Psyllid ID: psy2956

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRA
ccEEEEEcHHHHHHHcccccEEEEccccccccEEEccccHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHccccccccccccccccEEEEEEcccccccccccEEEEEccccccccccccccccEEEEEccccHHHHccccccccccccccEEEEEEEccccccccccccccccccccccccccccccHHcccccccccccHHHHHHccc
cEEEEEEcHHHHHHHHccccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHcccccccccccccEEEEEEEEEHHHEEEEEccEEEEEcccccEEccccccccccEEEEccHHHHHHHHHccccccccccccEEEHHHHHccccHHccccccEEEEEcccccHcccccccccccEEEEccccHHHHHccc
MQIFATRRQHLTrqyfdnaplmnvpgrthpveifytpeperDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDnlgpeagelkciplystlppnlQQRIfeaapankpnggigrKVVVSTNiaetsltidgvvfvidpgfakqkvynprirvesllvspiSKASAQQRagragrtrpgkcFRYIVVVSTNiaetsltidgvvfvidpgfakqkvynprirvesllvspiskasAQQRA
mqifatrrqhltrqyfdnaplmnvpgrtHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAApankpnggiGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESllvspiskasaqqragragrtrpgkcFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKvynprirvesllvspiskasaqqra
MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASaqqragragrTRPGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRA
*********HLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVS******************PGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLV************
MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEI*****EAGELKCIPLYSTLPPNLQQRIFEAAPANKP*GGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQR*
MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPI***************RPGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSP**********
MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQ*********RPGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKA******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYIVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
O17438 455 Putative pre-mRNA-splicin no N/A 0.729 0.402 0.918 1e-97
O35286 795 Putative pre-mRNA-splicin yes N/A 0.721 0.227 0.861 4e-91
O43143 795 Putative pre-mRNA-splicin yes N/A 0.721 0.227 0.861 4e-91
Q5RAZ4 795 Putative pre-mRNA-splicin yes N/A 0.721 0.227 0.861 4e-91
Q20875 739 Putative pre-mRNA-splicin yes N/A 0.725 0.246 0.803 4e-85
O22899 729 Probable pre-mRNA-splicin yes N/A 0.820 0.282 0.668 6e-80
O42945 735 Probable pre-mRNA-splicin yes N/A 0.768 0.262 0.671 2e-73
P53131 767 Pre-mRNA-splicing factor yes N/A 0.721 0.235 0.708 2e-70
Q54NJ4 727 Putative pre-mRNA-splicin yes N/A 0.685 0.236 0.628 6e-61
Q09530 1200 Probable pre-mRNA-splicin no N/A 0.804 0.168 0.508 9e-58
>sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  355 bits (912), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 168/183 (91%), Positives = 173/183 (94%)

Query: 13  RQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE 72
           + YFDNAPLM VPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE
Sbjct: 69  QHYFDNAPLMTVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE 128

Query: 73  EIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVS 132
           EIEEACKRIK+E+DNLGPE G+LK IPLYSTLPP +QQRIFE AP NK NG IGRKVVVS
Sbjct: 129 EIEEACKRIKREVDNLGPEVGDLKTIPLYSTLPPAMQQRIFEHAPPNKANGAIGRKVVVS 188

Query: 133 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGK 192
           TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQR GRAGRTRPGK
Sbjct: 189 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRVGRAGRTRPGK 248

Query: 193 CFR 195
           CFR
Sbjct: 249 CFR 251
Pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA.
Strongylocentrotus purpuratus (taxid: 7668)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|O35286|DHX15_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=2 SV=2 Back     alignment and function description
>sp|O43143|DHX15_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 Back     alignment and function description
>sp|Q5RAZ4|DHX15_PONAB Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 Back     alignment and function description
>sp|Q20875|DHX15_CAEEL Putative pre-mRNA-splicing factor ATP-dependent RNA helicase F56D2.6 OS=Caenorhabditis elegans GN=F56D2.6 PE=2 SV=1 Back     alignment and function description
>sp|O22899|DHX15_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 Back     alignment and function description
>sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 Back     alignment and function description
>sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 Back     alignment and function description
>sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 Back     alignment and function description
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
340725762 1039 PREDICTED: putative pre-mRNA-splicing fa 0.729 0.176 0.939 2e-99
350397130 1039 PREDICTED: putative pre-mRNA-splicing fa 0.729 0.176 0.939 2e-99
307170456 1037 Putative pre-mRNA-splicing factor ATP-de 0.729 0.176 0.928 1e-98
383866382 1039 PREDICTED: putative pre-mRNA-splicing fa 0.729 0.176 0.934 2e-98
91077430 716 PREDICTED: similar to ATP-dependent RNA 0.729 0.255 0.934 4e-98
193647974 716 PREDICTED: putative pre-mRNA-splicing fa 0.729 0.255 0.939 5e-98
195431188 734 GK21317 [Drosophila willistoni] gi|19415 0.729 0.249 0.928 8e-98
322796692 1038 hypothetical protein SINV_01104 [Solenop 0.729 0.176 0.923 8e-98
125806961 738 GA10763 [Drosophila pseudoobscura pseudo 0.729 0.247 0.928 9e-98
195149303 736 GL11162 [Drosophila persimilis] gi|19410 0.729 0.248 0.928 9e-98
>gi|340725762|ref|XP_003401235.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 172/183 (93%), Positives = 177/183 (96%)

Query: 13  RQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE 72
           +QYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTV+QIHMCEEV GD+LLFLTGQE
Sbjct: 544 QQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEVAGDLLLFLTGQE 603

Query: 73  EIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVS 132
           EIEEACKRIK+E+DNLGPE GELKCIPLYSTLPPNLQQRIFE AP  KPNG IGRKVVVS
Sbjct: 604 EIEEACKRIKREMDNLGPEVGELKCIPLYSTLPPNLQQRIFEPAPPTKPNGAIGRKVVVS 663

Query: 133 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGK 192
           TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGK
Sbjct: 664 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGK 723

Query: 193 CFR 195
           CFR
Sbjct: 724 CFR 726

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350397130|ref|XP_003484779.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307170456|gb|EFN62726.1| Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383866382|ref|XP_003708649.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91077430|ref|XP_966364.1| PREDICTED: similar to ATP-dependent RNA helicase [Tribolium castaneum] gi|270001627|gb|EEZ98074.1| hypothetical protein TcasGA2_TC000481 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193647974|ref|XP_001945171.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195431188|ref|XP_002063630.1| GK21317 [Drosophila willistoni] gi|194159715|gb|EDW74616.1| GK21317 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|322796692|gb|EFZ19125.1| hypothetical protein SINV_01104 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|125806961|ref|XP_001360210.1| GA10763 [Drosophila pseudoobscura pseudoobscura] gi|54635381|gb|EAL24784.1| GA10763 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195149303|ref|XP_002015597.1| GL11162 [Drosophila persimilis] gi|194109444|gb|EDW31487.1| GL11162 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
FB|FBgn0033160 729 CG11107 [Drosophila melanogast 0.729 0.251 0.863 3.6e-82
ZFIN|ZDB-GENE-030131-650 769 dhx15 "DEAH (Asp-Glu-Ala-His) 0.721 0.235 0.817 3.4e-77
UNIPROTKB|F1NHI3 762 DHX15 "Uncharacterized protein 0.721 0.237 0.812 1.9e-76
UNIPROTKB|A5D7D9 795 DHX15 "Uncharacterized protein 0.721 0.227 0.806 2.4e-76
UNIPROTKB|E2R2U3 795 DHX15 "Uncharacterized protein 0.721 0.227 0.806 2.4e-76
UNIPROTKB|O43143 795 DHX15 "Putative pre-mRNA-splic 0.721 0.227 0.806 2.4e-76
UNIPROTKB|F1S5A8 795 DHX15 "Uncharacterized protein 0.721 0.227 0.806 2.4e-76
MGI|MGI:1099786 795 Dhx15 "DEAH (Asp-Glu-Ala-His) 0.721 0.227 0.806 2.4e-76
RGD|1308072 795 Dhx15 "DEAH (Asp-Glu-Ala-His) 0.721 0.227 0.806 2.4e-76
WB|WBGene00018967 739 F56D2.6 [Caenorhabditis elegan 0.729 0.247 0.754 2.3e-71
FB|FBgn0033160 CG11107 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 824 (295.1 bits), Expect = 3.6e-82, P = 3.6e-82
 Identities = 158/183 (86%), Positives = 164/183 (89%)

Query:    13 RQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE 72
             +QYFDNAPLM VPGRTHPVEIFYTPEPERDYLEAAIRTV+QIHMCEE+EGD+L+FLTGQE
Sbjct:   234 QQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQE 293

Query:    73 EIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVS 132
             EIEEACKRIK+EIDNLG E GELKCIPLYSTLPPNLQQRIFE AP    NG IGRKVVVS
Sbjct:   294 EIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVS 353

Query:   133 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASXXXXXXXXXXTRPGK 192
             TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKAS          TRPGK
Sbjct:   354 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGK 413

Query:   193 CFR 195
             CFR
Sbjct:   414 CFR 416
GO:0008026 "ATP-dependent helicase activity" evidence=ISS
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-030131-650 dhx15 "DEAH (Asp-Glu-Ala-His) box polypeptide 15" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHI3 DHX15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7D9 DHX15 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2U3 DHX15 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43143 DHX15 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5A8 DHX15 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1099786 Dhx15 "DEAH (Asp-Glu-Ala-His) box polypeptide 15" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308072 Dhx15 "DEAH (Asp-Glu-Ala-His) box polypeptide 15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00018967 F56D2.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q20875DHX15_CAEEL3, ., 6, ., 4, ., 1, 30.80320.72500.2462yesN/A
O17438DHX15_STRPU3, ., 6, ., 4, ., 1, 30.91800.72900.4021noN/A
Q54NJ4DHX15_DICDI3, ., 6, ., 4, ., 1, 30.62840.68520.2365yesN/A
Q5RAZ4DHX15_PONAB3, ., 6, ., 4, ., 1, 30.86180.72110.2276yesN/A
O35286DHX15_MOUSE3, ., 6, ., 4, ., 1, 30.86180.72110.2276yesN/A
P53131PRP43_YEAST3, ., 6, ., 4, ., 1, 30.70810.72110.2359yesN/A
O43143DHX15_HUMAN3, ., 6, ., 4, ., 1, 30.86180.72110.2276yesN/A
O22899DHX15_ARATH3, ., 6, ., 4, ., 1, 30.66810.82070.2825yesN/A
O42945DHX15_SCHPO3, ., 6, ., 4, ., 1, 30.67140.76890.2625yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 5e-78
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 1e-41
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 7e-40
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-38
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 7e-34
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 3e-25
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 5e-13
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 6e-13
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-12
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-12
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 9e-12
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-10
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 4e-10
PHA02653 675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 1e-05
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  251 bits (642), Expect = 5e-78
 Identities = 95/183 (51%), Positives = 117/183 (63%), Gaps = 13/183 (7%)

Query: 14  QYFDNAPLMNVPGRTHPVEIFYTPEPERDY-LEAAIRTVVQIHMCEEVEGDVLLFLTGQE 72
            YF NAP++ + GRT+PVEI Y PE E DY L  AI   V IH+ E   G +L+FL GQ 
Sbjct: 212 AYFGNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIHLREG-SGSILVFLPGQR 270

Query: 73  EIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVS 132
           EIE   + ++K    LG +   L+ +PLY  L    Q R+FE AP  K      RKVV++
Sbjct: 271 EIERTAEWLEK--AELGDD---LEILPLYGALSAEEQVRVFEPAPGGK------RKVVLA 319

Query: 133 TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGK 192
           TNIAETSLTI G+ +VID G AK+K Y+PR  +  L   PISKASA QRAGRAGRT PG 
Sbjct: 320 TNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGI 379

Query: 193 CFR 195
           C+R
Sbjct: 380 CYR 382

Length = 845
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG0923|consensus 902 100.0
KOG0922|consensus 674 100.0
KOG0925|consensus 699 100.0
KOG0924|consensus 1042 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0926|consensus 1172 100.0
KOG0920|consensus 924 100.0
KOG0922|consensus 674 100.0
KOG0923|consensus 902 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0925|consensus 699 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0924|consensus 1042 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0920|consensus 924 99.97
PHA02653 675 RNA helicase NPH-II; Provisional 99.96
KOG0926|consensus 1172 99.92
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.91
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.9
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.9
KOG0921|consensus 1282 99.9
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.89
PHA02653 675 RNA helicase NPH-II; Provisional 99.66
KOG0921|consensus 1282 99.56
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.4
PRK01172 674 ski2-like helicase; Provisional 99.31
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.26
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.25
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.24
PTZ00110545 helicase; Provisional 99.18
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.18
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.15
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.15
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.15
PTZ00424401 helicase 45; Provisional 99.12
KOG0331|consensus519 99.11
KOG0345|consensus 567 99.1
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.1
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.08
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.06
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.98
PRK10689 1147 transcription-repair coupling factor; Provisional 98.95
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.95
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.95
PRK02362 737 ski2-like helicase; Provisional 98.91
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.9
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.89
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 98.88
KOG0333|consensus673 98.87
PRK00254 720 ski2-like helicase; Provisional 98.86
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.85
KOG0328|consensus400 98.85
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.84
KOG0330|consensus476 98.84
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.78
PRK13767 876 ATP-dependent helicase; Provisional 98.74
KOG0342|consensus543 98.68
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.66
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.63
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 98.62
KOG0332|consensus477 98.61
KOG0335|consensus482 98.57
KOG0340|consensus442 98.52
PRK09694 878 helicase Cas3; Provisional 98.49
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.48
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.47
KOG0338|consensus691 98.31
KOG0343|consensus 758 98.29
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.28
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.27
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 98.2
KOG0341|consensus610 98.16
KOG0339|consensus 731 98.14
KOG0326|consensus459 98.13
KOG4284|consensus 980 98.09
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 98.09
PRK05298652 excinuclease ABC subunit B; Provisional 98.08
KOG0348|consensus 708 98.05
KOG0327|consensus397 98.04
KOG0336|consensus629 98.01
PRK13766 773 Hef nuclease; Provisional 98.01
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.0
smart0049082 HELICc helicase superfamily c-terminal domain. 97.98
KOG0334|consensus 997 97.97
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 97.95
PHA02558501 uvsW UvsW helicase; Provisional 97.95
COG1202 830 Superfamily II helicase, archaea-specific [General 97.89
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 97.85
KOG0350|consensus620 97.83
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.78
KOG0347|consensus731 97.78
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 97.69
PRK12904 830 preprotein translocase subunit SecA; Reviewed 97.67
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.67
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.64
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 97.55
PRK09401 1176 reverse gyrase; Reviewed 97.54
KOG0344|consensus593 97.54
TIGR00595505 priA primosomal protein N'. All proteins in this f 97.42
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 97.38
PRK14701 1638 reverse gyrase; Provisional 97.36
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 97.32
KOG0346|consensus 569 97.29
COG4098441 comFA Superfamily II DNA/RNA helicase required for 97.26
KOG0354|consensus 746 97.2
PRK04914 956 ATP-dependent helicase HepA; Validated 97.1
KOG0951|consensus 1674 97.08
COG1200677 RecG RecG-like helicase [DNA replication, recombin 96.97
PRK05580679 primosome assembly protein PriA; Validated 96.91
COG1204 766 Superfamily II helicase [General function predicti 96.82
KOG0337|consensus529 96.81
PRK12326 764 preprotein translocase subunit SecA; Reviewed 96.81
COG1205 851 Distinct helicase family with a unique C-terminal 96.67
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 96.47
PRK01172 674 ski2-like helicase; Provisional 96.44
KOG0349|consensus725 96.29
KOG0953|consensus 700 96.19
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 95.86
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 95.66
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 95.61
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 95.57
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 94.99
KOG4150|consensus 1034 94.84
KOG0347|consensus 731 94.79
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 94.73
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 94.66
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 93.95
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 93.88
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 93.88
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 93.81
CHL00122 870 secA preprotein translocase subunit SecA; Validate 93.7
PTZ00110545 helicase; Provisional 93.57
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 91.83
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 91.75
KOG0329|consensus387 91.68
KOG0331|consensus 519 91.52
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 91.22
KOG0352|consensus 641 91.2
KOG0351|consensus 941 90.8
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 90.72
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 90.57
COG0556663 UvrB Helicase subunit of the DNA excision repair c 89.16
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 89.13
smart0049082 HELICc helicase superfamily c-terminal domain. 88.36
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 87.28
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 85.29
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 85.09
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 84.22
KOG0952|consensus 1230 83.93
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 83.67
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 83.13
PTZ00424401 helicase 45; Provisional 81.98
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 80.77
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 80.09
>KOG0923|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.2e-57  Score=414.81  Aligned_cols=221  Identities=52%  Similarity=0.843  Sum_probs=205.6

Q ss_pred             CeeeeccChHHHHHhcCCCCeEEeCCCccceeeeeCCCCchhHHHHHHHHHHHHhhccccCCCEEEecCCHHHHHHHHHH
Q psy2956           1 MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKR   80 (251)
Q Consensus         1 ~~~sAT~~~~~~~~yf~~~pvi~i~g~~~pV~~~y~~~~~~~~~~~~~~~v~~i~~~~~~~g~iLvFLpg~~ei~~~~~~   80 (251)
                      ++.|||+|+++|+.||++|||+.+|||.|||++||.+.|+.||+++|+.++++||.++. .|||||||+|++||+.+.+.
T Consensus       414 lIsSAT~DAekFS~fFDdapIF~iPGRRyPVdi~Yt~~PEAdYldAai~tVlqIH~tqp-~GDILVFltGQeEIEt~~e~  492 (902)
T KOG0923|consen  414 LISSATMDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYLDAAIVTVLQIHLTQP-LGDILVFLTGQEEIETVKEN  492 (902)
T ss_pred             EeeccccCHHHHHHhccCCcEEeccCcccceeeecccCCchhHHHHHHhhheeeEeccC-CccEEEEeccHHHHHHHHHH
Confidence            46899999999999999999999999999999999999999999999999999999874 79999999999999999999


Q ss_pred             HHHhhhhcCCCCCCeEEEEccCCCChhhHHHhcccCCCCCCCCCccceEEEecCcccceeeecceEEEEeCCcccceeeC
Q psy2956          81 IKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYN  160 (251)
Q Consensus        81 L~~~~~~l~~~~~~l~vi~lsatl~~~~~~~~f~~~p~~~~~g~~~rkiivst~iaetsltI~g~~lVfd~G~~~~~~~~  160 (251)
                      |.+.++.|+.+-.++-++|+||.|+.+.|.++|++.|.+      .||++++|||||||+||+|+.||||||+.|++.|+
T Consensus       493 l~~~~~~LGski~eliv~PiYaNLPselQakIFePtP~g------aRKVVLATNIAETSlTIdgI~yViDpGf~K~nsyn  566 (902)
T KOG0923|consen  493 LKERCRRLGSKIRELIVLPIYANLPSELQAKIFEPTPPG------ARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYN  566 (902)
T ss_pred             HHHHHHHhccccceEEEeeccccCChHHHHhhcCCCCCC------ceeEEEeecchhhceeecCeEEEecCccccccCcC
Confidence            999999999999999999999999999999999999988      89999999999999999999999999999999999


Q ss_pred             CccccccceEEEcccchHHHHhcccCCCCCCccccccce---------------eccccccceeecC--ceEEEEeCCCc
Q psy2956         161 PRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYIVV---------------VSTNIAETSLTID--GVVFVIDPGFA  223 (251)
Q Consensus       161 ~~~~~~~l~~~pis~~~a~qR~gragr~~~G~c~Rl~~i---------------~aTniaEtsiti~--~v~~ViD~g~~  223 (251)
                      |+.++.+|.+.|||+++|.||+|||||++||+|||||+-               ..||++-.-|.+.  ||.-+|+..|+
T Consensus       567 prtGmesL~v~piSKAsA~QRaGRAGRtgPGKCfRLYt~~aY~~eLE~~t~PEIqRtnL~nvVL~LkSLGI~Dl~~FdFm  646 (902)
T KOG0923|consen  567 PRTGMESLLVTPISKASANQRAGRAGRTGPGKCFRLYTAWAYEHELEEMTVPEIQRTNLGNVVLLLKSLGIHDLIHFDFL  646 (902)
T ss_pred             CCcCceeEEEeeechhhhhhhccccCCCCCCceEEeechhhhhhhhccCCCcceeeccchhHHHHHHhcCcchhcccccC
Confidence            999999999999999999999999999999999999983               4577776655443  77777887777


Q ss_pred             cceee
Q psy2956         224 KQKVY  228 (251)
Q Consensus       224 k~~~~  228 (251)
                      ..+-+
T Consensus       647 DpPp~  651 (902)
T KOG0923|consen  647 DPPPT  651 (902)
T ss_pred             CCCCh
Confidence            65543

>KOG0922|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-64
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-23
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-64
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-23
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  241 bits (615), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
Query: 13  RQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE 72
           ++YF++APL+ VPGRT+PVE++YTPE +RDYL++AIRTV+QIH  EE  GD+LLFLTG++
Sbjct: 256 QRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEA-GDILLFLTGED 314
Query: 73  EIEEACKRIKKEIDNLGPE--AGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVV 130
           EIE+A ++I  E D L  E   G L   PLY +LPP+ QQRIFE AP +  NG  GRKVV
Sbjct: 315 EIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESH-NGRPGRKVV 373
Query: 131 VSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASXXXXXXXXXXTRP 190
           +STNIAETSLTIDG+V+V+DPGF+KQKVYNPRIRVESLLVSPISKAS          TRP
Sbjct: 374 ISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRP 433
Query: 191 GKCFR 195
           GKCFR
Sbjct: 434 GKCFR 438
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-113
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 2e-33
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 5e-50
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 7e-20
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-49
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 2e-18
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 9e-48
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 4e-20
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-46
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 9e-18
1yks_A440 Genome polyprotein [contains: flavivirin protease 2e-43
1yks_A 440 Genome polyprotein [contains: flavivirin protease 7e-18
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-42
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 1e-16
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-39
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-18
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  340 bits (873), Expect = e-113
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 4/185 (2%)

Query: 13  RQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQE 72
           ++YF++APL+ VPGRT+PVE++YTPE +RDYL++AIRTV+QIH  EE  GD+LLFLTG++
Sbjct: 256 QRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEE-AGDILLFLTGED 314

Query: 73  EIEEACKRIKKEIDNLGPE--AGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVV 130
           EIE+A ++I  E D L  E   G L   PLY +LPP+ QQRIFE AP +   G  GRKVV
Sbjct: 315 EIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHN-GRPGRKVV 373

Query: 131 VSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRP 190
           +STNIAETSLTIDG+V+V+DPGF+KQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRP
Sbjct: 374 ISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRP 433

Query: 191 GKCFR 195
           GKCFR
Sbjct: 434 GKCFR 438
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.76
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.74
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.68
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.63
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.55
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.53
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.51
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.51
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.43
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.38
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.37
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.35
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.33
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.33
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.32
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.3
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.3
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.29
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.29
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.29
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.29
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.26
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.26
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.26
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.25
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.21
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.2
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.18
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.17
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.16
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.15
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.15
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.12
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.11
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.1
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.09
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.07
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.04
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.04
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.02
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.95
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.9
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.88
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.88
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 98.35
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.8
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.78
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.77
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.76
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.69
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.62
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.57
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.57
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.55
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.51
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.51
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.48
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.42
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 98.42
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.42
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.4
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.28
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.28
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.13
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.11
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.09
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.05
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.03
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.97
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 97.95
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.85
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 97.75
3h1t_A590 Type I site-specific restriction-modification syst 97.74
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.72
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.65
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.35
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 97.34
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 97.18
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 97.12
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.1
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 96.92
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 96.42
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 96.24
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.94
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 95.5
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 95.18
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 94.78
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 94.67
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 94.49
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 94.38
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 94.16
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 93.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 93.79
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 93.52
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 93.09
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 92.44
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 92.25
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 90.71
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 90.11
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 89.8
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 88.99
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 88.92
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 88.26
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 87.96
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 87.93
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 86.93
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 86.79
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 85.96
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 84.35
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 84.33
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 84.09
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 84.06
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 82.54
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=99.97  E-value=3.1e-31  Score=258.62  Aligned_cols=192  Identities=67%  Similarity=1.055  Sum_probs=175.0

Q ss_pred             CeeeeccChHHHHHhcCCCCeEEeCCCccceeeeeCCCCchhHHHHHHHHHHHHhhccccCCCEEEecCCHHHHHHHHHH
Q psy2956           1 MQIFATRRQHLTRQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKR   80 (251)
Q Consensus         1 ~~~sAT~~~~~~~~yf~~~pvi~i~g~~~pV~~~y~~~~~~~~~~~~~~~v~~i~~~~~~~g~iLvFLpg~~ei~~~~~~   80 (251)
                      ++||||+|.+.|++||+++|++.++|+.|||+++|.+.+..++++.++..+.+++..+ ..|++|||+++.++++.+++.
T Consensus       244 Il~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~-~~g~iLVF~~~~~~i~~l~~~  322 (773)
T 2xau_A          244 IIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATE-EAGDILLFLTGEDEIEDAVRK  322 (773)
T ss_dssp             EEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHS-CSCEEEEECSCHHHHHHHHHH
T ss_pred             EEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhc-CCCCEEEECCCHHHHHHHHHH
Confidence            4799999999999999999999999999999999999988999999898998888764 389999999999999999999


Q ss_pred             HHHhhhhc--CCCCCCeEEEEccCCCChhhHHHhcccCC-----CCCCCCCccceEEEecCcccceeeecceEEEEeCCc
Q psy2956          81 IKKEIDNL--GPEAGELKCIPLYSTLPPNLQQRIFEAAP-----ANKPNGGIGRKVVVSTNIAETSLTIDGVVFVIDPGF  153 (251)
Q Consensus        81 L~~~~~~l--~~~~~~l~vi~lsatl~~~~~~~~f~~~p-----~~~~~g~~~rkiivst~iaetsltI~g~~lVfd~G~  153 (251)
                      |.+.+..+  ..+.+++.+.++|+.|+.+++.++|...+     .+      .++++++||++|++++||++.+|||+|+
T Consensus       323 L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g------~~kVlVAT~iae~GidIp~v~~VId~g~  396 (773)
T 2xau_A          323 ISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRP------GRKVVISTNIAETSLTIDGIVYVVDPGF  396 (773)
T ss_dssp             HHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSC------CEEEEEECTHHHHTCCCTTEEEEEECSE
T ss_pred             HHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCC------ceEEEEeCcHHHhCcCcCCeEEEEeCCC
Confidence            98654433  12335899999999999999999999887     55      7999999999999999999999999999


Q ss_pred             ccceeeCCccccccceEEEcccchHHHHhcccCCCCCCccccccce
Q psy2956         154 AKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYIVV  199 (251)
Q Consensus       154 ~~~~~~~~~~~~~~l~~~pis~~~a~qR~gragr~~~G~c~Rl~~i  199 (251)
                      .+...|++..++..|.+.|+++++..||+|||||..+|+||++++.
T Consensus       397 ~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~  442 (773)
T 2xau_A          397 SKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTE  442 (773)
T ss_dssp             EEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCH
T ss_pred             ccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecH
Confidence            9999999999999999999999999999999999999999998863
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 6e-29
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 7e-13
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-19
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-06
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-04
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  108 bits (272), Expect = 6e-29
 Identities = 29/176 (16%), Positives = 48/176 (27%), Gaps = 26/176 (14%)

Query: 26  GRTHPVEIFYTP--EPERDYLEAAIRTVVQIHMCEEVEGDVLLFLTGQEEIEEACKRIKK 83
           G +           + + D       T          +     FL            ++K
Sbjct: 1   GTSDEFPHSNGEIEDVQTDIPSEPWNTGHD--WILADKRPTAWFLPSIRAANVMAASLRK 58

Query: 84  EIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSLTID 143
                         + L           I +               +++T+IAE    + 
Sbjct: 59  ---------AGKSVVVLNRKTFEREYPTIKQ----------KKPDFILATDIAEMGANLC 99

Query: 144 GVVFVIDPGFA-KQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYIV 198
            V  V+D   A K  + +   +V       IS +SA QR GR GR  P +      
Sbjct: 100 -VERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRN-PNRDGDSYY 153
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.82
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.59
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.29
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.12
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.1
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.09
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.08
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.05
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.98
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.95
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.87
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.85
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.59
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 98.5
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.42
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.42
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.4
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.85
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.39
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.38
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 96.95
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 95.11
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 94.01
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 87.02
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 84.26
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=99.82  E-value=1e-20  Score=162.90  Aligned_cols=116  Identities=22%  Similarity=0.158  Sum_probs=95.9

Q ss_pred             CCCEEEecCCHHHHHHHHHHHHHhhhhcCCCCCCeEEEEccCCCChhhHHHhcccCCCCCCCCCccceEEEecCccccee
Q psy2956          61 EGDVLLFLTGQEEIEEACKRIKKEIDNLGPEAGELKCIPLYSTLPPNLQQRIFEAAPANKPNGGIGRKVVVSTNIAETSL  140 (251)
Q Consensus        61 ~g~iLvFLpg~~ei~~~~~~L~~~~~~l~~~~~~l~vi~lsatl~~~~~~~~f~~~p~~~~~g~~~rkiivst~iaetsl  140 (251)
                      +|++|+|+|+..+++++++.|.+.         ..+|+++|+.+..++++++++.          .++++++||++|+++
T Consensus        36 ~g~~~~F~~s~~~~~~~a~~L~~~---------g~~V~~l~~~~~~~e~~~~~~~----------~~~~~~~t~~~~~~~   96 (299)
T d1yksa2          36 KRPTAWFLPSIRAANVMAASLRKA---------GKSVVVLNRKTFEREYPTIKQK----------KPDFILATDIAEMGA   96 (299)
T ss_dssp             CSCEEEECSCHHHHHHHHHHHHHT---------TCCEEECCSSSCC--------C----------CCSEEEESSSTTCCT
T ss_pred             CCCEEEEeCCHHHHHHHHHHHHhc---------CCeEEEEcCcCcHhHHhhhhcC----------CcCEEEEechhhhce
Confidence            799999999999999999998753         5679999999999998887643          578999999999999


Q ss_pred             eecceEEEEeCCcc-cceeeCCccccccceEEEcccchHHHHhcccCCCCCCcccccc
Q psy2956         141 TIDGVVFVIDPGFA-KQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRYI  197 (251)
Q Consensus       141 tI~g~~lVfd~G~~-~~~~~~~~~~~~~l~~~pis~~~a~qR~gragr~~~G~c~Rl~  197 (251)
                      || |+.+|||+|+. +...|++..++..+...|++++++.||+||+||.++ .||+.|
T Consensus        97 ~~-~~~~vid~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~qr~gr~gr~~~-~~~~~~  152 (299)
T d1yksa2          97 NL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPN-RDGDSY  152 (299)
T ss_dssp             TC-CCSEEEECCEEEEEEEETTTTEEEEEEEEECCHHHHHHHHTTSSCCTT-CCCEEE
T ss_pred             ec-CceEEEecCceeceeeecCCCCeeEEeeeecCHHHHHHhcccccccCC-CceEEE
Confidence            99 69999999995 777899999999999999999999999999999854 455444
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure