Psyllid ID: psy3103

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MSIQTSPEVREIVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK
ccccccHHHHHHHHHHHHHcccHHHHHHHHHcccEEEEEcccccHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHccccccEEEcccccccccccEEEEEEEcccccccHHHHHHHHcHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccc
cccccccccEHEccccEEEEccccccEEEEccccccccccccccHHHHHHHHHEEEEEEHHEEcccccccHHHHHHHHHHHHHHHHHHccccEEEEEHccHcHcHHHHHHHHcccccccEEEccccccccccEEEEEccccccccHHHHHHHHHcHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccc
MSIQTSPEVREIVDKCMSNIMDNKLKDMLRSsigyhhagmspedRTIIEQLFRSGYLMILVHLLgeesrgpvLEAVVCRMRTvqksqrasqpirFVAVSATIPNIYDIALWlgfgkptvyaqiddsfrpvkltkivrgfptkpsqstfQFEMMLSYKLKSIIMQysdnkptlifcatrkgvEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK
msiqtspevrEIVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRtvqksqrasqpirfvAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRgfptkpsqstfqFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILrqemsiqtspeVREIVDKCMsnmmdnklk
MSIQTSPEVREIVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK
************VDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMS************************
***********IVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQK**RASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEM******************M******
MSIQTSPEVREIVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMR********SQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK
******PEVREIVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMM*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIQTSPEVREIVDKCMSNIMDNKLKDMLRSSIGYHHAGMSPEDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query217 2.2.26 [Sep-21-2011]
A2RUV5 1336 Probable ATP-dependent DN yes N/A 0.797 0.129 0.456 1e-37
A2PYH4 1435 Probable ATP-dependent DN yes N/A 0.746 0.112 0.461 2e-37
P51979 1187 ATP-dependent DNA helicas yes N/A 0.534 0.097 0.416 3e-18
P53327 1967 Antiviral helicase SLH1 O no N/A 0.695 0.076 0.309 4e-13
O75643 2136 U5 small nuclear ribonucl no N/A 0.516 0.052 0.336 4e-11
E7F8F4 1534 Activating signal cointeg no N/A 0.594 0.084 0.323 4e-11
Q9VUV9 2142 Putative U5 small nuclear no N/A 0.566 0.057 0.325 2e-10
Q9U2G0 2145 Putative U5 small nuclear no N/A 0.562 0.056 0.333 4e-10
E1BNG3 2201 Activating signal cointeg no N/A 0.571 0.056 0.312 4e-10
E9PZJ8 2198 Activating signal cointeg no N/A 0.677 0.066 0.290 7e-10
>sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 Back     alignment and function desciption
 Score =  155 bits (393), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 122/182 (67%), Gaps = 9/182 (4%)

Query: 43  EDRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTV------QKSQRASQPIRFV 96
           +D T++ QL R  +L+  VH+L EE+RG  LE VV RM+T+       + ++A  P+RFV
Sbjct: 266 KDNTLV-QLVRL-FLIDEVHILKEENRGATLEVVVSRMKTIYSLSHLSEDRKAFIPMRFV 323

Query: 97  AVSATIPNIYDIALWLG-FGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLS 155
           AVSATIPN+ DIA WL     P V  ++D+S RPVKL K+V GFP    QS F+F++ L+
Sbjct: 324 AVSATIPNVEDIADWLSDENSPGVCMKMDESSRPVKLRKVVLGFPCSTKQSEFKFDLTLN 383

Query: 156 YKLKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNK 215
           YK+ +II  YSD +PTL+FC+TRKGV+   +IL ++     S E ++ + KC +++ D+K
Sbjct: 384 YKIANIIQTYSDGRPTLVFCSTRKGVQQAASILTKDAKFVMSIEHKQRLQKCANSIKDSK 443

Query: 216 LK 217
           L+
Sbjct: 444 LR 445

Xenopus tropicalis (taxid: 8364)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=2 SV=2 Back     alignment and function description
>sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 Back     alignment and function description
>sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 Back     alignment and function description
>sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 Back     alignment and function description
>sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 Back     alignment and function description
>sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=CG5931 PE=2 SV=4 Back     alignment and function description
>sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 Back     alignment and function description
>sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 Back     alignment and function description
>sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
344293613 1432 PREDICTED: probable ATP-dependent DNA he 0.926 0.140 0.415 2e-38
345314951 993 PREDICTED: probable ATP-dependent DNA he 0.746 0.163 0.467 5e-37
363736911 1436 PREDICTED: probable ATP-dependent DNA he 0.797 0.120 0.478 1e-36
410967744 1442 PREDICTED: LOW QUALITY PROTEIN: probable 0.746 0.112 0.461 2e-36
281337776 1399 hypothetical protein PANDA_015861 [Ailur 0.746 0.115 0.461 2e-36
301781644 1439 PREDICTED: probable ATP-dependent DNA he 0.746 0.112 0.461 2e-36
326925073 1160 PREDICTED: probable ATP-dependent DNA he 0.829 0.155 0.450 3e-36
395822029 1474 PREDICTED: probable ATP-dependent DNA he 0.746 0.109 0.455 4e-36
444732335 945 putative ATP-dependent DNA helicase HFM1 0.746 0.171 0.461 4e-36
431897068 842 Putative ATP-dependent DNA helicase HFM1 0.746 0.192 0.455 5e-36
>gi|344293613|ref|XP_003418516.1| PREDICTED: probable ATP-dependent DNA helicase HFM1 [Loxodonta africana] Back     alignment and taxonomy information
 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/219 (41%), Positives = 135/219 (61%), Gaps = 18/219 (8%)

Query: 15  KCMSNIMDNKLKDMLRSSIGYHHAGMS-PEDRTIIEQLFRSGYLMILV--------HLLG 65
           KC     D  + D+    I + H  M+ PE    + + +R   L+ LV        H++ 
Sbjct: 357 KCKELTGDTVMDDLFE--IQHAHIIMTTPEKWDSMTRKWRDNSLVQLVRLFFIDEVHIVK 414

Query: 66  EESRGPVLEAVVCRMRTVQKSQRASQ------PIRFVAVSATIPNIYDIALWLGFG-KPT 118
           +E+RGP+LE VV RM+TVQ   +  +      P+RFVAVSATIPN+ DIA WL  G +P 
Sbjct: 415 DENRGPILEVVVSRMKTVQSLPQTLENTSTIIPMRFVAVSATIPNVEDIAEWLSDGERPA 474

Query: 119 VYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATR 178
           VY +ID+S RPVKL K+V GFP   +Q+ F+F++ L+YK+ S+I  YSD KPTL+FCATR
Sbjct: 475 VYLKIDESHRPVKLRKVVLGFPCSNNQTEFKFDLTLNYKIASVIQTYSDQKPTLVFCATR 534

Query: 179 KGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK 217
           KGV+   ++L ++     + E ++ + KC  ++ D+KL+
Sbjct: 535 KGVQQAASVLVKDAKFIMTMEQKQRLQKCAHSIRDSKLR 573

Source: Loxodonta africana

Species: Loxodonta africana

Genus: Loxodonta

Family: Elephantidae

Order: Proboscidea

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|345314951|ref|XP_001519189.2| PREDICTED: probable ATP-dependent DNA helicase HFM1, partial [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|363736911|ref|XP_422349.3| PREDICTED: probable ATP-dependent DNA helicase HFM1-like [Gallus gallus] Back     alignment and taxonomy information
>gi|410967744|ref|XP_003990375.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent DNA helicase HFM1 [Felis catus] Back     alignment and taxonomy information
>gi|281337776|gb|EFB13360.1| hypothetical protein PANDA_015861 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|301781644|ref|XP_002926238.1| PREDICTED: probable ATP-dependent DNA helicase HFM1-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|326925073|ref|XP_003208746.1| PREDICTED: probable ATP-dependent DNA helicase HFM1-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|395822029|ref|XP_003784327.1| PREDICTED: probable ATP-dependent DNA helicase HFM1 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|444732335|gb|ELW72636.1| putative ATP-dependent DNA helicase HFM1 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|431897068|gb|ELK06332.1| Putative ATP-dependent DNA helicase HFM1 [Pteropus alecto] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
RGD|1584010 954 Hfm1 "HFM1, ATP-dependent DNA 0.792 0.180 0.477 1.2e-34
UNIPROTKB|A6NGI5 1114 HFM1 "Probable ATP-dependent D 0.792 0.154 0.453 1.3e-34
UNIPROTKB|E1C287177 E1C287 "Uncharacterized protei 0.728 0.892 0.497 1.3e-34
UNIPROTKB|A2PYH4 1435 HFM1 "Probable ATP-dependent D 0.792 0.119 0.453 2e-34
UNIPROTKB|F1S4E9 1438 HFM1 "Uncharacterized protein" 0.792 0.119 0.441 1.8e-33
UNIPROTKB|F1MFR1 1438 HFM1 "Uncharacterized protein" 0.746 0.112 0.461 2.9e-33
UNIPROTKB|E2RA34 1437 HFM1 "Uncharacterized protein" 0.792 0.119 0.444 3.8e-33
UNIPROTKB|E2R5U9 1466 HFM1 "Uncharacterized protein" 0.792 0.117 0.444 3.9e-33
ZFIN|ZDB-GENE-061207-43 1049 hfm1 "HFM1, ATP-dependent DNA 0.746 0.154 0.422 2.8e-30
SGD|S000003503 1967 SLH1 "Putative RNA helicase re 0.626 0.069 0.330 1.1e-18
RGD|1584010 Hfm1 "HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 1.2e-34, P = 1.2e-34
 Identities = 86/180 (47%), Positives = 123/180 (68%)

Query:    44 DRTIIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQ---KS-QRASQ-PIRFVAV 98
             D + I QL R  +L+  VH++ +E+RGP LE VV RM+TVQ   K+ + AS  P+RFVAV
Sbjct:   129 DNSFI-QLVRL-FLIDEVHVIKDENRGPTLEVVVSRMKTVQSLSKTLENASPAPVRFVAV 186

Query:    99 SATIPNIYDIALWLGFG-KPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYK 157
             SATIPN  DIA WL  G +P V  ++D+S RPVKL K+V GFP+  +Q+ F+F++ L+YK
Sbjct:   187 SATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPSSSNQTEFKFDLALNYK 246

Query:   158 LKSIIMQYSDNKPTLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVDKCMSNMMDNKLK 217
             + S+I  YSD KPTL+FCATRKGV+   ++L ++     + E +  + K   ++ D+KLK
Sbjct:   247 VYSVIRTYSDQKPTLVFCATRKGVQQAASVLVKDAKFIITVEQKLRLQKSAYSIRDSKLK 306
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
UNIPROTKB|A6NGI5 HFM1 "Probable ATP-dependent DNA helicase HFM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C287 E1C287 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A2PYH4 HFM1 "Probable ATP-dependent DNA helicase HFM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4E9 HFM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFR1 HFM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RA34 HFM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5U9 HFM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061207-43 hfm1 "HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000003503 SLH1 "Putative RNA helicase related to Ski2p" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 4e-19
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 2e-09
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 8e-09
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 4e-08
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 1e-07
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 3e-06
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 2e-05
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 4e-05
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 7e-05
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-04
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 3e-04
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information 
 Score = 84.7 bits (210), Expect = 4e-19
 Identities = 50/155 (32%), Positives = 77/155 (49%), Gaps = 29/155 (18%)

Query: 61  VHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVY 120
           +HLLG+ +RGPVLE++V RMR      R ++ IR V +SAT+PN  ++A WL   K    
Sbjct: 155 IHLLGDRTRGPVLESIVARMR------RLNELIRIVGLSATLPNAEEVADWLN-AKL--- 204

Query: 121 AQIDDSFRPVKLTKIVRGFP----------TKPSQSTFQFEMMLSYKLKSIIMQYSDNKP 170
             ++  +RPV L    RG P           K +       + L   L+S+    ++   
Sbjct: 205 --VESDWRPVPL---RRGVPYVGAFLGADGKKKTWPLLIDNLALELVLESL----AEGGQ 255

Query: 171 TLIFCATRKGVEHTCTILRQEMSIQTSPEVREIVD 205
            L+F  +RK  E T   LR +MS   S + + ++D
Sbjct: 256 VLVFVHSRKEAEKTAKKLRIKMSATLSDDEKIVLD 290

Length = 766
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 217
KOG0952|consensus 1230 99.94
KOG0951|consensus 1674 99.91
COG1204 766 Superfamily II helicase [General function predicti 99.89
KOG0948|consensus 1041 99.86
PRK02362 737 ski2-like helicase; Provisional 99.85
COG1202 830 Superfamily II helicase, archaea-specific [General 99.81
KOG0947|consensus 1248 99.81
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.8
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.8
PRK01172 674 ski2-like helicase; Provisional 99.78
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.78
PRK00254 720 ski2-like helicase; Provisional 99.77
KOG0950|consensus 1008 99.69
PRK13767 876 ATP-dependent helicase; Provisional 99.66
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.66
KOG0952|consensus1230 99.65
COG1205 851 Distinct helicase family with a unique C-terminal 99.49
KOG0951|consensus 1674 99.38
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.2
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.11
PTZ00110 545 helicase; Provisional 99.11
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.04
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.03
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.02
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.01
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 98.99
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.96
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.96
PTZ00424401 helicase 45; Provisional 98.96
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.93
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.91
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.81
KOG0328|consensus400 98.79
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.76
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 98.75
KOG0330|consensus 476 98.74
KOG0331|consensus 519 98.71
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.7
PHA02653 675 RNA helicase NPH-II; Provisional 98.65
KOG0326|consensus459 98.63
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.62
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.57
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.57
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.56
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.54
KOG4150|consensus 1034 98.52
KOG0335|consensus482 98.43
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.42
KOG0333|consensus 673 98.38
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.34
PRK10689 1147 transcription-repair coupling factor; Provisional 98.2
KOG0351|consensus 941 98.14
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.13
PRK09694 878 helicase Cas3; Provisional 98.12
KOG0340|consensus 442 98.11
KOG0949|consensus 1330 98.1
KOG0327|consensus397 98.08
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.08
KOG0346|consensus 569 98.03
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.99
KOG4284|consensus 980 97.99
KOG0343|consensus 758 97.98
KOG0342|consensus 543 97.9
KOG0338|consensus 691 97.89
KOG0353|consensus 695 97.85
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 97.83
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.81
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.75
KOG0336|consensus 629 97.72
PHA02558 501 uvsW UvsW helicase; Provisional 97.69
KOG0332|consensus477 97.69
KOG0337|consensus 529 97.67
PRK09401 1176 reverse gyrase; Reviewed 97.64
KOG0339|consensus 731 97.6
KOG0922|consensus 674 97.39
KOG0926|consensus 1172 97.34
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 97.24
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.07
KOG0345|consensus 567 97.07
smart00487201 DEXDc DEAD-like helicases superfamily. 96.98
KOG0341|consensus 610 96.98
PRK14701 1638 reverse gyrase; Provisional 96.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 96.89
PRK05580 679 primosome assembly protein PriA; Validated 96.85
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.79
KOG0334|consensus 997 96.72
PRK13766 773 Hef nuclease; Provisional 96.58
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.36
KOG0920|consensus 924 96.2
KOG0924|consensus 1042 96.02
KOG0348|consensus 708 95.84
KOG0350|consensus 620 95.66
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 95.59
KOG0329|consensus387 95.59
COG1198 730 PriA Primosomal protein N' (replication factor Y) 95.39
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 95.28
KOG0923|consensus 902 95.28
KOG0344|consensus 593 95.28
KOG0352|consensus 641 95.21
KOG0354|consensus 746 94.55
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 94.47
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 94.31
KOG0347|consensus 731 94.12
PF04851184 ResIII: Type III restriction enzyme, res subunit; 93.68
KOG0349|consensus 725 93.2
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 92.88
COG1204 766 Superfamily II helicase [General function predicti 92.8
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 92.55
KOG0925|consensus 699 91.38
PRK12904 830 preprotein translocase subunit SecA; Reviewed 91.29
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 90.77
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 90.76
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 90.59
PRK09200 790 preprotein translocase subunit SecA; Reviewed 90.54
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 90.31
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 90.27
PRK13107 908 preprotein translocase subunit SecA; Reviewed 90.26
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 89.62
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 89.47
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 88.79
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 87.59
KOG0953|consensus 700 87.5
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 87.28
PRK00254 720 ski2-like helicase; Provisional 86.69
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 86.65
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 86.42
PRK14873 665 primosome assembly protein PriA; Provisional 84.92
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 81.88
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 81.75
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 80.77
PRK02362 737 ski2-like helicase; Provisional 80.3
>KOG0952|consensus Back     alignment and domain information 
Probab=99.94  E-value=2.1e-26  Score=217.91  Aligned_cols=152  Identities=28%  Similarity=0.369  Sum_probs=129.5

Q ss_pred             ecccCCChhHHH----------HHHHHhhhhhHhhhhhhhcCCCchhHHHHHHHHHHhHHHhhcCCCCceEEEEeccCCC
Q psy3103          35 YHHAGMSPEDRT----------IIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPN  104 (217)
Q Consensus        35 ~~h~~l~~~~~~----------~~l~~v~l~vViDEiH~l~~~~RG~~lE~ll~RL~~l~~~~~~~~~~riv~LSATl~n  104 (217)
                      +.-.++|||||+          .++..|+| |||||+|+|.| +||+++|.+++|+.++.  .-....+||||||||+||
T Consensus       212 tqiiVTTPEKwDvvTRk~~~d~~l~~~V~L-viIDEVHlLhd-~RGpvlEtiVaRtlr~v--essqs~IRivgLSATlPN  287 (1230)
T KOG0952|consen  212 TQIIVTTPEKWDVVTRKSVGDSALFSLVRL-VIIDEVHLLHD-DRGPVLETIVARTLRLV--ESSQSMIRIVGLSATLPN  287 (1230)
T ss_pred             cCEEEecccceeeeeeeeccchhhhhheee-EEeeeehhhcC-cccchHHHHHHHHHHHH--HhhhhheEEEEeeccCCC
Confidence            445677999995          78999999 99999999999 59999999999987664  444678999999999999


Q ss_pred             HHHHHhhhcCCCCCeeeecCCCCccccceeEEEeecCCCCCchhHHHHHhhHHHHHHHHHhcCCCCeEEEeCChhHHHHH
Q psy3103         105 IYDIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHT  184 (217)
Q Consensus       105 ~~~~a~wL~~~~~~~~~~~~~~~Rp~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVF~~sRk~~e~~  184 (217)
                      .+|+|+||+.++..+++.|+..+||+|+++.++|.+.+.  .+.+....-...+.++++.+.+|+|++|||+||+.+-++
T Consensus       288 ~eDvA~fL~vn~~~glfsFd~~yRPvpL~~~~iG~k~~~--~~~~~~~~d~~~~~kv~e~~~~g~qVlvFvhsR~~Ti~t  365 (1230)
T KOG0952|consen  288 YEDVARFLRVNPYAGLFSFDQRYRPVPLTQGFIGIKGKK--NRQQKKNIDEVCYDKVVEFLQEGHQVLVFVHSRNETIRT  365 (1230)
T ss_pred             HHHHHHHhcCCCccceeeecccccccceeeeEEeeeccc--chhhhhhHHHHHHHHHHHHHHcCCeEEEEEecChHHHHH
Confidence            999999999998888999999999999999999987662  222222222345677888889999999999999999999


Q ss_pred             HHHHHHhc
Q psy3103         185 CTILRQEM  192 (217)
Q Consensus       185 A~~l~~~~  192 (217)
                      |+.+.+.+
T Consensus       366 A~~l~~~a  373 (1230)
T KOG0952|consen  366 AKKLRERA  373 (1230)
T ss_pred             HHHHHHHH
Confidence            99999887

>KOG0951|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
4f91_B 1724 Brr2 Helicase Region Length = 1724 3e-12
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 3e-12
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 8e-08
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 6e-06
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 1e-05
4a4z_A 997 Crystal Structure Of The S. Cerevisiae Dexh Helicas 1e-04
2va8_A 715 Dna Repair Helicase Hel308 Length = 715 3e-04
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 13/143 (9%)
Query: 50  QLFRSGYLMIL--VHLLGEESRGPVLEAVVCR-MRTVQKSQRASQPIRFVAVSATIPNIY 106
           QL R   L+IL  +HLL ++ RGPVLEA+V R +R ++ +Q   + +R + +SAT+PN  
Sbjct: 206 QLVR---LIILDEIHLLHDD-RGPVLEALVARAIRNIEMTQ---EDVRLIGLSATLPNYE 258
Query: 107 DIALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYS 166
           D+A +L           D+SFRPV L +   G   K +   FQ    + Y+    IM+++
Sbjct: 259 DVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEK---IMEHA 315
Query: 167 DNKPTLIFCATRKGVEHTCTILR 189
                L+F  +RK    T   +R
Sbjct: 316 GKNQVLVFVHSRKETGKTARAIR 338
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure
>pdb|4A4Z|A Chain A, Crystal Structure Of The S. Cerevisiae Dexh Helicase Ski2 Bound To Amppnp Length = 997 Back     alignment and structure
>pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 3e-36
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-11
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 4e-34
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 8e-12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 4e-30
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-12
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 8e-06
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 1e-05
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 3e-05
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
 Score =  133 bits (336), Expect = 3e-36
 Identities = 43/159 (27%), Positives = 69/159 (43%), Gaps = 15/159 (9%)

Query: 61  VHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVY 120
           +HLL  E RG  LE +V +MR      R ++ +R + +SAT PN+ +IA WL        
Sbjct: 147 IHLLDSEKRGATLEILVTKMR------RMNKALRVIGLSATAPNVTEIAEWLDADY---- 196

Query: 121 AQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQ-YSDNKPTLIFCATRK 179
                 +RPV L + V    T        F      K + ++ +  ++N   L+F +TR+
Sbjct: 197 --YVSDWRPVPLVEGVLCEGTL-ELFDGAFSTSRRVKFEELVEECVAENGGVLVFESTRR 253

Query: 180 GVEHTCTILRQEMSIQTSPE-VREIVDKCMSNMMDNKLK 217
           G E T   L    +     E + + + +     M  KL 
Sbjct: 254 GAEKTAVKLSAITAKYVENEGLEKAILEENEGEMSRKLA 292
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.89
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.88
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.7
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.69
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.68
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.54
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.49
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.45
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.27
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.12
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.02
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.01
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.97
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.92
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.92
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.91
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.9
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.89
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.89
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.89
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.84
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.83
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.79
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.76
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.73
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.65
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.59
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.54
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.38
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.33
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.3
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.29
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.28
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.16
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.16
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.16
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.14
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.13
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.13
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.11
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.11
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.1
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.09
3h1t_A 590 Type I site-specific restriction-modification syst 98.02
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.02
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.02
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 97.98
3bor_A237 Human initiation factor 4A-II; translation initiat 97.98
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 97.98
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.96
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.96
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.94
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.93
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.91
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.91
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.9
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 97.86
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.86
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.81
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.71
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.69
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.64
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 97.64
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.58
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 97.54
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.46
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.14
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.03
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 96.67
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 96.11
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.85
3jux_A 822 Protein translocase subunit SECA; protein transloc 95.67
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.4
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 95.26
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 94.88
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 94.7
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 94.6
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 93.68
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 93.64
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 93.62
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 93.37
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 92.93
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 92.48
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 92.31
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 91.35
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 89.3
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 88.73
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 88.59
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 85.58
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 83.33
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
Probab=99.89  E-value=9.8e-24  Score=214.90  Aligned_cols=148  Identities=30%  Similarity=0.447  Sum_probs=117.2

Q ss_pred             cCCChhHHH---------HHHHHhhhhhHhhhhhhhcCCCchhHHHHHHHHHHhHHHhhcCCCCceEEEEeccCCCHHHH
Q psy3103          38 AGMSPEDRT---------IIEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDI  108 (217)
Q Consensus        38 ~~l~~~~~~---------~~l~~v~l~vViDEiH~l~~~~RG~~lE~ll~RL~~l~~~~~~~~~~riv~LSATl~n~~~~  108 (217)
                      .++|||+|+         .+++++++ |||||+|+++| +||++||.+++|+++..  ...++++|+||||||+||++++
T Consensus       185 lVtTpEkld~llr~~~~~~~l~~v~~-vIiDEvH~l~d-~RG~~lE~~l~rl~~~~--~~~~~~~riI~LSATl~N~~dv  260 (1724)
T 4f92_B          185 IVCTPEKWDIITRKGGERTYTQLVRL-IILDEIHLLHD-DRGPVLEALVARAIRNI--EMTQEDVRLIGLSATLPNYEDV  260 (1724)
T ss_dssp             EEECHHHHHHHTTSSTTHHHHTTEEE-EEETTGGGGGS-TTHHHHHHHHHHHHHHH--HHHTCCCEEEEEECSCTTHHHH
T ss_pred             EEECHHHHHHHHcCCccchhhcCcCE-EEEecchhcCC-ccHHHHHHHHHHHHHHH--HhCCCCCcEEEEecccCCHHHH
Confidence            455788774         45778999 99999999998 69999999999987653  3346889999999999999999


Q ss_pred             HhhhcCCCCCeeeecCCCCccccceeEEEeecCCCCCchhHHHHHhhHHHHHHHHHhcCCCCeEEEeCChhHHHHHHHHH
Q psy3103         109 ALWLGFGKPTVYAQIDDSFRPVKLTKIVRGFPTKPSQSTFQFEMMLSYKLKSIIMQYSDNKPTLIFCATRKGVEHTCTIL  188 (217)
Q Consensus       109 a~wL~~~~~~~~~~~~~~~Rp~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVF~~sRk~~e~~A~~l  188 (217)
                      |+||+++++..++.|++++||+|+++++++.+.......+   ..+...++..+.....++|+||||+||+.|+.+|..|
T Consensus       261 A~wL~~~~~~~~~~~~~~~RPvpL~~~~~~~~~~~~~~~~---~~~~~~~~~~v~~~~~~~~~LVF~~sR~~~~~~A~~l  337 (1724)
T 4f92_B          261 ATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRF---QIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAI  337 (1724)
T ss_dssp             HHHTTCCHHHHEEECCGGGCSSCEEEECCEECCCCHHHHH---HHHHHHHHHHHTTCCSSCCEEEECSSTTTTHHHHHHH
T ss_pred             HHHhCCCCCCCeEEECCCCccCccEEEEeccCCcchhhhh---HHHHHHHHHHHHHHhcCCcEEEECCCHHHHHHHHHHH
Confidence            9999987666677899999999999988887765322211   2223334444444456789999999999999999999


Q ss_pred             HHhc
Q psy3103         189 RQEM  192 (217)
Q Consensus       189 ~~~~  192 (217)
                      .+.+
T Consensus       338 ~~~~  341 (1724)
T 4f92_B          338 RDMC  341 (1724)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            8654
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 217
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 7e-04
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 36.9 bits (84), Expect = 7e-04
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 62  HLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLG 113
           HLL  E RG  LE +V +MR      R ++ +R + +SAT PN+ +IA WL 
Sbjct: 148 HLLDSEKRGATLEILVTKMR------RMNKALRVIGLSATAPNVTEIAEWLD 193

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.37
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.31
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.3
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.25
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.25
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.23
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.22
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.19
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.14
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.1
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.79
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.69
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.69
d2p6ra4 201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.63
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.44
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.18
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.89
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 96.73
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.23
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 96.13
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 95.75
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 95.74
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.69
d1t5la2 181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.44
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 95.29
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 95.1
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 94.21
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.52
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 93.26
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.08
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 92.66
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.05
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 90.29
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 87.29
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 86.5
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.37  E-value=1.6e-13  Score=108.44  Aligned_cols=68  Identities=32%  Similarity=0.544  Sum_probs=59.7

Q ss_pred             HHHHhhhhhHhhhhhhhcCCCchhHHHHHHHHHHhHHHhhcCCCCceEEEEeccCCCHHHHHhhhcCCCCCeeeecCCCC
Q psy3103          48 IEQLFRSGYLMILVHLLGEESRGPVLEAVVCRMRTVQKSQRASQPIRFVAVSATIPNIYDIALWLGFGKPTVYAQIDDSF  127 (217)
Q Consensus        48 ~l~~v~l~vViDEiH~l~~~~RG~~lE~ll~RL~~l~~~~~~~~~~riv~LSATl~n~~~~a~wL~~~~~~~~~~~~~~~  127 (217)
                      .+.++++ ||+||+|.+.++.|+..++.++.+++..      +++.|+|+||||++|++++++||+++      .|.+++
T Consensus       135 ~~~~~~~-ii~DE~h~~~~~~r~~~~~~~l~~i~~~------~~~~~~l~lSATl~n~~~~~~~l~~~------~~~s~~  201 (202)
T d2p6ra3         135 WIKAVSC-LVVDEIHLLDSEKRGATLEILVTKMRRM------NKALRVIGLSATAPNVTEIAEWLDAD------YYVSDW  201 (202)
T ss_dssp             GGGGCCE-EEETTGGGGGCTTTHHHHHHHHHHHHHH------CTTCEEEEEECCCTTHHHHHHHTTCE------EEECCC
T ss_pred             hhhhhhh-ccccHHHHhcccccchHHHHHHHHHHhc------CCCCcEEEEcCCCCcHHHHHHHcCCC------eeeCCC
Confidence            4668899 9999999999999999999999998776      67899999999999999999999876      344555


Q ss_pred             c
Q psy3103         128 R  128 (217)
Q Consensus       128 R  128 (217)
                      |
T Consensus       202 ~  202 (202)
T d2p6ra3         202 R  202 (202)
T ss_dssp             C
T ss_pred             C
Confidence            4
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure