG4619223 ABC-type uncharacterized transport system, ATPase 93.08
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 93.08
cd03246173 ABCC_Protease_Secretion This family represents the 93.05
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 93.04
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 93.04
PRK08506472 replicative DNA helicase; Provisional 93.03
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.02
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.01
PRK08118167 topology modulation protein; Reviewed 93.01
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 93.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 92.99
PRK06893229 DNA replication initiation factor; Validated 92.97
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 92.96
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 92.96
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 92.95
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 92.95
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 92.94
TIGR00959428 ffh signal recognition particle protein. This mode 92.93
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 92.93
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 92.93
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 92.93
PRK14241258 phosphate transporter ATP-binding protein; Provisi 92.93
PRK10908222 cell division protein FtsE; Provisional 92.91
PRK14240250 phosphate transporter ATP-binding protein; Provisi 92.88
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 92.88
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 92.86
PRK14242253 phosphate transporter ATP-binding protein; Provisi 92.86
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 92.85
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 92.83
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 92.82
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 92.82
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamid 92.82
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 92.81
PRK14239252 phosphate transporter ATP-binding protein; Provisi 92.81
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.8
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 92.8
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 92.8
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 92.78
PRK08939306 primosomal protein DnaI; Reviewed 92.78
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 92.76
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 92.74
COG1126240 GlnQ ABC-type polar amino acid transport system, A 92.74
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 92.73
CHL00181287 cbbX CbbX; Provisional 92.73
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 92.72
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 92.72
PRK10253265 iron-enterobactin transporter ATP-binding protein; 92.69
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 92.69
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 92.68
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 92.67
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 92.66
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 92.65
PRK14237267 phosphate transporter ATP-binding protein; Provisi 92.64
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 92.63
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 92.63
PRK09087226 hypothetical protein; Validated 92.63
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 92.62
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 92.61
KOG0057|consensus591 92.59
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 92.58
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.58
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 92.58
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 92.58
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 92.57
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 92.57
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 92.57
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 92.51
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.5
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 92.5
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 92.49
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 92.49
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 92.48
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 92.47
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 92.47
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 92.46
CHL00195489 ycf46 Ycf46; Provisional 92.42
PF14516331 AAA_35: AAA-like domain 92.42
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 92.39
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 92.39
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 92.38
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 92.37
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 92.37
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 92.36
PRK14238271 phosphate transporter ATP-binding protein; Provisi 92.36
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 92.36
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 92.34
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 92.34
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 92.33
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 92.33
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 92.32
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 92.31
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 92.31
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 92.28
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 92.27
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 92.25
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 92.23
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 92.22
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 92.21
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 92.21
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 92.2
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 92.2
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 92.2
PRK09984262 phosphonate/organophosphate ester transporter subu 92.17
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 92.17
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 92.16
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 92.16
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.15
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 92.14
PRK14243264 phosphate transporter ATP-binding protein; Provisi 92.13
PRK10619257 histidine/lysine/arginine/ornithine transporter su 92.12
PRK13546264 teichoic acids export protein ATP-binding subunit; 92.12
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 92.1
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 92.08
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 92.08
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 92.07
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 92.07
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 92.05
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 92.03
TIGR00362405 DnaA chromosomal replication initiator protein Dna 92.03
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 92.03
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 92.01
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 92.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 92.0
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 91.99
PRK14235267 phosphate transporter ATP-binding protein; Provisi 91.98
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 91.98
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 91.97
PRK05642234 DNA replication initiation factor; Validated 91.96
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 91.94
PRK05595444 replicative DNA helicase; Provisional 91.94
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 91.94
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 91.93
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 91.93
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 91.9
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 91.89
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 91.89
COG0552340 FtsY Signal recognition particle GTPase [Intracell 91.86
PRK08903227 DnaA regulatory inactivator Hda; Validated 91.85
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 91.85
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 91.85
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 91.84
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 91.83
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 91.82
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.82
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 91.79
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 91.78
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 91.77
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 91.76
PRK14087450 dnaA chromosomal replication initiation protein; P 91.76
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 91.75
COG3842352 PotA ABC-type spermidine/putrescine transport syst 91.74
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 91.72
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 91.71
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 91.69
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 91.68
PF1355562 AAA_29: P-loop containing region of AAA domain 91.67
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 91.66
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 91.66
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 91.64
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 91.64
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 91.63
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.63
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 91.63
PRK13341 725 recombination factor protein RarA/unknown domain f 91.63
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 91.62
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 91.62
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 91.61
cd03234226 ABCG_White The White subfamily represents ABC tran 91.6
KOG2028|consensus554 91.6
cd03299235 ABC_ModC_like Archeal protein closely related to M 91.59
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 91.59
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 91.55
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 91.55
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 91.53
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.51
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 91.49
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 91.47
PRK09580248 sufC cysteine desulfurase ATPase component; Review 91.46
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 91.45
PRK14236272 phosphate transporter ATP-binding protein; Provisi 91.43
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 91.43
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 91.4
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 91.37
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 91.36
COG4172534 ABC-type uncharacterized transport system, duplica 91.34
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 91.34
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 91.34
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 91.33
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 91.33
PRK09473330 oppD oligopeptide transporter ATP-binding componen 91.32
PF02283167 CobU: Cobinamide kinase / cobinamide phosphate gua 91.3
KOG0651|consensus388 91.3
PRK08760476 replicative DNA helicase; Provisional 91.29
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 91.29
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 91.26
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 91.26
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 91.26
PRK07004460 replicative DNA helicase; Provisional 91.25
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 91.23
COG0411250 LivG ABC-type branched-chain amino acid transport 91.22
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 91.19
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 91.19
PRK03695248 vitamin B12-transporter ATPase; Provisional 91.17
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 91.12
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 91.11
PRK03992389 proteasome-activating nucleotidase; Provisional 91.07
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 91.05
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 91.01
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 91.01
KOG0743|consensus457 91.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 90.95
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 90.94
PRK12339197 2-phosphoglycerate kinase; Provisional 90.9
PRK05541176 adenylylsulfate kinase; Provisional 90.89
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 90.89
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 90.87
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 90.81
COG4525259 TauB ABC-type taurine transport system, ATPase com 90.75
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 90.75
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 90.75
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 90.74
COG1484254 DnaC DNA replication protein [DNA replication, rec 90.73
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 90.71
PRK13536340 nodulation factor exporter subunit NodI; Provision 90.67
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 90.67
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 90.66
PHA02544316 44 clamp loader, small subunit; Provisional 90.61
COG1127263 Ttg2A ABC-type transport system involved in resist 90.57
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 90.55
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 90.51
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 90.49
COG4181228 Predicted ABC-type transport system involved in ly 90.48
COG4167267 SapF ABC-type antimicrobial peptide transport syst 90.45
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 90.45
PRK07773 886 replicative DNA helicase; Validated 90.44
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 90.43
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 90.43
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 90.35
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 90.35
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 90.26
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 90.22
PRK11607377 potG putrescine transporter ATP-binding subunit; P 90.19
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 90.15
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 90.14
PRK04841 903 transcriptional regulator MalT; Provisional 90.08
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 90.08
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.07
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 89.96
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 89.96
PHA00729226 NTP-binding motif containing protein 89.88
COG4987573 CydC ABC-type transport system involved in cytochr 89.86
PLN03073 718 ABC transporter F family; Provisional 89.84
KOG0727|consensus408 89.77
PRK13537306 nodulation ABC transporter NodI; Provisional 89.74
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 89.73
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 89.71
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 89.68
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 89.67
PRK00149450 dnaA chromosomal replication initiation protein; R 89.65
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 89.58
PRK11147 635 ABC transporter ATPase component; Reviewed 89.54
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 89.52
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 89.51
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 89.45
PRK14531183 adenylate kinase; Provisional 89.44
COG0488530 Uup ATPase components of ABC transporters with dup 89.43
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 89.43
cd00881189 GTP_translation_factor GTP translation factor fami 89.43
PRK06620214 hypothetical protein; Validated 89.41
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 89.41
PRK15064 530 ABC transporter ATP-binding protein; Provisional 89.4
KOG0060|consensus659 89.35
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 89.27
cd01878204 HflX HflX subfamily. A distinct conserved domain w 89.24
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 89.18
COG4136213 ABC-type uncharacterized transport system, ATPase 89.16
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.6e-150  Score=1156.10  Aligned_cols=502  Identities=63%  Similarity=1.021  Sum_probs=497.2

Q ss_pred             CCCChHHHHHHHHHHHHcccCccCccceeEEEEEECcEEEEEecCCCcccCEEEEcCCceEEEEEEeCCeEEEEEeCCCC
Q psy2894           1 MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYE   80 (515)
Q Consensus         1 ~~~~~~~~~~~l~~~i~~~~~~~~~~~~G~V~~I~g~iv~v~Gl~~~~~gElv~~~~~~~g~V~~l~~~~v~~~~~~~~~   80 (515)
                      |.++++|+++.|++++++|+......+.|+|++|.|++++|+||.+++.||+++|+++++|+++++++|.|+++++|+..
T Consensus         1 ~~~~~~ei~~~i~~~i~~~~~~~~~~~~g~V~sv~DgIa~v~Gl~~~~~~E~~ef~~~v~G~alnle~d~VG~vi~g~~~   80 (504)
T COG0056           1 MQLNPTEISSLIKQQIENFDVEAEVKEVGTVISVGDGIARVSGLENVMAGELVEFPGGVKGMALNLEEDSVGAVILGDYS   80 (504)
T ss_pred             CCCcHHHHHHHHHHHHHhcchhhhhhccceEEEEecceEEEecCchhhcCceEEecCCcEEEEEeccccceeEEEecCCc
Confidence            78999999999999999999988899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCEEEEcCCccccccCccccceEecccCCcCCCCCCCCcccccccccCCCCccccCCCcccccccccccccccccc
Q psy2894          81 HITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIG  160 (515)
Q Consensus        81 gi~~G~~V~~tg~~~~vpvg~~lLGrViD~lG~pid~~~~~~~~~~~~i~~~~p~~~~R~~~~epl~TGik~ID~l~pig  160 (515)
                      .|++||+|++||+.++||||++|+|||+|++|+|+||++++....+.|++..+|++++|++++|||+|||++||+|+|||
T Consensus        81 ~i~eG~~v~~Tg~i~~Vpvg~~llGRVVn~lG~pidgkg~i~~~~~~~~e~~Apgv~~RksV~ePlqTGikaIDamiPIG  160 (504)
T COG0056          81 DIKEGDEVKRTGRILEVPVGEELLGRVVDALGNPIDGKGPIDATKTRPVEKKAPGVMDRKSVNEPLQTGIKAIDALIPIG  160 (504)
T ss_pred             cccCCcEEEeeCceEEEecchhhcceeecCCCCccCCCCCccccccCccccccCceecccccCchhhhhhHHHhhhcccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcceeeecCCCCCccHHHHHHHHHhcCCCeEEEEEEecCChHHHHHHHHHHhhcCCCCcEEEEEeCCCCCHHhhHHHHh
Q psy2894         161 KGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY  240 (515)
Q Consensus       161 rGqr~~I~g~~g~GKt~l~~~~i~~~~~~~~~~V~~~iGer~~ev~~~~~~l~~~~~~~~t~vv~~t~~~~~~~r~~a~~  240 (515)
                      ||||++|+||+|||||++|+|+|+||++.|++||||+|||+.++|++++++|+++|+|+||+||+|++++|+.+||+|||
T Consensus       161 RGQRELIIGDRQTGKTaIAidtIiNQk~~~v~CIYVAIGQK~stva~vv~tL~e~gAmdyTiVV~AsASd~a~lqYLaPy  240 (504)
T COG0056         161 RGQRELIIGDRQTGKTAIAIDTIINQKGSGVKCIYVAIGQKRSTVANVVRTLEEHGAMDYTIVVAASASDSAPLQYLAPY  240 (504)
T ss_pred             CCceEEEeccCcCCcchhhHHHHHhcccCCcEEEEEEcccchHHHHHHHHHHHHcCCccceEEEEecCCcchhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhHHHHHHcCCcEEEEEechhHHHHHHHHHHHhcCCCCCCCCCCCchhhhhhHHHHHhhccchhhhhcccCCcccCC
Q psy2894         241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGK  320 (515)
Q Consensus       241 ~a~~iAE~frd~G~~Vlli~Dsltr~a~A~reisl~l~~pp~~~gypg~vf~~~~rl~ERag~~~~~~~~~~~~~~~~g~  320 (515)
                      +|||||||||++|+|||+||||||+||.|||||||+++||||||+|||||||+||||||||+|++++          .| 
T Consensus       241 ~g~a~aE~f~~~G~dvLIVyDDLsKhA~AYReiSLLlrRPPGREAyPGDVFYlHSrLLERAakl~~e----------~g-  309 (504)
T COG0056         241 AGCAMAEYFRDNGKDVLIVYDDLSKHAVAYREISLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDE----------LG-  309 (504)
T ss_pred             hhhHHHHHHHhcCCeEEEEecCchHHHHHHHHHHHHhcCCCCccCCCCceeehhHHHHHHHHhhccc----------cC-
Confidence            9999999999999999999999999999999999999999999999999999999999999999987          77 


Q ss_pred             CCceeeeeEEeecCCCCCCcccccccccCCeEEEecchhhcCCCcCccccCCCccccccccchHHHHHHHHHHHHHHHhh
Q psy2894         321 TGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQY  400 (515)
Q Consensus       321 ~GSiT~l~~v~~~~~D~s~pI~~~~~si~Dg~i~L~r~La~~g~~PAIdv~~S~SRv~~~~~~~~~~~~a~~lr~~la~y  400 (515)
                      |||||++|+++|++||+|+|||||++|||||||||+.+||++|++||||++.||||+|+++|.+.++++|+.+|+.|+||
T Consensus       310 ~GSiTALPIIETqagDvSAyIpTNVISITDGQIfl~t~LFn~G~rPAInvGlSVSRvGssAQ~kamkkvag~lrl~laqY  389 (504)
T COG0056         310 GGSITALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGIRPAINVGLSVSRVGSAAQIKAMKKVAGSLRLILAQY  389 (504)
T ss_pred             CCceEeeeeEEeccCceeeecccceEEecCCcEEeehhhhhcCCCccccCCceeeccchHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccCCCHHHHHHHHhhHHHhhcccccccCCCCHHHHHHHHHHHhcCcccccchhHHHHHHHHHHHHHHhhch
Q psy2894         401 RELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN  480 (515)
Q Consensus       401 ~el~~~~~~g~~ld~~~~~~l~~~~~i~~~L~Q~~~~~~~~~~~~~~l~~~~~G~ld~v~~~~v~~f~~~l~~~l~~~~~  480 (515)
                      +|++.|++||++||+++++.+++|+++.++|+|++|+|+|+++|+..+|++.|||||++|++++.+|+..++.+++..++
T Consensus       390 rel~afsqf~sdLd~~T~~~l~~G~r~~ellkQ~~~~p~sv~~qv~ilya~~~G~ld~v~v~~v~~fe~~l~~~~~~~~~  469 (504)
T COG0056         390 RELEAFSQFGSDLDKATRKQLERGKRLTELLKQPQYSPLSVEEQVLILYAGTNGYLDDVPVEKVADFEKELLAYLRSDHK  469 (504)
T ss_pred             HHHHHHHhhcchhCHHHHHHHHccHHHHHHhcCCCCCCccHHHHHHHHHHHhcCcccCCcHHHHHHHHHHHHHHHHhhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhccCCCHHHHHHHHHHHHHHHhhhhh
Q psy2894         481 SILEKIKNVNEFNADIEDSLTTILINFKKSYDA  513 (515)
Q Consensus       481 ei~~~i~~~~~l~~e~~~~l~~~~~~f~~~f~~  513 (515)
                      ++++.|.++++|+++++++|+.++++|+++|..
T Consensus       470 ~~~~~I~~~~~l~~~~e~~l~~~i~~f~~~f~~  502 (504)
T COG0056         470 ELLEEIRTTKELDDEIEAKLKAAIKEFKKTFAL  502 (504)
T ss_pred             HHHHHHHhhcCCCHHHHHHHHHHHHHHHHhccc
Confidence            999999999999999999999999999999965

>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>KOG1353|consensus Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>PF00306 ATP-synt_ab_C: ATP synthase alpha/beta chain, C terminal domain; InterPro: IPR000793 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
3oaa_A513 Structure Of The E.Coli F1-Atp Synthase Inhibited B 0.0
2qe7_A502 Crystal Structure Of The F1-Atpase From The Thermoa 1e-171
1sky_B502 Crystal Structure Of The Nucleotide Free Alpha3beta 1e-169
2r9v_A515 Crystal Structure Of Atp Synthase Subunit Alpha (Tm 1e-166
2w6e_A553 Low Resolution Structures Of Bovine Mitochondrial F 1e-163
2jiz_A510 The Structure Of F1-Atpase Inhibited By Resveratrol 1e-163
1cow_A510 Bovine Mitochondrial F1-Atpase Complexed With Aurov 1e-163
1bmf_A510 Bovine Mitochondrial F1-Atpase Length = 510 1e-163
2f43_A510 Rat Liver F1-atpase Length = 510 1e-162
1mab_A510 Rat Liver F1-Atpase Length = 510 1e-162
2xok_A545 Refined Structure Of Yeast F1c10 Atpase Complex To 1e-159
2hld_A510 Crystal Structure Of Yeast Mitochondrial F1-Atpase 1e-159
2xnd_A492 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 1e-159
3oee_A510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-158
3ofn_A510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-158
4b2q_B486 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-154
4b2q_A485 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-154
1ohh_B487 Bovine Mitochondrial F1-Atpase Complexed With The I 1e-152
1fx0_A507 Crystal Structure Of The Chloroplast F1-Atpase From 1e-152
1mab_B479 Rat Liver F1-Atpase Length = 479 2e-26
2xok_D511 Refined Structure Of Yeast F1c10 Atpase Complex To 5e-26
3fks_D484 Yeast F1 Atpase In The Absence Of Bound Nucleotides 6e-26
2hld_D478 Crystal Structure Of Yeast Mitochondrial F1-Atpase 6e-26
4b2q_D470 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 6e-26
3oeh_D484 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 6e-26
4b2q_E473 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 7e-26
2dpy_A438 Crystal Structure Of The Flagellar Type Iii Atpase 7e-26
1nbm_E480 The Structure Of Bovine F1-Atpase Covalently Inhibi 2e-25
2xnd_D467 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 3e-25
1nbm_D480 The Structure Of Bovine F1-Atpase Covalently Inhibi 3e-25
1cow_D482 Bovine Mitochondrial F1-Atpase Complexed With Aurov 3e-25
4asu_D480 F1-Atpase In Which All Three Catalytic Sites Contai 3e-25
2w6e_D528 Low Resolution Structures Of Bovine Mitochondrial F 6e-25
2qe7_D462 Crystal Structure Of The F1-Atpase From The Thermoa 7e-25
1sky_E473 Crystal Structure Of The Nucleotide Free Alpha3beta 2e-23
2obl_A347 Structural And Biochemical Analysis Of A Prototypic 2e-23
3tiv_A460 Crystal Structure Of Subunit B Mutant N157a Of The 4e-23
3ssa_A460 Crystal Structure Of Subunit B Mutant N157t Of The 4e-23
2rkw_A469 Intermediate Position Of Atp On Its Trail To The Bi 4e-23
2c61_A469 Crystal Structure Of The Non-Catalytic B Subunit Of 4e-23
3tgw_A460 Crystal Structure Of Subunit B Mutant H156a Of The 5e-23
3gqb_B464 Crystal Structure Of The A3b3 Complex From V-atpase 1e-22
3vr6_D465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 1e-22
3a5c_D478 Inter-Subunit Interaction And Quaternary Rearrangem 1e-22
3oaa_D459 Structure Of The E.Coli F1-Atp Synthase Inhibited B 2e-22
3vr2_D465 Crystal Structure Of Nucleotide-free A3b3 Complex F 2e-21
3vr6_A600 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 1e-19
1fx0_B498 Crystal Structure Of The Chloroplast F1-Atpase From 2e-19
3vr2_A600 Crystal Structure Of Nucleotide-free A3b3 Complex F 8e-18
3sdz_A588 Structural Characterization Of The Subunit A Mutant 1e-17
3qia_A588 Crystal Structure Of P-Loop G237a Mutant Of Subunit 2e-17
3mfy_A588 Structural Characterization Of The Subunit A Mutant 2e-17
1vdz_A588 Crystal Structure Of A-Type Atpase Catalytic Subuni 2e-17
3i4l_A588 Structural Characterization For The Nucleotide Bind 2e-17
3se0_A588 Structural Characterization Of The Subunit A Mutant 2e-17
3nd9_A588 Structural Characterization For The Nucleotide Bind 2e-17
3m4y_A588 Structural Characterization Of The Subunit A Mutant 3e-17
3ikj_A588 Structural Characterization For The Nucleotide Bind 3e-17
3nd8_A588 Structural Characterization For The Nucleotide Bind 5e-17
3qg1_A588 Crystal Structure Of P-Loop G239a Mutant Of Subunit 9e-17
3qjy_A588 Crystal Structure Of P-Loop G234a Mutant Of Subunit 1e-16
3gqb_A578 Crystal Structure Of The A3b3 Complex From V-atpase 5e-16
3a5c_A578 Inter-Subunit Interaction And Quaternary Rearrangem 6e-16
>pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 Back     alignment and structure 
Iteration: 1

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/510 (62%), Positives = 416/510 (81%)
Query: 1   MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVF 60
           M++N++EIS +I+++I  FN  +E +N+G ++SV DG+ +I+GL++ MQGEM+  PGN +
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60
Query: 61  GLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGP 120
            +ALNLERDS+GAV++G Y  + EG  VKCTGRILEVP+G  L GRV+N LG PIDGKGP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAPIDGKGP 120
Query: 121 IKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAI 180
           +     + +E +APGVI RQSV +P+QTG KA+DS++PIG+GQRELIIGDRQTGK+++AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180
Query: 181 DIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY 240
           D IINQ++  + CIYVAIGQK S+I      LE++GA+  TI+V ATAS+SA++Q+++ Y
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240
Query: 241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLER 300
           +GC +GEYFRD G+DAL++YDDLSKQAVAYRQISLLL+RPPGREA+PGD+FYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300
Query: 301 SARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLF 360
           +ARVN +YVE +T G+V GKTGSLTA+PIIETQAGD+SAFVPTNVISITDGQIFL+++LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360
Query: 361 NSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQ 420
           N+GIRPA+N GISVSRVGGAAQ K +KKLS  IRT LAQYRELAAFSQF+SDLD  TRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420
Query: 421 LDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN 480
           LD G +VTELLKQKQY+P+ V+  +++LFA  +G+L D+E+ KI +FE++L  ++     
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480
Query: 481 SILEKIKNVNEFNADIEDSLTTILINFKKS 510
            ++++I     +N +IE  L  IL +FK +
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKAT 510
>pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 Back     alignment and structure
>pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 Back     alignment and structure
>pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 Back     alignment and structure
>pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 Back     alignment and structure
>pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 Back     alignment and structure
>pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 Back     alignment and structure
>pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 Back     alignment and structure
>pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 Back     alignment and structure
>pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 Back     alignment and structure
>pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 Back     alignment and structure
>pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 Back     alignment and structure
>pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 Back     alignment and structure
>pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 Back     alignment and structure
>pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 Back     alignment and structure
>pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 Back     alignment and structure
>pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 Back     alignment and structure
>pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 Back     alignment and structure
>pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 Back     alignment and structure
>pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 Back     alignment and structure
>pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 Back     alignment and structure
>pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 Back     alignment and structure
>pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 Back     alignment and structure
>pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 Back     alignment and structure
>pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 Back     alignment and structure
>pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 Back     alignment and structure
>pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 Back     alignment and structure
>pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 Back     alignment and structure
>pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 Back     alignment and structure
>pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 Back     alignment and structure
>pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 Back     alignment and structure
>pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 Back     alignment and structure
>pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 Back     alignment and structure
>pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 Back     alignment and structure
>pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 Back     alignment and structure
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure
>pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 Back     alignment and structure
>pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 Back     alignment and structure
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure
>pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 Back     alignment and structure
>pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 Back     alignment and structure
>pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 Back     alignment and structure
>pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 Back     alignment and structure
>pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 Back     alignment and structure
>pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 Back     alignment and structure
>pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 0.0
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 0.0
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 0.0
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 0.0
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 0.0
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 6e-70
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 8e-69
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 5e-57
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 6e-56
3gqb_A578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 5e-39
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 7e-39
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 9e-22
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 6e-19
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
 Score =  900 bits (2327), Expect = 0.0
 Identities = 317/511 (62%), Positives = 416/511 (81%)

Query: 1   MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVF 60
           M++N++EIS +I+++I  FN  +E +N+G ++SV DG+ +I+GL++ MQGEM+  PGN +
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 61  GLALNLERDSIGAVILGKYEHITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGP 120
            +ALNLERDS+GAV++G Y  + EG  VKCTGRILEVP+G  L GRV+N LG PIDGKGP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAPIDGKGP 120

Query: 121 IKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTGKSSIAI 180
           +     + +E +APGVI RQSV +P+QTG KA+DS++PIG+GQRELIIGDRQTGK+++AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 181 DIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY 240
           D IINQ++  + CIYVAIGQK S+I      LE++GA+  TI+V ATAS+SA++Q+++ Y
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLER 300
           +GC +GEYFRD G+DAL++YDDLSKQAVAYRQISLLL+RPPGREA+PGD+FYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 301 SARVNIKYVENYTNGKVTGKTGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLF 360
           +ARVN +YVE +T G+V GKTGSLTA+PIIETQAGD+SAFVPTNVISITDGQIFL+++LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 361 NSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQYRELAAFSQFSSDLDLVTRKQ 420
           N+GIRPA+N GISVSRVGGAAQ K +KKLS  IRT LAQYRELAAFSQF+SDLD  TRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 421 LDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN 480
           LD G +VTELLKQKQY+P+ V+  +++LFA  +G+L D+E+ KI +FE++L  ++     
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 481 SILEKIKNVNEFNADIEDSLTTILINFKKSY 511
            ++++I     +N +IE  L  IL +FK + 
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQ 511
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 100.0
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 100.0
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 100.0
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 100.0
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 100.0
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 100.0
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 100.0
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 100.0
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 100.0
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 100.0
3vr4_A600 V-type sodium ATPase catalytic subunit A; V-ATPase 100.0
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 100.0
3gqb_A578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 100.0
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 100.0
3l0o_A427 Transcription termination factor RHO; helicase, RH 100.0
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 100.0
3ice_A422 Transcription termination factor RHO; transcriptio 100.0
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 100.0
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.97
3io5_A333 Recombination and repair protein; storage dimer, i 97.91
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.7
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.66
2z43_A324 DNA repair and recombination protein RADA; archaea 97.6
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.58
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.58
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.57
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.52
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.51
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.44
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.42
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.33
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.29
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.13
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.08
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.06
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.04
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.97
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.88
3bs4_A260 Uncharacterized protein PH0321; structural genomic 96.8
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.78
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.7
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.67
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.6
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.58
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.46
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.38
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.26
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.06
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.99
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.85
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.76
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.65
3bos_A242 Putative DNA replication factor; P-loop containing 95.56
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.36
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.23
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.06
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.01
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.8
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.77
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.74
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 94.49
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.46
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.27
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.14
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.14
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.97
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.94
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.94
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.87
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.83
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 93.82
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.79
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.75
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.65
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.6
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 93.58
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.57
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.44
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.25
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.2
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 93.14
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.1
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.02
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.99
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 92.97
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 92.91
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.86
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 92.86
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 92.81
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.78
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.77
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.77
3pvs_A447 Replication-associated recombination protein A; ma 92.76
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.73
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 92.72
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.7
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.7
2ghi_A260 Transport protein; multidrug resistance protein, M 92.7
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.68
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 92.62
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.61
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.57
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.56
1g6h_A257 High-affinity branched-chain amino acid transport 92.52
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.49
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.45
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.44
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.41
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.36
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.33
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.33
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.26
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.15
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.11
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.06
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 92.05
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.02
1vma_A306 Cell division protein FTSY; TM0570, structural gen 91.99
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 91.94
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.92
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 91.9
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.86
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 91.84
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.8
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 91.79
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.75
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.72
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.71
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.62
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 91.57
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 91.54
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 91.52
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 91.47
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.47
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 91.43
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 91.42
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 91.41
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 91.35
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.35
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 91.33
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 91.27
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 91.26
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 91.25
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 91.17
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 91.07
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 90.98
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 90.97
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 90.96
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 90.95
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 90.92
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 90.87
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 90.85
3vaa_A199 Shikimate kinase, SK; structural genomics, center 90.79
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 90.78
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 90.75
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 90.74
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.68
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.56
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.5
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 90.48
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.47
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 90.43
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 90.38
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 90.34
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 90.3
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 90.27
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.12
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.08
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 90.03
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 89.84
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.83
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 89.8
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 89.79
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.74
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 89.71
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 89.69
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.66
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 89.64
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 89.61
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 89.61
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 89.52
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 89.49
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.46
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 89.34
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 89.24
3kta_A182 Chromosome segregation protein SMC; structural mai 89.11
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 89.08
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 89.02
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.01
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 88.91
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 88.89
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 88.89
2xxa_A433 Signal recognition particle protein; protein trans 88.87
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 88.81
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.75
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 88.64
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 88.62
2chq_A319 Replication factor C small subunit; DNA-binding pr 88.56
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 88.49
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 88.33
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.32
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 88.31
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 88.29
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.26
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 88.18
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 88.07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 87.97
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.93
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 87.85
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 87.78
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 87.59
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 87.58
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 87.51
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 87.4
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 87.38
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 87.37
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 87.33
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 87.28
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 87.24
2oap_1511 GSPE-2, type II secretion system protein; hexameri 87.23
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 87.12
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 87.01
2qgz_A308 Helicase loader, putative primosome component; str 86.95
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 86.94
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 86.88
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 86.83
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 86.82
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 86.73
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 86.65
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 86.64
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 86.63
2og2_A359 Putative signal recognition particle receptor; nuc 86.48
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 86.47
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 86.45
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 86.33
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 86.27
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 86.26
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 86.25
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 86.2
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 86.15
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 86.12
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 86.07
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 86.01
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.99
2ewv_A372 Twitching motility protein PILT; pilus retraction 85.98
2wji_A165 Ferrous iron transport protein B homolog; membrane 85.97
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 85.97
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 85.95
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.93
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 85.92
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 85.87
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 85.82
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 85.79
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 85.77
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 85.76
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 85.72
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 85.7
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 85.68
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 85.68
2vli_A183 Antibiotic resistance protein; transferase, tunica 85.63
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 85.61
2r62_A268 Cell division protease FTSH homolog; ATPase domain 85.57
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 85.52
2r44_A331 Uncharacterized protein; putative ATPase, structur 85.51
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 85.48
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 85.48
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 85.42
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 85.41
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 85.35
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 85.3
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 85.23
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 85.23
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 85.21
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 85.19
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 85.17
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 85.15
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 85.14
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 85.14
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 85.05
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 85.01
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 85.0
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 84.98
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 84.98
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 84.95
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 84.94
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 84.93
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 84.83
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 84.81
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 84.81
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 84.78
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 84.78
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 84.71
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 84.67
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 84.63
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 84.62
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 84.52
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.48
2ged_A193 SR-beta, signal recognition particle receptor beta 84.48
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 84.46
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 84.42
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 84.38
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 84.37
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 84.35
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 84.27
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 84.27
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 84.17
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 84.13
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 83.97
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 83.91
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 83.87
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 83.87
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 83.84
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.74
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 83.7
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 83.7
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 83.69
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 83.67
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 83.6
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 83.6
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 83.55
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 83.53
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 83.51
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 83.5
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 83.49
1via_A175 Shikimate kinase; structural genomics, transferase 83.44
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 83.41
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 83.39
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 83.38
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 83.31
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 83.29
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 83.19
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 83.19
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 83.18
1ojl_A304 Transcriptional regulatory protein ZRAR; response 83.14
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 83.14
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 83.13
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 83.08
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 83.03
3lxx_A239 GTPase IMAP family member 4; structural genomics c 82.97
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 82.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 82.85
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 82.82
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 82.81
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 82.81
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 82.8
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 82.79
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 82.79
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 82.78
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 82.74
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 82.73
2fna_A357 Conserved hypothetical protein; structural genomic 82.72
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 82.64
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 82.61
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 82.58
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 82.54
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 82.51
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 82.51
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 82.49
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 82.43
3co5_A143 Putative two-component system transcriptional RES 82.37
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 82.24
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 82.23
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 82.23
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 82.21
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 82.19
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 82.09
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 82.05
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 81.98
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 81.96
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 81.93
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 81.91
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 81.83
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 81.83
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 81.78
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 81.72
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 81.72
1nrj_B218 SR-beta, signal recognition particle receptor beta 81.63
1p9r_A418 General secretion pathway protein E; bacterial typ 81.48
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 81.33
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 81.33
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 81.27
3t1o_A198 Gliding protein MGLA; G domain containing protein, 81.24
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 81.2
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 81.16
3lxw_A247 GTPase IMAP family member 1; immunity, structural 81.12
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 81.06
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 81.05
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 81.01
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 80.97
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 80.91
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 80.85
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 80.85
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 80.76
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 80.65
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 80.64
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 80.58
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 80.57
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 80.57
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 80.57
2fh5_B214 SR-beta, signal recognition particle receptor beta 80.55
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 80.51
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 80.47
3tlx_A243 Adenylate kinase 2; structural genomics, structura 80.45
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 80.39
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 80.33
1tue_A212 Replication protein E1; helicase, replication, E1E 80.19
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 80.19
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 80.18
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 80.18
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 80.13
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 80.08
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 80.05
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 80.03
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
Probab=100.00  E-value=3.7e-141  Score=1129.83  Aligned_cols=511  Identities=62%  Similarity=1.023  Sum_probs=477.1

Q ss_pred             CCCChHHHHHHHHHHHHcccCccCccceeEEEEEECcEEEEEecCCCcccCEEEEcCCceEEEEEEeCCeEEEEEeCCCC
Q psy2894           1 MKINASEISTIIQEQIKNFNNTTEIYNQGKVISVFDGICQIYGLSNAMQGEMLEFPGNVFGLALNLERDSIGAVILGKYE   80 (515)
Q Consensus         1 ~~~~~~~~~~~l~~~i~~~~~~~~~~~~G~V~~I~g~iv~v~Gl~~~~~gElv~~~~~~~g~V~~l~~~~v~~~~~~~~~   80 (515)
                      |+++++|++++|++++++|+.....+++|+|++|.|++++|+|++++++||+|+|.++..|+|++++++.+++++|+++.
T Consensus         1 ~~~~~~~~~~~~~~~i~~~~~~~~~~~~G~V~~v~g~i~~v~Gl~~~~~gElv~~~~~~~g~v~~l~~d~v~~~~~~~~~   80 (513)
T 3oaa_A            1 MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRYAIALNLERDSVGAVVMGPYA   80 (513)
T ss_dssp             -----------------------CCTTEEEEEEEETTEEEEEECTTCBTTCEEEETTTEEEEEEEECSSCEEEEESSCCS
T ss_pred             CCCCHHHHHHHHHHHHHhcCCCCCceeEEEEEEEECcEEEEECCccCCcCCEEEECCCCEEEEEEeeCCEEEEEEeCCcc
Confidence            78899999999999999999888899999999999999999999999999999999889999999999999999999999


Q ss_pred             CCCCCCEEEEcCCccccccCccccceEecccCCcCCCCCCCCcccccccccCCCCccccCCCcccccccccccccccccc
Q psy2894          81 HITEGDIVKCTGRILEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIG  160 (515)
Q Consensus        81 gi~~G~~V~~tg~~~~vpvg~~lLGrViD~lG~pid~~~~~~~~~~~~i~~~~p~~~~R~~~~epl~TGik~ID~l~pig  160 (515)
                      ||++|++|++||++++||||++|||||+|++|+|||+++++....++|++..||++++|.++++||+||||+||+|+|||
T Consensus        81 gi~~G~~V~~tg~~~~VpvG~~lLGRV~d~lG~PiDg~g~i~~~~~~pi~~~ap~~~~R~~v~epl~TGikaID~l~Pig  160 (513)
T 3oaa_A           81 DLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAPIDGKGPLDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIG  160 (513)
T ss_dssp             SCCTTCEEECCSCSSEEECSGGGTTCEEETTSCBTTCSCSCCCSCEEESSCCCCCSSSCCCCCCBCCCSCHHHHHHSCCB
T ss_pred             CCCCCCEEEEcCCCCeEeeCHHHhccchhhcCcCccCCCCCCccceeecccCCCCccccCCcCcccccceeeeccccccc
Confidence            99999999999999999999999999999999999999999988899999999999999999999999999999999999


Q ss_pred             CCcceeeecCCCCCccHHHHHHHHHhcCCCeEEEEEEecCChHHHHHHHHHHhhcCCCCcEEEEEeCCCCCHHhhHHHHh
Q psy2894         161 KGQRELIIGDRQTGKSSIAIDIIINQKNKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAY  240 (515)
Q Consensus       161 rGqr~~I~g~~g~GKt~l~~~~i~~~~~~~~~~V~~~iGer~~ev~~~~~~l~~~~~~~~t~vv~~t~~~~~~~r~~a~~  240 (515)
                      ||||++|||++|||||+|++++|+||++.|++|||++||||++||++|+++++++|+|+||++|++|+|+||.+|+++||
T Consensus       161 rGQR~~Ifg~~g~GKT~l~l~~I~n~~~~dv~~V~~~IGeR~~ev~e~~~~l~~~g~m~~tvvV~atad~p~~~r~~a~~  240 (513)
T 3oaa_A          161 RGQRELIIGDRQTGKTALAIDAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY  240 (513)
T ss_dssp             TTCBCEEEESSSSSHHHHHHHHHHTTSSSSCEEEEEEESCCHHHHHHHHHHHHHHSCSTTEEEEEECTTSCHHHHHHHHH
T ss_pred             cCCEEEeecCCCCCcchHHHHHHHhhccCCceEEEEEecCChHHHHHHHHHHhhcCcccceEEEEECCCCChHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhHHHHHHcCCcEEEEEechhHHHHHHHHHHHhcCCCCCCCCCCCchhhhhhHHHHHhhccchhhhhcccCCcccCC
Q psy2894         241 SGCTIGEYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGK  320 (515)
Q Consensus       241 ~a~~iAE~frd~G~~Vlli~Dsltr~a~A~reisl~l~~pp~~~gypg~vf~~~~rl~ERag~~~~~~~~~~~~~~~~g~  320 (515)
                      +|||+||||||+|+|||++|||+||||+||||||+++||||+++|||||+||+||||+||||++++.+++++.+|+..|+
T Consensus       241 ~a~tiAEyfrd~G~dVLli~Dsltr~A~A~REisl~lgepP~r~gYP~~vf~~~srLlERAg~~~~~~~~~~~~~~~~g~  320 (513)
T 3oaa_A          241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGK  320 (513)
T ss_dssp             HHHHHHHHHHHTTCEEEEEEETHHHHHHHHHHHHHHTTCCBCTTSCBTTHHHHHHHHHTTCSEECHHHHHHHHTTSCCSC
T ss_pred             HHHHHHHHHHhcCCCEEEEecChHHHHHHHHHHHHhcCCCCcccCCCchhhhhcchHHHHHhhcccccchhccccccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999998766777766553345


Q ss_pred             CCceeeeeEEeecCCCCCCcccccccccCCeEEEecchhhcCCCcCccccCCCccccccccchHHHHHHHHHHHHHHHhh
Q psy2894         321 TGSLTAIPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQIKFIKKLSSNIRTDLAQY  400 (515)
Q Consensus       321 ~GSiT~l~~v~~~~~D~s~pI~~~~~si~Dg~i~L~r~La~~g~~PAIdv~~S~SRv~~~~~~~~~~~~a~~lr~~la~y  400 (515)
                      +||||++|+|+|++||++||||||++|||||||||||+||++||||||||+.|+||+|++++.++|+++|+++|+.|++|
T Consensus       321 ~GSITal~~V~~~~dD~s~pIp~~~~si~DGqIvLsr~La~~giyPAIdvl~SvSRv~~~~~~~~~~~va~~lr~~la~y  400 (513)
T 3oaa_A          321 TGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQY  400 (513)
T ss_dssp             CEEEEECCEEECGGGCCSSHHHHHHHHHSSEEEEECHHHHTTSCCSCBCTTTCEESSGGGGSCHHHHHHHHHHHHHHHHH
T ss_pred             CcceEEEEEEEcCCCCccCcchHhhhccCCeEEEEehhHHhCCCCCccCccccccccCcccccHHHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccCCCHHHHHHHHhhHHHhhcccccccCCCCHHHHHHHHHHHhcCcccccchhHHHHHHHHHHHHHHhhch
Q psy2894         401 RELAAFSQFSSDLDLVTRKQLDRGARVTELLKQKQYSPLPVSLIAVILFAINKGFLDDIEIKKILNFESSLYKFMKTCQN  480 (515)
Q Consensus       401 ~el~~~~~~g~~ld~~~~~~l~~~~~i~~~L~Q~~~~~~~~~~~~~~l~~~~~G~ld~v~~~~v~~f~~~l~~~l~~~~~  480 (515)
                      +|+++|++||+++|++++.+++++++|++||+|++++++++++|+..||++.|||||++|++++.+|++.+++|++..++
T Consensus       401 ~el~~~~~~g~~ld~~~~~~l~~~~~i~~fL~Q~~~~~~~~~e~~~~l~a~~~g~ld~~~~~~~~~~~~~~~~~~~~~~~  480 (513)
T 3oaa_A          401 RELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA  480 (513)
T ss_dssp             HHHHHHHTTCCSCCHHHHHHHHHHHHHHHHTCCCSSCCCCTTHHHHHHHHHHSCTTTTTCCHHHHHHHHHHHHHHTGGGC
T ss_pred             HHHHHHHHhhccCCHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHHHhcCCCccCCHHHHHHHHHHHHHHHHhhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhccCCCHHHHHHHHHHHHHHHhhh
Q psy2894         481 SILEKIKNVNEFNADIEDSLTTILINFKKSY  511 (515)
Q Consensus       481 ei~~~i~~~~~l~~e~~~~l~~~~~~f~~~f  511 (515)
                      ++++.|.+++++++++++.|++++++|++..
T Consensus       481 ~~~~~i~~~~~~~~~~~~~l~~~~~~~~~~~  511 (513)
T 3oaa_A          481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQ  511 (513)
T ss_dssp             HHHHHHHHHCCCCHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHhcCCCCHHHHHHHHHHHHHHHhhc
Confidence            9999999999999999999999999998763
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 515
d2jdia3285 c.37.1.11 (A:95-379) Central domain of alpha subun 1e-123
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 1e-114
d1fx0a3276 c.37.1.11 (A:97-372) Central domain of alpha subun 1e-113
d1xpua3289 c.37.1.11 (A:129-417) Transcription termination fa 2e-53
d2jdia1131 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit 4e-39
d1fx0a1129 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit 1e-37
d1skyb1131 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit 3e-37
d1skyb275 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, 6e-29
d1fx0a272 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, 2e-28
d2jdia271 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, 6e-28
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  361 bits (928), Expect = e-123
 Identities = 191/295 (64%), Positives = 234/295 (79%), Gaps = 19/295 (6%)

Query: 96  EVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDS 155
           +VP+G EL GRV++ALG+ IDGKGPI +K    +   APG+I R SV EP+QTGIKA+DS
Sbjct: 2   DVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDS 61

Query: 156 IVPIGKGQRELIIGDRQTGKSSIAIDIIINQK--------NKNVTCIYVAIGQKISSIKK 207
           +VPIG+GQRELIIGDRQTGK+SIAID IINQK         K + CIYVAIGQK S++ +
Sbjct: 62  LVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQ 121

Query: 208 TANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIGEYFRDHGKDALVVYDDLSKQA 267
               L    AM YTI+V+ATASD+A +Q+++ YSGC++GEYFRD+GK AL++YDDLSKQA
Sbjct: 122 LVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQA 181

Query: 268 VAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTAI 327
           VAYRQ+SLLL+RPPGREAYPGD+FYLHSRLLER+A++N                GSLTA+
Sbjct: 182 VAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDA-----------FGGGSLTAL 230

Query: 328 PIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQ 382
           P+IETQAGD+SA++PTNVISITDGQIFL++ LF  GIRPAIN G+SVSRVG AAQ
Sbjct: 231 PVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQ 285
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure
>d2jdia1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} Length = 131 Back     information, alignment and structure
>d1fx0a1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 129 Back     information, alignment and structure
>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 131 Back     information, alignment and structure
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 75 Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 72 Back     information, alignment and structure
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 100.0
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 100.0
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 100.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 100.0
d2jdia1131 F1 ATP synthase alpha subunit, domain 3 {Cow (Bos 99.96
d1fx0a1129 F1 ATP synthase alpha subunit, domain 3 {Spinach ( 99.96
d1skyb1131 F1 ATP synthase alpha subunit, domain 3 {Bacillus 99.95
d1skyb275 F1 ATP synthase alpha subunit, domain 1 {Bacillus 99.55
d2jdia271 F1 ATP synthase alpha subunit, domain 1 {Cow (Bos 99.53
d1fx0a272 F1 ATP synthase alpha subunit, domain 1 {Spinach ( 99.49
d1skye1114 F1 ATP synthase beta subunit, domain 3 {Bacillus s 99.08
d2jdid1118 F1 ATP synthase beta subunit, domain 3 {Rat (Rattu 99.07
d1fx0b1108 F1 ATP synthase beta subunit, domain 3 {Spinach (S 99.01
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 98.2
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 98.07
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.95
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.89
d2jdid272 F1 ATP synthase beta subunit, domain 1 {Rat (Rattu 97.84
d1fx0b279 F1 ATP synthase beta subunit, domain 1 {Spinach (S 97.61
d1skye282 F1 ATP synthase beta subunit, domain 1 {Bacillus s 97.52
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.37
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 97.25
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.19
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.03
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.01
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.74
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.99
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.87
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.86
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.51
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.39
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.37
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.3
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.88
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 93.85
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.78
d1okkd2207 GTPase domain of the signal recognition particle r 93.66
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.62
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.62
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.45
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.44
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.41
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.4
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.3
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.24
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.17
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.14
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.12
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.09
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.06
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.03
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.9
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.85
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.65
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.6
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.59
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.55
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.49
d2qy9a2211 GTPase domain of the signal recognition particle r 92.21
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.2
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.19
d1vmaa2213 GTPase domain of the signal recognition particle r 92.18
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.13
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.08
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.07
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.04
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.04
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.02
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.99
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.91
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.85
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.84
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 91.74
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.72
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.7
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.64
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.52
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.5
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.45
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.39
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.38
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.35
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.33
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.2
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.02
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.02
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.92
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.84
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.75
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.73
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 90.63
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 90.62
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.41
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.09
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.85
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.82
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.73
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.53
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.53
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.29
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.29
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.22
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.08
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.07
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.06
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 89.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.87
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.86
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.84
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.8
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.64
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.61
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 88.59
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.51
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.44
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.42
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.4
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.29
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.17
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.17
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.07
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.07
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.98
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.92
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.9
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.82
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.75
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 87.7
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.7
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.67
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.67
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.64
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.62
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.61
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.59
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.42
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 87.34
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 87.32
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 87.21
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 87.21
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.08
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.06
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.03
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.99
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 86.75
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 86.58
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 86.5
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.45
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 86.42
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.31
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 86.23
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.1
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 85.99
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 85.92
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.84
d2fh5b1207 Signal recognition particle receptor beta-subunit 85.73
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.65
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.51
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.38
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.31
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 85.2
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.1
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 85.01
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 85.01
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 84.92
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 84.81
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.72
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.54
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 84.51
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 84.35
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 84.24
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 83.84
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 83.84
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.71
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 83.55
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 83.53
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 83.45
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.42
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 83.19
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 82.8
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 82.7
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 82.6
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 82.57
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 82.36
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 82.28
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 81.75
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 81.35
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.29
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.2
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.14
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 81.09
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 80.64
d1svma_362 Papillomavirus large T antigen helicase domain {Si 80.56
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=2.5e-90  Score=695.77  Aligned_cols=277  Identities=69%  Similarity=1.115  Sum_probs=266.7

Q ss_pred             cccccCccccceEecccCCcCCCCCCCCcccccccccCCCCccccCCCccccccccccccccccccCCcceeeecCCCCC
Q psy2894          95 LEVPIGPELCGRVINALGDPIDGKGPIKTKLTAPIEKVAPGVISRQSVSEPLQTGIKAIDSIVPIGKGQRELIIGDRQTG  174 (515)
Q Consensus        95 ~~vpvg~~lLGrViD~lG~pid~~~~~~~~~~~~i~~~~p~~~~R~~~~epl~TGik~ID~l~pigrGqr~~I~g~~g~G  174 (515)
                      .+||||++|||||+|++|+|||+++++...++++++..+|++++|.++++||+||||+||+|+|||||||++|||++|+|
T Consensus         1 i~VPVG~~lLGRVid~~G~piDg~~~~~~~~~~~i~~~~p~~~~R~~i~e~l~TGIraID~l~pig~GQr~~If~~~g~G   80 (285)
T d2jdia3           1 VDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTG   80 (285)
T ss_dssp             CEEEESGGGTTCEECTTSCBCSSSCCCCCSEEEESSCCCCCSTTBCCCCSBCCCSCHHHHHHSCCBTTCBCEEEESTTSS
T ss_pred             CccccCcCccCcEECCCccccCCCCCCCCCccccccCCCcCchhccCCCcccccCceEEecccCccCCCEEEeecCCCCC
Confidence            36999999999999999999999999988899999999999999999999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHhc--------CCCeEEEEEEecCChHHHHHHHHHHhhcCCCCcEEEEEeCCCCCHHhhHHHHhhhhhhH
Q psy2894         175 KSSIAIDIIINQK--------NKNVTCIYVAIGQKISSIKKTANLLEKYGAMPYTIIVAATASDSASMQFISAYSGCTIG  246 (515)
Q Consensus       175 Kt~l~~~~i~~~~--------~~~~~~V~~~iGer~~ev~~~~~~l~~~~~~~~t~vv~~t~~~~~~~r~~a~~~a~~iA  246 (515)
                      ||+|+++++.|++        +.+++|||++||||++|+.+|++.+.+.++|+||++|++|+++||.+|+++||+|||+|
T Consensus        81 Kt~ll~~~~~~~~~~~~~~~~~~~~~~v~~~IGer~~E~~e~~~~~~~~~~~~~tvvv~~ts~~~~~~r~~~~~~a~tiA  160 (285)
T d2jdia3          81 KTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMG  160 (285)
T ss_dssp             HHHHHHHHHHHTHHHHTSSCTTTCCEEEEEEESCCHHHHHHHHHHHHHTTCGGGEEEEEECTTSCHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHhHHhhccccccccceEEEEeeeCccHHHHHHHHHHhcccccccceEEEEECCCCCHHHHHHHHHHHHHHH
Confidence            9999888888863        34568999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCcEEEEEechhHHHHHHHHHHHhcCCCCCCCCCCCchhhhhhHHHHHhhccchhhhhcccCCcccCCCCceee
Q psy2894         247 EYFRDHGKDALVVYDDLSKQAVAYRQISLLLKRPPGREAYPGDIFYLHSRLLERSARVNIKYVENYTNGKVTGKTGSLTA  326 (515)
Q Consensus       247 E~frd~G~~Vlli~Dsltr~a~A~reisl~l~~pp~~~gypg~vf~~~~rl~ERag~~~~~~~~~~~~~~~~g~~GSiT~  326 (515)
                      |||||+|+|||+++||+||||+|+||||+++||+|+++||||++|+.|++|+||||+++..          .| +||||+
T Consensus       161 Eyfrd~G~~VLll~Dsltr~A~A~rEis~~~ge~p~~~gyp~~~~~~~~~l~ERag~~~~~----------~~-~GSiT~  229 (285)
T d2jdia3         161 EYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDA----------FG-GGSLTA  229 (285)
T ss_dssp             HHHHHTTCEEEEEEETHHHHHHHHHHHHHHTTCCCCGGGCCTTHHHHHHHHHTTCCBBCGG----------GT-CCEEEE
T ss_pred             HHHHHcCCcEEEEEcChHHHHHHHHHHHHhcCCCCCcCCcCchHHHHHHHHHHHHhcccCC----------CC-CeeEEE
Confidence            9999999999999999999999999999999999999999999999999999999998543          44 899999


Q ss_pred             eeEEeecCCCCCCcccccccccCCeEEEecchhhcCCCcCccccCCCccccccccc
Q psy2894         327 IPIIETQAGDISAFVPTNVISITDGQIFLDSSLFNSGIRPAINAGISVSRVGGAAQ  382 (515)
Q Consensus       327 l~~v~~~~~D~s~pI~~~~~si~Dg~i~L~r~La~~g~~PAIdv~~S~SRv~~~~~  382 (515)
                      +|+|++++||++||||+++++|+||||+|||+||++||||||||+.|+||+|+++|
T Consensus       230 i~~v~~~~dD~tdpI~~~~~~i~dg~ivLsr~la~~g~yPAID~l~S~SR~~~~~q  285 (285)
T d2jdia3         230 LPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQ  285 (285)
T ss_dssp             EEEEECSTTCTTSHHHHHHHHHSSEEEEBCHHHHHHTCSSCBCTTTCEESSGGGGS
T ss_pred             EEEEEecCCCCCCchhHHHHhhcCcEEEEcHHHHhcCCCCCcCCcccccccCcccC
Confidence            99999999999999999999999999999999999999999999999999999987
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d2jdid1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure