Psyllid ID: psy3123

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-----
MMEDELPILKSILKGNARYHNAPVRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQQWHGEDNSKSPTGSSWSDVTMEEVKSPLGSVSSTESVCSNEVATLNEYTSTHAQNAPLLAATLAGAQCPHRNRANSGSTTDGDRRFRKLDSPTDSGIESGTEKIEKHASAPTSVCSSPRSSFEEKDFNHVEDMPVLKRILQAPPLDTSSLMDEAYKPHKKFRALRQKDSAEAEPLHPSLASSHSMLAKSLMEGPRMTPDQLKRTEIVHNYIMRTDSPPSAYFPRSWHSSSVIKPAPPATVTSNALLELQVAATSQPLNLSKKTPPPSPRLSVVSLEA
cccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHcccccccHHHHccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHcHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHcEEccccEEEccccEEEEHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccccHHHHHHHcccccccccccccccccHccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccHcccHHHHHHHccccccccHHHHHHHcccHHHHHHHcccccccccccccHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccccccccccEEcccccccccccccccccccccEEEEcc
MMEDELPILKSILKgnaryhnapvrfgrvpKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRrarehptytacpstlacplnpnshplqGQQELLQDFSERFSPTIRDVVEFAKripgfsllchDDQVTLLKAGVFEVLLVRLACMfdsqtnsmiclngevlvrdsihssnaRFLMDSMFDFAERlnglhlsdteIGLFSSIVvispsrsglrnKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQqwhgednsksptgsswsdVTMEEVksplgsvsstesvcsNEVATLNEYTSTHAQNAPLLAATLAgaqcphrnransgsttdgdrrfrkldsptdsgiesgTEKIekhasaptsvcssprssfeekdfnhvedmPVLKRilqappldtsslmdeaykphkKFRAlrqkdsaeaeplhpslasSHSMLAKSlmegprmtpdqlkrTEIVHNYimrtdsppsayfprswhsssvikpappatvtSNALLELQVAAtsqplnlskktpppsprlsvvslea
MMEDELPILKSilkgnaryhnapvrfgrvpkREKARILAAmqqstntkcTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIvvispsrsglrnkeLVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQQWHGEDNSKSPTGSSWSDVTMEEVKSplgsvsstesVCSNEVATLNEYTSTHAQNAPLLAATLAGAQCPhrnransgsttdgdrrfrkldsptdsgiesgtekiekhasaptsvcssprssFEEKDFNHVEDMPVLKRILQAPPLDTSSLMDEAYKPHKKFRALRQKDSAEAEPLHPSLASSHSMLAKSLMegprmtpdqLKRTEIVHNYIMRTDSPPSAYFPRSWHSSSVIKPAPPATVTSNALLELQVAATsqplnlskktpppsprlsvvslea
MMEDELPILKSILKGNARYHNAPVRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEqqqqlaaqqqqWHGEDNSKSPTGSSWSDVTMEEVKSPLGSVSSTESVCSNEVATLNEYTSTHAQNAPLLAATLAGAQCPHRNRANSGSTTDGDRRFRKLDSPTDSGIESGTEKIEKHASAPTSVCSSPRSSFEEKDFNHVEDMPVLKRILQAPPLDTSSLMDEAYKPHKKFRALRQKDSAEAEPLHPSLASSHSMLAKSLMEGPRMTPDQLKRTEIVHNYIMRTDSPPSAYFPRSWHSSSVIKPAPPATVTSNALLELQVAATSQPLNLSKKTpppsprlsvvslEA
********LKSILKGNARYHNAPVRFGR**********************************RMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACP****************DFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISP****************KLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAF***********************************************************************LLAA************************************************************************************************************************************************IVHNYIM*****************************************************************
***DELPILKSILKGNARYHN*****************************************RMLSTVVRAHLDTCAFTADKIEPML********************************LLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQ************************************************************AATL**********************************************************************PVLKRILQAPPLDTSSLMDEAYKPHK*********************************************EIVHNYI**************************************************************S***
MMEDELPILKSILKGNARYHNAPVRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMT****************************DVTM*****************SNEVATLNEYTSTHAQNAPLLAATLAGAQCPHR***********DRRFRKLDSP*******************************EKDFNHVEDMPVLKRILQAPPLDTSSLMDEAYKPHKKFRALRQKDSAEAEPLHPSLASSHSMLAKSLMEGPRMTPDQLKRTEIVHNYIMRTDSPPSAYFPRSWHSSSVIKPAPPATVTSNALLELQVAATSQPLN*******************
***DELPILKSILKGNARYHNAPVRFGRVPKREKARILAAMQQ************AELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQQWHGE****************************************************************************************************************************VEDMPVLKRILQAPPLDTSSLMDEAYKPHKKFRALRQ**************************GPRMTPDQLKRTEIVHNYIMRTDSPPSAYFPRSWHSSSVIKPAP******NALLELQVAATSQPLNL***********S******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMEDELPILKSILKGNARYHNAPVRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQQWHGEDNSKSPTGSSWSDVTMEEVKSPLGSVSSTESVCSNEVATLNEYTSTHAQNAPLLAATLAGAQCPHRNRANSGSTTDGDRRFRKLDSPTDSGIESGTEKIEKHASAPTSVCSSPRSSFEEKDFNHVEDMPVLKRILQAPPLDTSSLMDEAYKPHKKFRALRQKDSAEAEPLHPSLASSHSMLAKSLMEGPRMTPDQLKRTEIVHNYIMRTDSPPSAYFPRSWHSSSVIKPAPPATVTSNALLELQVAATSQPLNLSKKTPPPSPRLSVVSLEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query585 2.2.26 [Sep-21-2011]
P50239711 Ecdysone-inducible protei N/A N/A 0.875 0.720 0.493 1e-133
Q08893699 Ecdysone-inducible protei N/A N/A 0.878 0.735 0.5 1e-131
O01639690 Ecdysone-inducible protei N/A N/A 0.861 0.730 0.490 1e-129
O77245606 Nuclear hormone receptor N/A N/A 0.670 0.646 0.531 1e-110
P17671 1199 Ecdysone-induced protein no N/A 0.606 0.296 0.536 1e-105
P17672 1355 Ecdysone-induced protein no N/A 0.606 0.261 0.536 1e-105
P13055 1412 Ecdysone-induced protein no N/A 0.606 0.251 0.536 1e-105
Q63504578 Nuclear receptor subfamil yes N/A 0.331 0.335 0.448 1e-43
Q14995579 Nuclear receptor subfamil yes N/A 0.331 0.335 0.448 3e-43
Q60674576 Nuclear receptor subfamil yes N/A 0.331 0.336 0.443 7e-43
>sp|P50239|E75_GALME Ecdysone-inducible protein E75 OS=Galleria mellonella GN=E75 PE=2 SV=1 Back     alignment and function desciption
 Score =  475 bits (1223), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 300/608 (49%), Positives = 379/608 (62%), Gaps = 96/608 (15%)

Query: 24  VRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKI 83
           VRFGRVPKREKARILAAMQ ST T+  E+A AAELDD  R+L+ VVRAHLDTC FT D++
Sbjct: 118 VRFGRVPKREKARILAAMQSST-TRAHEQAAAAELDDGPRLLARVVRAHLDTCEFTRDRV 176

Query: 84  EPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIP 143
             M   AR+ PTY+    TLACPLNP    LQ ++E    FS+RF+  IR V++FA  IP
Sbjct: 177 AAMRNGARDCPTYSQ--PTLACPLNPAPE-LQSEKE----FSQRFAHVIRGVIDFAGLIP 229

Query: 144 GFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHS-SNARFLM 202
           GF LL  DD+ TLLK+G+F+ L VRL CMFD+  NS+ICLNG+++ RDSI S +NARFL+
Sbjct: 230 GFQLLTQDDKFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANARFLV 289

Query: 203 DSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQN 262
           DS F FAER+N ++L+D EIGLF +IV+I+P R GLRN ELVERM  +L++ L  V+ QN
Sbjct: 290 DSTFKFAERMNSMNLTDAEIGLFCAIVLITPDRPGLRNVELVERMHSRLKSCLQTVIAQN 349

Query: 263 HPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQQWHGEDNSKSPTGS 322
             +      EL+  LPDLRTL+ LH+EKLV F+ TE ++ L  +QQ W  ++      G+
Sbjct: 350 RSDGPGFLRELMDTLPDLRTLSTLHTEKLVVFR-TEHKELL--RQQMWVEDE------GA 400

Query: 323 SWSDVTMEE-VKSPLGSVSSTESVCSNEVATLNEYTSTHAQNAPLLAATLAGAQCPHRNR 381
            W+D   ++  +SP+GSVSS+ES             +T     PLLAATLAG     R R
Sbjct: 401 LWADSGADDSARSPIGSVSSSESS-----------ETTGDCGTPLLAATLAG-----RRR 444

Query: 382 ANSGSTTDGDR--------------------RFRKLDSPTDSGIESGTEKIEKHASAPTS 421
            +S  + D +                     R+RKLDSPTDSGIESG EK E+    P S
Sbjct: 445 LDSRGSVDEEALGVAHLAHNGLTVTPVRPPPRYRKLDSPTDSGIESGNEKHER-IVGPES 503

Query: 422 VCSSPRSSFEE-----KDFNHVEDMPVLKRILQAPPL-DTSSLMDEAYKPHKKFRALRQK 475
            CSSPRSS EE     +     +DMPVLKR+LQAPPL D SSLMDEAYKPHKKFRA+R+ 
Sbjct: 504 GCSSPRSSLEEHSDDRRPIAPADDMPVLKRVLQAPPLYDASSLMDEAYKPHKKFRAMRRD 563

Query: 476 DSAEAE-----------------------------PLHPSLASSHSMLAKSLMEGPRMTP 506
             +EAE                             P+   L+S+HS+LAKSLMEGPRMTP
Sbjct: 564 TWSEAEARPGRPTPSPQPPHHPHPASPAHPAHSPRPIRAPLSSTHSVLAKSLMEGPRMTP 623

Query: 507 DQLKRTEIVHNYIMR--TDSPPSAYFPRSWHSSSVIKPAPPATVTSNALLELQVAATS-- 562
           +QLKRT+I+  Y+ R  T +P      R+    +  + A PA     A L++ VA T   
Sbjct: 624 EQLKRTDIIQQYMRRGETGAPTEGCPLRAGGLLTCFRGASPAPQPVIA-LQVDVAETDAP 682

Query: 563 QPLNLSKK 570
           QPLNLSKK
Sbjct: 683 QPLNLSKK 690
Orphan receptor possibly involved in the regulation of genes in the ecdysteroid cascade.
Galleria mellonella (taxid: 7137)
>sp|Q08893|E75_MANSE Ecdysone-inducible protein E75 OS=Manduca sexta GN=E75 PE=2 SV=2 Back     alignment and function description
>sp|O01639|E75_CHOFU Ecdysone-inducible protein E75 OS=Choristoneura fumiferana GN=E75 PE=2 SV=1 Back     alignment and function description
>sp|O77245|E75_METEN Nuclear hormone receptor E75 OS=Metapenaeus ensis GN=E75 PE=2 SV=1 Back     alignment and function description
>sp|P17671|E75BC_DROME Ecdysone-induced protein 75B, isoforms C/D OS=Drosophila melanogaster GN=Eip75B PE=2 SV=2 Back     alignment and function description
>sp|P17672|E75BA_DROME Ecdysone-induced protein 75B, isoform A OS=Drosophila melanogaster GN=Eip75B PE=2 SV=2 Back     alignment and function description
>sp|P13055|E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster GN=Eip75B PE=2 SV=2 Back     alignment and function description
>sp|Q63504|NR1D2_RAT Nuclear receptor subfamily 1 group D member 2 OS=Rattus norvegicus GN=Nr1d2 PE=2 SV=1 Back     alignment and function description
>sp|Q14995|NR1D2_HUMAN Nuclear receptor subfamily 1 group D member 2 OS=Homo sapiens GN=NR1D2 PE=1 SV=3 Back     alignment and function description
>sp|Q60674|NR1D2_MOUSE Nuclear receptor subfamily 1 group D member 2 OS=Mus musculus GN=Nr1d2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query585
187468484 854 ecdysone inducible protein 75 [Blattella 0.895 0.613 0.637 0.0
307176559 708 Nuclear hormone receptor E75 [Camponotus 0.887 0.733 0.649 0.0
322795547 761 hypothetical protein SINV_11306 [Solenop 0.887 0.681 0.646 0.0
340721158 757 PREDICTED: ecdysone-induced protein 75B, 0.882 0.681 0.648 0.0
270014294 897 E75 nuclear receptor [Tribolium castaneu 0.969 0.632 0.6 0.0
189240947 771 PREDICTED: similar to ecdysone inducible 0.953 0.723 0.601 0.0
144687066 690 ecdysone response nuclear receptor E75A 0.935 0.792 0.653 0.0
144687068636 ecdysone response nuclear receptor E75B 0.935 0.860 0.651 0.0
187468482 985 ecdysone inducible protein 75 [Blattella 0.858 0.509 0.633 0.0
242010552 848 ecdysone-induced protein 75B, putative [ 0.858 0.591 0.651 0.0
>gi|187468484|emb|CAM97374.1| ecdysone inducible protein 75 [Blattella germanica] Back     alignment and taxonomy information
 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/634 (63%), Positives = 455/634 (71%), Gaps = 110/634 (17%)

Query: 2   MEDELPILKSILKGNARYHNAPVRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDE 61
           M+DELPILK IL G+ +YHNAPVRFGRVPKREKARILAAMQQS+N++  EKA+AAEL+DE
Sbjct: 1   MDDELPILKGILNGDVKYHNAPVRFGRVPKREKARILAAMQQSSNSRSQEKAVAAELEDE 60

Query: 62  QRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELL 121
           QR+LSTVVRAHLDTC FT +K+EPML RAR+ P+YTACP TLACPLNPN  PL GQQELL
Sbjct: 61  QRLLSTVVRAHLDTCDFTREKVEPMLARARDQPSYTACPPTLACPLNPNPQPLTGQQELL 120

Query: 122 QDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMI 181
           QDFS+RFSP IR VVEFAKRIPGF+LL  DDQVTLLKAGVFEVLLVRLACMFD+QTNSMI
Sbjct: 121 QDFSKRFSPAIRGVVEFAKRIPGFALLPQDDQVTLLKAGVFEVLLVRLACMFDAQTNSMI 180

Query: 182 CLNGEVLVRDSIH-SSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRN 240
           CLNG+VL R++IH SSNARFLMDSMFDFAERLN L LSD E+GLF S+VVI+P R GLRN
Sbjct: 181 CLNGQVLKREAIHNSSNARFLMDSMFDFAERLNSLRLSDAEVGLFCSVVVIAPDRPGLRN 240

Query: 241 KELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQ 300
            EL+ERM+GKL+  L  V++QNHP   N+C EL+  +PDLRTLN LHSEKL+AF+MTEQQ
Sbjct: 241 TELIERMQGKLKAALQMVVSQNHPGHANICHELMKKIPDLRTLNTLHSEKLLAFKMTEQQ 300

Query: 301 QQLAAQQQQ--W----HGEDNSKSPTG----SSWSDVTMEE-VKSPLGSVSSTESVCSNE 349
           Q    QQQQ  W      E NSKSP G    SS SDVTM+E VKSPLGSVSSTESVCS E
Sbjct: 301 QLQQQQQQQHLWGTSPEEESNSKSPAGSSSWSSSSDVTMDEAVKSPLGSVSSTESVCSGE 360

Query: 350 VATLNEYTSTH------AQNAPLLAATLAGAQCPHRNRANSGSTTDGD------------ 391
           VA+L EY   H      A +APLLAATLAG  CPHR+RANSGST+  D            
Sbjct: 361 VASLTEYQPNHHPVSHQASSAPLLAATLAGGICPHRHRANSGSTSGDDDMSGLPHHSHHG 420

Query: 392 --------------------RRF-RKLDSPTDSGIESGTEKIEK-------HASAPTSVC 423
                                RF RKLDSP+DSGIESGTEK++K         SAPTSVC
Sbjct: 421 LTITAVNPPSRQQPLMPQHHHRFQRKLDSPSDSGIESGTEKLDKLTSGGGSTGSAPTSVC 480

Query: 424 SSPRSSFEEKD----------FNHVEDMPVLKRILQAPPL-DTSSLMDEAYKPHKKFRAL 472
           SSPRSS E+KD           +H++DMPVLKR+LQAPPL DT+SLMDEAYKPHKKFRA 
Sbjct: 481 SSPRSSLEDKDEEKHHNGSSGSSHIDDMPVLKRVLQAPPLYDTNSLMDEAYKPHKKFRAC 540

Query: 473 RQKDSAEAEP-----------------------LHPSLASSH------------------ 491
           R KDSAEAEP                       LH  L S++                  
Sbjct: 541 RNKDSAEAEPMIVHVSPPPPSHPVPPQHHSSPQLHLHLTSNNHQSQSSTSSTSSSLSSTH 600

Query: 492 SMLAKSLMEGPRMTPDQLKRTEIVHNYIMRTDSP 525
           S LAKSLME PRMT +QLKRT+I+HNYIMR DSP
Sbjct: 601 STLAKSLMESPRMTAEQLKRTDIIHNYIMRADSP 634

Source: Blattella germanica

Species: Blattella germanica

Genus: Blattella

Family: Ectobiidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307176559|gb|EFN66046.1| Nuclear hormone receptor E75 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322795547|gb|EFZ18243.1| hypothetical protein SINV_11306 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340721158|ref|XP_003398992.1| PREDICTED: ecdysone-induced protein 75B, isoforms C/D-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|270014294|gb|EFA10742.1| E75 nuclear receptor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240947|ref|XP_971362.2| PREDICTED: similar to ecdysone inducible protein 75 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|144687066|gb|ABP02024.1| ecdysone response nuclear receptor E75A [Oncopeltus fasciatus] Back     alignment and taxonomy information
>gi|144687068|gb|ABP02025.1| ecdysone response nuclear receptor E75B [Oncopeltus fasciatus] Back     alignment and taxonomy information
>gi|187468482|emb|CAM97373.1| ecdysone inducible protein 75 [Blattella germanica] Back     alignment and taxonomy information
>gi|242010552|ref|XP_002426029.1| ecdysone-induced protein 75B, putative [Pediculus humanus corporis] gi|212510039|gb|EEB13291.1| ecdysone-induced protein 75B, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query585
FB|FBgn0000568 1412 Eip75B "Ecdysone-induced prote 0.608 0.252 0.516 8.9e-112
UNIPROTKB|G3V9L8508 Nr1d1 "Nuclear receptor subfam 0.331 0.381 0.433 9.3e-51
ZFIN|ZDB-GENE-050105-1637 nr1d1 "nuclear receptor subfam 0.331 0.304 0.443 1.3e-50
UNIPROTKB|G3V770614 Nr1d1 "Nuclear receptor subfam 0.331 0.315 0.433 2.1e-50
RGD|628827615 Nr1d1 "nuclear receptor subfam 0.331 0.315 0.433 2.3e-50
UNIPROTKB|Q14995579 NR1D2 "Nuclear receptor subfam 0.331 0.335 0.448 1.6e-49
MGI|MGI:2444210615 Nr1d1 "nuclear receptor subfam 0.331 0.315 0.433 2e-49
RGD|628828578 Nr1d2 "nuclear receptor subfam 0.331 0.335 0.448 2.6e-49
UNIPROTKB|Q08E02613 NR1D1 "Nuclear receptor subfam 0.331 0.316 0.433 5.7e-49
UNIPROTKB|I3LL46573 NR1D2 "Uncharacterized protein 0.331 0.338 0.443 1.1e-48
FB|FBgn0000568 Eip75B "Ecdysone-induced protein 75B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 890 (318.4 bits), Expect = 8.9e-112, Sum P(3) = 8.9e-112
 Identities = 200/387 (51%), Positives = 264/387 (68%)

Query:    24 VRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKI 83
             VRFGRVPKREKARILAAMQQST  +  ++ALA ELDD+ R+L+ V+RAHL+TC FT +K+
Sbjct:   529 VRFGRVPKREKARILAAMQQSTQNRGQQRALATELDDQPRLLAAVLRAHLETCEFTKEKV 588

Query:    84 EPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIP 143
               M +RAR+ P+Y+  P+ LACPLNP +  LQ +QE    FS+RF+  IR V++FA  IP
Sbjct:   589 SAMRQRARDCPSYSM-PTLLACPLNP-APELQSEQE----FSQRFAHVIRGVIDFAGMIP 642

Query:   144 GFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHS-SNARFLM 202
             GF LL  DD+ TLLKAG+F+ L VRL CMFDS  NS+ICLNG+V+ RD+I + +NARFL+
Sbjct:   643 GFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARFLV 702

Query:   203 DSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQN 262
             DS F+FAER+N ++L+D EIGLF +IV+I+P R GLRN EL+E+M  +L+  L +++ QN
Sbjct:   703 DSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQN 762

Query:   263 HPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEXXXXXXXXXXXWHGED--NS---- 316
              P+Q    A+L+  +PDLRTL+ LH+EKLV F+ TE           W  ED  NS    
Sbjct:   763 RPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFR-TEHKELLRQQM--WSMEDGNNSDGQQ 819

Query:   317 -KSPTGSSWSD-VTMEEVKSPLGSVSSTESV-------CSNEVATLNEYTSTHAQNAPL- 366
              KSP+GS W+D + +E  KSPLGSVSSTES         S++   ++  +    Q + L 
Sbjct:   820 NKSPSGS-WADAMDVEAAKSPLGSVSSTESADLDYGSPSSSQPQGVSLPSPPQQQPSALA 878

Query:   367 ----LAATLAGAQCPHRNRANSGSTTD 389
                 L A      CP RNRANSGS+ D
Sbjct:   879 SSAPLLAATLSGGCPLRNRANSGSSGD 905
GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;IDA;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;NAS
GO:0007591 "molting cycle, chitin-based cuticle" evidence=IMP;NAS
GO:0048477 "oogenesis" evidence=NAS
GO:0035072 "ecdysone-mediated induction of salivary gland cell autophagic cell death" evidence=NAS
GO:0018990 "ecdysis, chitin-based cuticle" evidence=IMP
GO:0007553 "regulation of ecdysteroid metabolic process" evidence=IMP
GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA
GO:0004887 "thyroid hormone receptor activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003707 "steroid hormone receptor activity" evidence=IEA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0020037 "heme binding" evidence=IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0035075 "response to ecdysone" evidence=IMP
GO:0010468 "regulation of gene expression" evidence=IDA
UNIPROTKB|G3V9L8 Nr1d1 "Nuclear receptor subfamily 1 group D member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050105-1 nr1d1 "nuclear receptor subfamily 1, group d, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3V770 Nr1d1 "Nuclear receptor subfamily 1 group D member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|628827 Nr1d1 "nuclear receptor subfamily 1, group D, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q14995 NR1D2 "Nuclear receptor subfamily 1 group D member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444210 Nr1d1 "nuclear receptor subfamily 1, group D, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628828 Nr1d2 "nuclear receptor subfamily 1, group D, member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E02 NR1D1 "Nuclear receptor subfamily 1 group D member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL46 NR1D2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query585
cd06940189 cd06940, NR_LBD_REV_ERB, The ligand binding domain 2e-90
cd06929174 cd06929, NR_LBD_F1, Ligand-binding domain of nucle 3e-54
cd06939241 cd06939, NR_LBD_ROR_like, The ligand binding domai 2e-47
cd06941195 cd06941, NR_LBD_DmE78_like, The ligand binding dom 4e-34
cd06157168 cd06157, NR_LBD, The ligand binding domain of nucl 1e-31
cd06954236 cd06954, NR_LBD_LXR, The ligand binding domain of 2e-31
cd06932259 cd06932, NR_LBD_PPAR, The ligand binding domain of 5e-31
cd06935243 cd06935, NR_LBD_TR, The ligand binding domain of t 5e-30
cd06937231 cd06937, NR_LBD_RAR, The ligand binding domain (LB 6e-30
smart00430163 smart00430, HOLI, Ligand binding domain of hormone 9e-29
cd06938231 cd06938, NR_LBD_EcR, The ligand binding domain (LB 8e-26
pfam00104186 pfam00104, Hormone_recep, Ligand-binding domain of 2e-25
cd06936221 cd06936, NR_LBD_Fxr, The ligand binding domain of 3e-24
cd06930165 cd06930, NR_LBD_F2, Ligand-binding domain of nucle 2e-19
cd06943207 cd06943, NR_LBD_RXR_like, The ligand binding domai 1e-18
cd06934226 cd06934, NR_LBD_PXR_like, The ligand binding domai 3e-18
cd06933238 cd06933, NR_LBD_VDR, The ligand binding domain of 5e-18
cd07348238 cd07348, NR_LBD_NGFI-B, The ligand binding domain 3e-15
cd06945239 cd06945, NR_LBD_Nurr1_like, The ligand binding dom 3e-15
cd06942191 cd06942, NR_LBD_Sex_1_like, The ligand binding dom 9e-15
cd06931222 cd06931, NR_LBD_HNF4_like, The ligand binding doma 3e-12
cd07072239 cd07072, NR_LBD_DHR38_like, Ligand binding domain 9e-11
cd07071238 cd07071, NR_LBD_Nurr1, The ligand binding domain o 1e-10
cd06948236 cd06948, NR_LBD_COUP-TF, Ligand binding domain of 5e-08
cd06952222 cd06952, NR_LBD_TR2_like, The ligand binding domai 1e-07
cd07068221 cd07068, NR_LBD_ER_like, The ligand binding domain 2e-06
cd06949235 cd06949, NR_LBD_ER, Ligand binding domain of Estro 6e-05
cd07069241 cd07069, NR_LBD_Lrh-1, The ligand binding domain o 0.002
>gnl|CDD|132738 cd06940, NR_LBD_REV_ERB, The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information 
 Score =  276 bits (708), Expect = 2e-90
 Identities = 94/192 (48%), Positives = 132/192 (68%), Gaps = 3/192 (1%)

Query: 105 CPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEV 164
            P      P +   E+ ++FS  F+P +R+VVEFAKRIPGF  L   DQVTLLKAG FEV
Sbjct: 1   SPYVD---PPKSGHEIWEEFSMSFTPAVREVVEFAKRIPGFRDLSQHDQVTLLKAGTFEV 57

Query: 165 LLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGL 224
           L+VR A +FD++  S+  L+G+    D +HS  A  L++SMFDF+E+LN L LSD E+GL
Sbjct: 58  LMVRFASLFDAKERSVTFLSGQKYSVDDLHSMGAGDLLNSMFDFSEKLNSLQLSDEEMGL 117

Query: 225 FSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLN 284
           F+++V++S  RSGL N  LVE ++  L   L  ++ +NHP + ++  +L+  LPDLRTLN
Sbjct: 118 FTAVVLVSADRSGLENVNLVEALQETLIRALRTLIAKNHPNEPSIFTKLLLKLPDLRTLN 177

Query: 285 QLHSEKLVAFQM 296
            LHSEKL+AF++
Sbjct: 178 NLHSEKLLAFKV 189

The ligand binding domain (LBD) of REV-ERB receptors: REV-ERBs are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. The LBD domain of REV-ERB is unusual in the nuclear receptor family by lacking the AF-2 region that is responsible for coactivator interaction. REV-ERBs act as constitutive repressors because of their inability to bind coactivators. REV-ERB receptors can bind to two classes of DNA response elements as either a monomer or heterodimer, indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target gene. The porphyrin heme has been demonstrated to function as a ligand for REV-ERB. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, REV-ERB receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 189
>gnl|CDD|132727 cd06929, NR_LBD_F1, Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>gnl|CDD|132737 cd06939, NR_LBD_ROR_like, The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132739 cd06941, NR_LBD_DmE78_like, The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>gnl|CDD|132752 cd06954, NR_LBD_LXR, The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>gnl|CDD|132730 cd06932, NR_LBD_PPAR, The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>gnl|CDD|132733 cd06935, NR_LBD_TR, The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>gnl|CDD|132735 cd06937, NR_LBD_RAR, The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors Back     alignment and domain information
>gnl|CDD|132736 cd06938, NR_LBD_EcR, The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone receptor Back     alignment and domain information
>gnl|CDD|132734 cd06936, NR_LBD_Fxr, The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132732 cd06934, NR_LBD_PXR_like, The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>gnl|CDD|132731 cd06933, NR_LBD_VDR, The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132762 cd07348, NR_LBD_NGFI-B, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>gnl|CDD|132743 cd06945, NR_LBD_Nurr1_like, The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132740 cd06942, NR_LBD_Sex_1_like, The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>gnl|CDD|132757 cd07072, NR_LBD_DHR38_like, Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132756 cd07071, NR_LBD_Nurr1, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>gnl|CDD|132747 cd06949, NR_LBD_ER, Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 585
cd06939241 NR_LBD_ROR_like The ligand binding domain of Retin 100.0
cd06932259 NR_LBD_PPAR The ligand binding domain of peroxisom 100.0
cd06937231 NR_LBD_RAR The ligand binding domain (LBD) of reti 100.0
cd06935243 NR_LBD_TR The ligand binding domain of thyroid hor 100.0
cd07348238 NR_LBD_NGFI-B The ligand binding domain of Nurr1, 100.0
cd07072239 NR_LBD_DHR38_like Ligand binding domain of DHR38_l 100.0
cd07071238 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a 100.0
cd06945239 NR_LBD_Nurr1_like The ligand binding domain of Nur 100.0
cd06933238 NR_LBD_VDR The ligand binding domain of vitamin D 100.0
cd06954236 NR_LBD_LXR The ligand binding domain of Liver X re 100.0
cd06941195 NR_LBD_DmE78_like The ligand binding domain of Dro 100.0
cd06934226 NR_LBD_PXR_like The ligand binding domain of xenob 100.0
cd06940189 NR_LBD_REV_ERB The ligand binding domain of REV-ER 100.0
cd06949235 NR_LBD_ER Ligand binding domain of Estrogen recept 100.0
cd06938231 NR_LBD_EcR The ligand binding domain (LBD) of the 100.0
cd06936221 NR_LBD_Fxr The ligand binding domain of Farnesoid 100.0
KOG4216|consensus479 100.0
cd07069241 NR_LBD_Lrh-1 The ligand binding domain of the live 100.0
cd07068221 NR_LBD_ER_like The ligand binding domain of estrog 100.0
cd06944237 NR_LBD_Ftz-F1_like The ligand binding domain of FT 100.0
cd07076247 NR_LBD_GR Ligand binding domain of the glucocortic 100.0
cd06946221 NR_LBD_ERR The ligand binding domain of estrogen r 100.0
cd07070237 NR_LBD_SF-1 The ligand binding domain of nuclear r 100.0
cd06947246 NR_LBD_GR_Like Ligand binding domain of nuclear ho 100.0
cd07073246 NR_LBD_AR Ligand binding domain of the nuclear rec 100.0
KOG4217|consensus605 100.0
cd07349222 NR_LBD_SHP The ligand binding domain of DAX1 prote 100.0
cd06951222 NR_LBD_Dax1_like The ligand binding domain of DAX1 100.0
cd07075248 NR_LBD_MR Ligand binding domain of the mineralocor 100.0
cd06948236 NR_LBD_COUP-TF Ligand binding domain of chicken ov 100.0
cd07350232 NR_LBD_Dax1 The ligand binding domain of DAX1 prot 100.0
cd06929174 NR_LBD_F1 Ligand-binding domain of nuclear recepto 100.0
cd06950206 NR_LBD_Tlx_PNR_like The ligand binding domain of T 100.0
cd06942191 NR_LBD_Sex_1_like The ligand binding domain of Cae 100.0
cd06943207 NR_LBD_RXR_like The ligand binding domain of the r 100.0
cd06931222 NR_LBD_HNF4_like The ligand binding domain of hept 99.97
cd06952222 NR_LBD_TR2_like The ligand binding domain of the o 99.97
cd06953213 NR_LBD_DHR4_like The ligand binding domain of orph 99.97
cd06930165 NR_LBD_F2 Ligand-binding domain of nuclear recepto 99.96
cd07074248 NR_LBD_PR Ligand binding domain of the progesteron 99.96
KOG4215|consensus432 99.96
PF00104203 Hormone_recep: Ligand-binding domain of nuclear ho 99.93
cd06157168 NR_LBD The ligand binding domain of nuclear recept 99.9
smart00430163 HOLI Ligand binding domain of hormone receptors. 99.89
KOG4218|consensus475 99.76
KOG4846|consensus538 99.57
cd0696895 NR_DBD_ROR DNA-binding domain of Retinoid-related 93.22
KOG4846|consensus538 93.15
cd0696584 NR_DBD_Ppar DNA-binding domain of peroxisome proli 90.07
cd0716689 NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep 83.94
>cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information 
Probab=100.00  E-value=3.8e-42  Score=347.28  Aligned_cols=235  Identities=34%  Similarity=0.591  Sum_probs=208.4

Q ss_pred             HHHHHHHHHHHhhhcccChhhhhhhhhhhhcCCCCcCCCCCCCCCCCCCCCCCccchHHHHHHHHHhhhHHHHHHHHhhh
Q psy3123          61 EQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAK  140 (585)
Q Consensus        61 ~~~Li~~Iv~Ah~~tc~~T~ekvr~~l~~~~~~~~~~~~~~~~~c~l~~~~~~~~~r~e~~~~~~e~~~~~I~~vVeFAK  140 (585)
                      .+.++..+++||.+||+|+.++++.+..+.     |....  ..      .....++.++|++|++.++..|+.+|+|||
T Consensus         3 ~~~l~~~v~~ah~~~~~~~~~~~~~~~~~~-----~~~~~--~~------~~~~~~~~~~~~~~~~~~t~~i~~vVefAK   69 (241)
T cd06939           3 LEHLAQNICKAHLETCQYLREELQQLRWKT-----FSQEE--IL------AYQNKSREEMWQLCAEKITEAIQYVVEFAK   69 (241)
T ss_pred             HHHHHHHHHHHHHHHccCcHHHHHHHhcCc-----CCccc--cc------ccccccHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            356889999999999999999988884432     11100  00      112345789999999999999999999999


Q ss_pred             cCCCCccccchhhHHHHHHHHHHHHHHHHHhhccCCCceeEecCCeeecchhhcccchHHHHHHHHHHHHHHhhcCCChh
Q psy3123         141 RIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDT  220 (585)
Q Consensus       141 ~LPgF~~Ls~eDQi~LLK~s~~ElllLr~A~r~~~~~~~ll~~nG~~i~rd~l~~~~~~~li~~m~~f~~~L~~LqLde~  220 (585)
                      +||||.+|+++||++|||+||+|+++|++|++|+..++.+.+ +|.+++++.++..+..++++.+++|+.+|+.|+||++
T Consensus        70 ~IPgF~~L~~~DQi~LLk~~~~Ellll~~a~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~f~~~l~~L~ld~~  148 (241)
T cd06939          70 RIPGFMELCQNDQIVLLKAGSLEVVLVRMSRAFNPSNNTVLF-DGKYAPIDLFKSLGCDDLISAVFDFAKSLCELKLTED  148 (241)
T ss_pred             cCCCcccCCHHHHHHHHHHhHHHHHHHHHHHHhCCCCCEEEE-CCccccHHHHHHcCcHHHHHHHHHHHHHHHhcCCCHH
Confidence            999999999999999999999999999999999998888776 5667788877766677889999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCCCCcHHHHHHHHHHHHHHHHHHHHhcCCCchhHHHHHHHhhHHHHHHHHHHHHHHHHHhhccc-
Q psy3123         221 EIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQ-  299 (585)
Q Consensus       221 E~ALLkAIvLfsPDr~GLsd~~~Ve~lQer~l~aL~~yi~~~~p~~p~RF~kLLllLp~LR~Ls~~h~E~L~~~kl~~~-  299 (585)
                      ||+||+||+||+|||+||.+...|+++|+++..+|+.|+..+| +.+.||++||++||+||+++..|.|.++++|+... 
T Consensus       149 E~all~AivL~~pDr~gL~~~~~Ve~lQe~~~~aL~~yi~~~~-~~~~rf~kLL~~Lp~LR~l~~~~~e~l~~~k~~~p~  227 (241)
T cd06939         149 EIALFSALVLISADRPGLQEKRKVEKLQQKIELALRHVLQKNH-GDDTILTKLLAKMPTLRALCSLHMEKLQKFKQSYPD  227 (241)
T ss_pred             HHHHHHHHHHhcCCCcCCCCHHHHHHHHHHHHHHHHHHHHHhC-CCccHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCC
Confidence            9999999999999999999999999999999999999999999 88999999999999999999999999999999854 


Q ss_pred             ---cchhHHHHHHh
Q psy3123         300 ---QQQLAAQQQQW  310 (585)
Q Consensus       300 ---i~l~~Ll~Emf  310 (585)
                         ..+|+|++|||
T Consensus       228 ~~~~~~ppL~~Elf  241 (241)
T cd06939         228 IVHLEFPPLYKELF  241 (241)
T ss_pred             cccCCCCcHHHhhC
Confidence               36899999997

The ligand binding domain (LBD) of Retinoid-related orphan receptors (RORs): Retinoid-related orphan receptors (RORs) are transcription factors belonging to the nuclear receptor superfamily. RORs are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. Transcription regulation by RORs is mediated through certain corepressors, as well as coactivators. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma that differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum, particularly in the regulation of the maturation and survival of Purkinje cells. RORbeta expression is largely r
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information
>KOG4217|consensus Back     alignment and domain information
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>KOG4215|consensus Back     alignment and domain information
>PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>smart00430 HOLI Ligand binding domain of hormone receptors Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query585
3cqv_A199 Crystal Structure Of Reverb Beta In Complex With He 4e-43
2v0v_A194 Crystal Structure Of Rev-Erb Beta Length = 194 1e-42
2v7c_A194 Crystal Structure Of Rev-Erb Beta Length = 194 1e-42
3n00_A245 Crystal Structure Of A Deletion Mutant Of Human Rev 1e-38
1n4h_A259 Characterization Of Ligands For The Orphan Nuclear 3e-29
1k4w_A252 X-Ray Structure Of The Orphan Nuclear Receptor Ror 4e-29
1nq7_A244 Characterization Of Ligands For The Orphan Nuclear 4e-29
1n83_A270 Crystal Structure Of The Complex Between The Orphan 5e-29
3l0l_A248 Crystal Structure Of Orphan Nuclear Receptor Rorgam 3e-23
3kyt_A243 Crystal Structure Of Orphan Nuclear Receptor Rorgam 4e-23
3dzu_D419 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 6e-22
1xdk_B303 Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN 1e-21
1xap_A267 Structure Of The Ligand Binding Domain Of The Retin 2e-21
1fcx_A235 Isotype Selectivity Of The Human Retinoic Acid Nucl 3e-20
1fcy_A236 Isotype Selectivity Of The Human Retinoic Acid Nucl 3e-20
2lbd_A267 Ligand-Binding Domain Of The Human Retinoic Acid Re 3e-20
1exa_A246 Enantiomer Discrimination Illustrated By Crystal St 3e-20
2q59_A274 Crystal Structure Of Ppargamma Lbd Bound To Full Ag 7e-20
3et0_A292 Structure Of Ppargamma With 3-(5-Methoxy-1h-Indol-3 9e-20
1i7g_A287 Crystal Structure Of The Ligand Binding Domain From 1e-19
2zvt_A286 Cys285ser Mutant Ppargamma Ligand-Binding Domain Co 1e-19
3lmp_A283 Crystal Structure Of The Ppargamma-Lbd Complexed Wi 1e-19
3cs8_A275 Structural And Biochemical Basis For The Binding Se 1e-19
1k74_D283 The 2.3 Angstrom Resolution Crystal Structure Of Th 1e-19
3s9s_A284 Ligand Binding Domain Of Ppargamma Complexed With A 1e-19
2q59_B274 Crystal Structure Of Ppargamma Lbd Bound To Full Ag 1e-19
3ads_A287 Human Ppargamma Ligand-Binding Domain In Complex Wi 1e-19
3sp6_A285 Structural Basis For Iloprost As A Dual PparalphaDE 1e-19
2vv4_B276 Hppargamma Ligand Binding Domain In Complex With 6- 1e-19
1i7i_A292 Crystal Structure Of The Ligand Binding Domain Of H 1e-19
1fm6_D272 The 2.1 Angstrom Resolution Crystal Structure Of Th 1e-19
3vn2_A285 Crystal Structure Of Ppargamma Complexed With Telmi 1e-19
2i4j_A286 Crystal Structure Of The Complex Between Ppargamma 1e-19
1zeo_A277 Crystal Structure Of Human Ppar-Gamma Ligand Bindin 1e-19
3osi_A285 Crystal Structure Of Ppargamma Ligand Binding Domai 1e-19
3bc5_A296 X-Ray Crystal Structure Of Human Ppar Gamma With 2- 1e-19
1rdt_D284 Crystal Structure Of A New Rexinoid Bound To The Rx 1e-19
3pba_A286 Crystal Structure Of Ppargamma Ligand Binding Domai 1e-19
3prg_A278 Ligand Binding Domain Of Human Peroxisome Prolifera 1e-19
2vv1_B276 Hppargamma Ligand Binding Domain In Complex With 4- 1e-19
2vsr_A276 Hppargamma Ligand Binding Domain In Complex With 9- 1e-19
2hfp_A282 Crystal Structure Of Ppar Gamma With N-Sulfonyl-2-I 1e-19
2om9_A278 Ajulemic Acid, A Synthetic Cannabinoid Bound To Ppa 1e-19
1nyx_A276 Ligand Binding Domain Of The Human Peroxisome Proli 1e-19
2rew_A277 Crystal Structure Of Pparalpha Ligand Binding Domai 1e-19
1wm0_X292 Ppargamma In Complex With A 2-Baba Compound Length 1e-19
3t03_A284 Crystal Structure Of Ppar Gamma Ligand Binding Doma 1e-19
3b0q_A274 Human Ppar Gamma Ligand Binding Domain In Complex W 1e-19
1knu_A274 Ligand Binding Domain Of The Human Peroxisome Proli 1e-19
1k7l_A288 The 2.5 Angstrom Resolution Crystal Structure Of Th 2e-19
3et1_A291 Structure Of Pparalpha With 3-[5-Methoxy-1-(4-Metho 2e-19
3r8a_A282 X-Ray Crystal Structure Of The Nuclear Hormone Rece 2e-19
3et3_A292 Structure Of Ppargamma With 3-[5-Methoxy-1-(4-Metho 2e-19
2znn_A273 Human Pprr Alpha Ligand Binding Domain In Complex W 2e-19
2prg_A271 Ligand-Binding Domain Of The Human Peroxisome Proli 2e-19
3g8i_A270 Aleglitazar, A New, Potent, And Balanced Ppar Alpha 2e-19
2npa_A270 The Crystal Structure Of The Human Pparaplpha Ligan 2e-19
4prg_A270 0072 Partial Agonist Ppar Gamma Cocrystal Length = 2e-19
3u9q_A269 Ligand Binding Domain Of Ppargamma Complexed With D 2e-19
3cwd_A270 Molecular Recognition Of Nitro-Fatty Acids By Ppar 2e-19
1kkq_A269 Crystal Structure Of The Human Ppar-Alpha Ligand-Bi 2e-19
2p54_A267 A Crystal Structure Of Ppar Alpha Bound With Src1 P 2e-19
3a9e_B269 Crystal Structure Of A Mixed Agonist-Bound Rar-Alph 2e-19
3kmr_A266 Crystal Structure Of Raralpha Ligand Binding Domain 2e-19
4dqm_A234 Revealing A Marine Natural Product As A Novel Agoni 2e-19
1dkf_B235 Crystal Structure Of A Heterodimeric Complex Of Rar 3e-19
3ipq_A283 X-Ray Structure Of Gw3965 Synthetic Agonist Bound T 3e-19
1r20_D265 Crystal Structure Of The Ligand-Binding Domains Of 3e-19
2b50_A272 Human Nuclear Receptor-Ligand Complex 2 Length = 27 3e-19
3et2_A287 Structure Of Ppardelta With 3-[5-Methoxy-1-(4-Metho 3e-19
2q5g_A283 Ligand Binding Domain Of Ppar Delta Receptor In Com 3e-19
2xyj_A288 Novel Sulfonylthiadiazoles With An Unusual Binding 4e-19
2znp_A276 Human Pprr Delta Ligand Binding Domain In Complex W 4e-19
1y0s_A272 Crystal Structure Of Ppar Delta Complexed With Gw23 4e-19
2awh_A268 Human Nuclear Receptor-Ligand Complex 1 Length = 26 4e-19
2j14_A285 3,4,5-Trisubstituted Isoxazoles As Novel Ppardelta 4e-19
3sp9_A281 Structural Basis For Iloprost As A Dual PparalphaDE 4e-19
2gwx_A267 Molecular Recognition Of Fatty Acids By Peroxisome 4e-19
3tkm_A275 Crystal Structure Ppar Delta Binding Gw0742 Length 5e-19
1gwx_A271 Molecular Recognition Of Fatty Acids By Peroxisome 5e-19
1uhl_B242 Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero 9e-19
3gz9_A269 Crystal Structure Of Peroxisome Proliferator-Activa 9e-19
3fc6_B266 Hrxralpha & Mlxralpha With An Indole Pharmacophore, 2e-18
2acl_B244 Liver X-Receptor Alpha Ligand Binding Domain With S 3e-18
1r1k_D266 Crystal Structure Of The Ligand-Binding Domains Of 3e-18
3p88_A229 Fxr Bound To Isoquinolinecarboxylic Acid Length = 2 3e-18
3hc6_A232 Fxr With Src1 And Gsk088 Length = 232 3e-18
3gd2_A229 Isoxazole Ligand Bound To Farnesoid X Receptor (Fxr 4e-18
3p89_A229 Fxr Bound To A Quinolinecarboxylic Acid Length = 22 4e-18
2nxx_E248 Crystal Structure Of The Ligand-Binding Domains Of 4e-18
3l0e_A253 X-Ray Crystal Structure Of A Potent Liver X Recepto 6e-18
3jzc_A263 Crystal Structure Of Tr-Beta Bound To The Selective 7e-18
1z5x_E310 Hemipteran Ecdysone Receptor Ligand-Binding Domain 1e-17
2h79_A269 Crystal Structure Of Human Tr Alpha Bound T3 In Ort 1e-17
3gws_X259 Crystal Structure Of T3-Bound Thyroid Hormone Recep 2e-17
3hzf_A269 Structure Of Tr-alfa Bound To Selective Thyromimeti 2e-17
3jzb_A267 Crystal Structure Of Tr-Alfa Bound To The Selective 2e-17
3imy_A261 Structure Of Tr-Beta Bound To Selective Thyromimeti 2e-17
3p8x_A280 Synthesis, Structure, And Biological Activity Of De 2e-17
1db1_A259 Crystal Structure Of The Nuclear Receptor For Vitam 2e-17
1nq0_A263 Tr Receptor Mutations Conferring Hormone Resistance 2e-17
1nq1_A263 Tr Receptor Mutations Conferring Hormone Resistance 2e-17
3b0t_A254 Human Vdr Ligand Binding Domain In Complex With Max 2e-17
1r6g_A259 Crystal Structure Of The Thyroid Hormone Receptor B 2e-17
3az1_A253 Crystal Structure Analysis Of Vitamin D Receptor Le 2e-17
1s0z_A263 Crystal Structure Of The Vdr Lbd Complexed To Seoca 2e-17
1nax_A252 Thyroid Receptor Beta1 In Complex With A Beta-Selec 2e-17
1n46_A258 Crystal Structure Of Human Tr Beta Ligand-Binding D 2e-17
1bsx_A260 Structure And Specificity Of Nuclear Receptor-Coact 2e-17
1q4x_A253 Crystal Structure Of Human Thyroid Hormone Receptor 2e-17
1rjk_A292 Crystal Structure Of The Rat Vitamin D Receptor Lig 2e-17
1xzx_X281 Thyroxine-Thyroid Hormone Receptor Interactions Len 2e-17
2zl9_A271 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26 2e-17
3m7r_A253 Crystal Structure Of Vdr H305q Mutant Length = 253 2e-17
2h77_A269 Crystal Structure Of Human Tr Alpha Bound T3 In Mon 3e-17
3uvv_A265 Crystal Structure Of The Ligand Binding Domains Of 3e-17
3fxv_A233 Identification Of An N-Oxide Pyridine Gw4064 Analog 3e-17
2zfx_A265 Crystal Structure Of The Rat Vitamin D Receptor Lig 4e-17
3bej_A238 Structure Of Human Fxr In Complex With Mfa-1 And Co 5e-17
1nav_A263 Thyroid Receptor Alpha In Complex With An Agonist S 5e-17
3dct_A235 Fxr With Src1 And Gw4064 Length = 235 5e-17
3a2i_A263 Crystal Structure Of The Human Vitamin D Receptor ( 5e-17
1nq2_A264 Two Rth Mutants With Impaired Hormone Binding Lengt 5e-17
3hc5_A232 Fxr With Src1 And Gsk826 Length = 232 6e-17
3l1b_A233 Complex Structure Of Fxr Ligand-Binding Domain With 6e-17
1osh_A232 A Chemical, Genetic, And Structural Analysis Of The 6e-17
3fli_A231 Discovery Of Xl335, A Highly Potent, Selective And 6e-17
3rut_A229 Fxr With Src1 And Gsk359 Length = 229 6e-17
1upv_A257 Crystal Structure Of The Human Liver X Receptor Bet 7e-17
1p8d_A250 X-Ray Crystal Structure Of Lxr Ligand Binding Domai 7e-17
1pq6_A253 Human Lxr Beta Hormone Receptor / Gw3965 Complex Le 9e-17
2j4a_A253 Human Thyroid Hormone Receptor Beta Ligand Binding 9e-17
4dk8_A247 Crystal Structure Of Lxr Ligand Binding Domain In C 9e-17
1nuo_A261 Two Rth Mutants With Impaired Hormone Binding Lengt 1e-16
1osv_A230 Structural Basis For Bile Acid Binding And Activati 1e-16
1ot7_A229 Structural Basis For 3-Deoxy-Cdca Binding And Activ 1e-16
3d57_A266 Tr Variant D355r Length = 266 2e-16
2pin_A253 Thyroid Receptor Beta In Complex With Inhibitor Len 2e-16
3dzu_A467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 3e-16
4dk7_A247 Crystal Structure Of Lxr Ligand Binding Domain In C 4e-16
1xnx_A256 Crystal Structure Of Constitutive Androstane Recept 5e-16
3a2j_A263 Crystal Structure Of The Human Vitamin D Receptor ( 6e-16
1xls_E242 Crystal Structure Of The Mouse CarRXR LBD HETERODIM 6e-16
2hbh_A302 Crystal Structure Of Vitamin D Nuclear Receptor Lig 9e-16
4fhh_A300 Development Of Synthetically Accessible Non-Secoste 1e-15
1lbd_A282 Ligand-Binding Domain Of The Human Nuclear Receptor 1e-15
3a9e_A240 Crystal Structure Of A Mixed Agonist-Bound Rar-Alph 1e-15
1mv9_A240 Crystal Structure Of The Human Rxr Alpha Ligand Bin 2e-15
3e94_A244 Crystal Structure Of Rxralpha Ligand Binding Domain 2e-15
1xdk_A238 Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN 2e-15
1rdt_A242 Crystal Structure Of A New Rexinoid Bound To The Rx 2e-15
1fby_A239 Crystal Structure Of The Human Rxr Alpha Ligand Bin 2e-15
1fm6_A238 The 2.1 Angstrom Resolution Crystal Structure Of Th 2e-15
3uvv_B244 Crystal Structure Of The Ligand Binding Domains Of 2e-15
3oap_A231 Crystal Structure Of Human Retinoid X Receptor Alph 2e-15
1xls_A232 Crystal Structure Of The Mouse CarRXR LBD HETERODIM 2e-15
3pcu_A230 Crystal Structure Of Human Retinoic X Receptor Alph 2e-15
1xv9_A236 Crystal Structure Of CarRXR HETERODIMER BOUND WITH 3e-15
2gl8_A241 Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi 3e-15
1uhl_A236 Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero 3e-15
3h0a_A228 Crystal Structure Of Peroxisome Proliferator-Activa 3e-15
1h9u_A224 The Structure Of The Human Retinoid-X-Receptor Beta 3e-15
3eyb_A219 Structural And Functional Insights Into The Ligand 4e-15
1dkf_A233 Crystal Structure Of A Heterodimeric Complex Of Rar 5e-15
1z5x_U262 Hemipteran Ecdysone Receptor Ligand-Binding Domain 1e-14
3ctb_A344 Tethered Pxr-LbdSRC-1p Apoprotein Length = 344 5e-13
1ilg_A316 Crystal Structure Of Apo Human Pregnane X Receptor 5e-13
1skx_A313 Structural Disorder In The Complex Of Human Pxr And 6e-13
2o9i_A293 Crystal Structure Of The Human Pregnane X Receptor 1e-12
1xiu_A230 Crystal Structure Of The Agonist-Bound Ligand-Bindi 3e-12
1xv9_B246 Crystal Structure Of CarRXR HETERODIMER BOUND WITH 2e-10
2q60_A258 Crystal Structure Of The Ligand Binding Domain Of P 2e-10
2nxx_A235 Crystal Structure Of The Ligand-Binding Domains Of 7e-10
1pdu_A244 Ligand-Binding Domain Of Drosophila Orphan Nuclear 2e-09
1ovl_A271 Crystal Structure Of Nurr1 Lbd Length = 271 3e-09
2qw4_A273 Human Nr4a1 Ligand-Binding Domain Length = 273 4e-09
1ovl_B271 Crystal Structure Of Nurr1 Lbd Length = 271 5e-09
3v3e_B257 Crystal Structure Of The Human Nur77 Ligand-Binding 5e-09
1yje_A264 Crystal Structure Of The Rngfi-B Ligand-Binding Dom 4e-08
1m7w_A250 Hnf4a Ligand Binding Domain With Bound Fatty Acid L 6e-05
3cjw_A244 Crystal Structure Of The Human Coup-Tfii Ligand Bin 8e-05
1hg4_A279 Ultraspiracle Ligand Binding Domain From Drosophila 1e-04
3up0_A243 Nuclear Receptor Daf-12 From Hookworm Ancylostoma C 1e-04
1lv2_A229 Hepatocyte Nuclear Factor 4 Is A Transcription Fact 1e-04
3gyt_A244 Nuclear Receptor Daf-12 From Parasitic Nematode Str 2e-04
1pzl_A237 Crystal Structure Of Hnf4a Lbd In Complex With The 2e-04
3fs1_A230 Crystal Structure Of Hnf4a Lbd In Complex With The 2e-04
3tx7_B352 Crystal Structure Of Lrh-1BETA-Catenin Complex Leng 3e-04
1kv6_A230 X-Ray Structure Of The Orphan Nuclear Receptor Err3 6e-04
2e2r_A244 Crystal Structure Of Human Estrogen-Related Recepto 6e-04
1vjb_A251 Crystal Structure Of The Ligand-Binding Domain Of T 6e-04
1s9q_A251 Crystal Structure Of The Ligand-Binding Domain Of T 6e-04
3os8_C258 Estrogen Receptor Length = 258 8e-04
1s9p_A227 Crystal Structure Of The Ligand-Binding Domain Of T 9e-04
>pdb|3CQV|A Chain A, Crystal Structure Of Reverb Beta In Complex With Heme Length = 199 Back     alignment and structure 
Iteration: 1

 Score =  172 bits (437), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 129/196 (65%), Gaps = 2/196 (1%)
Query: 103 LACPLN--PNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAG 160
           L CP +  P   P +   E+ ++FS  F+P +++VVEFAKRIPGF  L   DQV LLKAG
Sbjct: 2   LVCPXSKSPYVDPHKSGHEIWEEFSXSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAG 61
Query: 161 VFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDT 220
            FEVL VR A +FD++  ++  L+G+    D +HS  A  L++S F+F+E+LN L LSD 
Sbjct: 62  TFEVLXVRFASLFDAKERTVTFLSGKKYSVDDLHSXGAGDLLNSXFEFSEKLNALQLSDE 121
Query: 221 EIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDL 280
           E  LF+++V++S  RSG+ N   VE ++  L   L  ++ +NHP + ++  +L+  LPDL
Sbjct: 122 EXSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIXKNHPNEASIFTKLLLKLPDL 181
Query: 281 RTLNQLHSEKLVAFQM 296
           R+LN  HSE+L+AF++
Sbjct: 182 RSLNNXHSEELLAFKV 197
>pdb|2V0V|A Chain A, Crystal Structure Of Rev-Erb Beta Length = 194 Back     alignment and structure
>pdb|2V7C|A Chain A, Crystal Structure Of Rev-Erb Beta Length = 194 Back     alignment and structure
>pdb|3N00|A Chain A, Crystal Structure Of A Deletion Mutant Of Human Reverba Ligand Binding Domain Bound With An Ncor Id1 Peptide Determined To 2.60a Length = 245 Back     alignment and structure
>pdb|1N4H|A Chain A, Characterization Of Ligands For The Orphan Nuclear Receptor Rorbeta Length = 259 Back     alignment and structure
>pdb|1K4W|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Ror Beta Ligand-Binding Domain In The Active Conformation Length = 252 Back     alignment and structure
>pdb|1NQ7|A Chain A, Characterization Of Ligands For The Orphan Nuclear Receptor Rorbeta Length = 244 Back     alignment and structure
>pdb|1N83|A Chain A, Crystal Structure Of The Complex Between The Orphan Nuclear Hormone Receptor Ror(Alpha)-Lbd And Cholesterol Length = 270 Back     alignment and structure
>pdb|3L0L|A Chain A, Crystal Structure Of Orphan Nuclear Receptor Rorgamma In Com Natural Ligand Length = 248 Back     alignment and structure
>pdb|3KYT|A Chain A, Crystal Structure Of Orphan Nuclear Receptor Rorgamma In Com Natural Ligand Length = 243 Back     alignment and structure
>pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 Back     alignment and structure
>pdb|1XDK|B Chain B, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 303 Back     alignment and structure
>pdb|1XAP|A Chain A, Structure Of The Ligand Binding Domain Of The Retinoic Acid Receptor Beta Length = 267 Back     alignment and structure
>pdb|1FCX|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Bms184394 Length = 235 Back     alignment and structure
>pdb|1FCY|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The RarbetaGAMMA- Selective Retinoid Cd564 Length = 236 Back     alignment and structure
>pdb|2LBD|A Chain A, Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To All-Trans Retinoic Acid Length = 267 Back     alignment and structure
>pdb|1EXA|A Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Active R-Enantiomer Bms270394. Length = 246 Back     alignment and structure
>pdb|2Q59|A Chain A, Crystal Structure Of Ppargamma Lbd Bound To Full Agonist Mrl20 Length = 274 Back     alignment and structure
>pdb|3ET0|A Chain A, Structure Of Ppargamma With 3-(5-Methoxy-1h-Indol-3-Yl)- Propionic Acid Length = 292 Back     alignment and structure
>pdb|1I7G|A Chain A, Crystal Structure Of The Ligand Binding Domain From Human Ppar-Alpha In Complex With The Agonist Az 242 Length = 287 Back     alignment and structure
>pdb|2ZVT|A Chain A, Cys285ser Mutant Ppargamma Ligand-Binding Domain Complexed With 15-Deoxy-Delta12,14-Prostaglandin J2 Length = 286 Back     alignment and structure
>pdb|3LMP|A Chain A, Crystal Structure Of The Ppargamma-Lbd Complexed With A Cercosporamide Derivative Modulator Length = 283 Back     alignment and structure
>pdb|3CS8|A Chain A, Structural And Biochemical Basis For The Binding Selectivity Of Pparg To Pgc-1a Length = 275 Back     alignment and structure
>pdb|1K74|D Chain D, The 2.3 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Ppargamma And Rxralpha Ligand Binding Domains Respectively Bound With Gw409544 And 9-Cis Retinoic Acid And Co-Activator Peptides Length = 283 Back     alignment and structure
>pdb|3S9S|A Chain A, Ligand Binding Domain Of Ppargamma Complexed With A Benzimidazole Partial Agonist Length = 284 Back     alignment and structure
>pdb|2Q59|B Chain B, Crystal Structure Of Ppargamma Lbd Bound To Full Agonist Mrl20 Length = 274 Back     alignment and structure
>pdb|3ADS|A Chain A, Human Ppargamma Ligand-Binding Domain In Complex With Indomethacin Length = 287 Back     alignment and structure
>pdb|3SP6|A Chain A, Structural Basis For Iloprost As A Dual PparalphaDELTA AGONIST Length = 285 Back     alignment and structure
>pdb|2VV4|B Chain B, Hppargamma Ligand Binding Domain In Complex With 6-Oxoote Length = 276 Back     alignment and structure
>pdb|1I7I|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Ppar-Gamma In Complex With The Agonist Az 242 Length = 292 Back     alignment and structure
>pdb|1FM6|D Chain D, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 272 Back     alignment and structure
>pdb|3VN2|A Chain A, Crystal Structure Of Ppargamma Complexed With Telmisartan Length = 285 Back     alignment and structure
>pdb|2I4J|A Chain A, Crystal Structure Of The Complex Between Ppargamma And The Agonist Lt160 (Ureidofibrate Derivative) Length = 286 Back     alignment and structure
>pdb|1ZEO|A Chain A, Crystal Structure Of Human Ppar-Gamma Ligand Binding Domain Complexed With An Alpha-Aryloxyphenylacetic Acid Agonist Length = 277 Back     alignment and structure
>pdb|3OSI|A Chain A, Crystal Structure Of Ppargamma Ligand Binding Domain In Complex With Tetrachloro-Bisphenol A (Tcbpa) Length = 285 Back     alignment and structure
>pdb|3BC5|A Chain A, X-Ray Crystal Structure Of Human Ppar Gamma With 2-(5-(3-(2- (5-Methyl-2-Phenyloxazol-4-Yl)ethoxy)benzyl)-2-Phenyl- 2h-1, 2,3-Triazol-4-Yl)acetic Acid Length = 296 Back     alignment and structure
>pdb|1RDT|D Chain D, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 284 Back     alignment and structure
>pdb|3PBA|A Chain A, Crystal Structure Of Ppargamma Ligand Binding Domain In Complex With Monosulfate Tetrabromo-Bisphenol A (Monotbbpa) Length = 286 Back     alignment and structure
>pdb|3PRG|A Chain A, Ligand Binding Domain Of Human Peroxisome Proliferator Activated Receptor Length = 278 Back     alignment and structure
>pdb|2VV1|B Chain B, Hppargamma Ligand Binding Domain In Complex With 4-Hdha Length = 276 Back     alignment and structure
>pdb|2VSR|A Chain A, Hppargamma Ligand Binding Domain In Complex With 9-(S)-Hode Length = 276 Back     alignment and structure
>pdb|2HFP|A Chain A, Crystal Structure Of Ppar Gamma With N-Sulfonyl-2-Indole Carboxamide Ligands Length = 282 Back     alignment and structure
>pdb|2OM9|A Chain A, Ajulemic Acid, A Synthetic Cannabinoid Bound To Ppar Gamma Length = 278 Back     alignment and structure
>pdb|1NYX|A Chain A, Ligand Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma In Complex With An Agonist Length = 276 Back     alignment and structure
>pdb|2REW|A Chain A, Crystal Structure Of Pparalpha Ligand Binding Domain With Bms-631707 Length = 277 Back     alignment and structure
>pdb|1WM0|X Chain X, Ppargamma In Complex With A 2-Baba Compound Length = 292 Back     alignment and structure
>pdb|3T03|A Chain A, Crystal Structure Of Ppar Gamma Ligand Binding Domain In Complex With A Novel Partial Agonist Gq-16 Length = 284 Back     alignment and structure
>pdb|3B0Q|A Chain A, Human Ppar Gamma Ligand Binding Domain In Complex With Mcc555 Length = 274 Back     alignment and structure
>pdb|1KNU|A Chain A, Ligand Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma In Complex With A Synthetic Agonist Length = 274 Back     alignment and structure
>pdb|1K7L|A Chain A, The 2.5 Angstrom Resolution Crystal Structure Of The Human Pparalpha Ligand Binding Domain Bound With Gw409544 And A Co-Activator Peptide. Length = 288 Back     alignment and structure
>pdb|3ET1|A Chain A, Structure Of Pparalpha With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 291 Back     alignment and structure
>pdb|3R8A|A Chain A, X-Ray Crystal Structure Of The Nuclear Hormone Receptor Ppar-Gamma In A Complex With A Compound With Dual Ppar Gamma Agonism And Angiotensin Ii Type I Receptor Antagonism Activity Length = 282 Back     alignment and structure
>pdb|3ET3|A Chain A, Structure Of Ppargamma With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 292 Back     alignment and structure
>pdb|2ZNN|A Chain A, Human Pprr Alpha Ligand Binding Domain In Complex With A Synthetic Agonist Tipp703 Length = 273 Back     alignment and structure
>pdb|2PRG|A Chain A, Ligand-Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma Length = 271 Back     alignment and structure
>pdb|3G8I|A Chain A, Aleglitazar, A New, Potent, And Balanced Ppar AlphaGAMMA Agonist For The Treatment Of Type Ii Diabetes Length = 270 Back     alignment and structure
>pdb|2NPA|A Chain A, The Crystal Structure Of The Human Pparaplpha Ligand Binding Domain In Complex With A A-Hydroxyimino Phenylpropanoic Acid Length = 270 Back     alignment and structure
>pdb|4PRG|A Chain A, 0072 Partial Agonist Ppar Gamma Cocrystal Length = 270 Back     alignment and structure
>pdb|3U9Q|A Chain A, Ligand Binding Domain Of Ppargamma Complexed With Decanoic Acid And Pgc-1a Peptide Length = 269 Back     alignment and structure
>pdb|3CWD|A Chain A, Molecular Recognition Of Nitro-Fatty Acids By Ppar Gamma Length = 270 Back     alignment and structure
>pdb|1KKQ|A Chain A, Crystal Structure Of The Human Ppar-Alpha Ligand-Binding Domain In Complex With An Antagonist Gw6471 And A Smrt Corepressor Motif Length = 269 Back     alignment and structure
>pdb|2P54|A Chain A, A Crystal Structure Of Ppar Alpha Bound With Src1 Peptide And Gw735 Length = 267 Back     alignment and structure
>pdb|3A9E|B Chain B, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 269 Back     alignment and structure
>pdb|3KMR|A Chain A, Crystal Structure Of Raralpha Ligand Binding Domain In Complex With An Agonist Ligand (Am580) And A Coactivator Fragment Length = 266 Back     alignment and structure
>pdb|4DQM|A Chain A, Revealing A Marine Natural Product As A Novel Agonist For Retinoic Acid Receptors With A Unique Binding Mode And Antitumor Activity Length = 234 Back     alignment and structure
>pdb|1DKF|B Chain B, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 235 Back     alignment and structure
>pdb|3IPQ|A Chain A, X-Ray Structure Of Gw3965 Synthetic Agonist Bound To The Lxr Length = 283 Back     alignment and structure
>pdb|1R20|D Chain D, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO THE SYNTHETIC AGONIST BYI06830 Length = 265 Back     alignment and structure
>pdb|2B50|A Chain A, Human Nuclear Receptor-Ligand Complex 2 Length = 272 Back     alignment and structure
>pdb|3ET2|A Chain A, Structure Of Ppardelta With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 287 Back     alignment and structure
>pdb|2Q5G|A Chain A, Ligand Binding Domain Of Ppar Delta Receptor In Complex With A Partial Agonist Length = 283 Back     alignment and structure
>pdb|2XYJ|A Chain A, Novel Sulfonylthiadiazoles With An Unusual Binding Mode As Partial Dual Peroxisome Proliferator-Activated Receptor (Ppar) Gamma-Delta Agonists With High Potency And In-Vivo Efficacy Length = 288 Back     alignment and structure
>pdb|2ZNP|A Chain A, Human Pprr Delta Ligand Binding Domain In Complex With A Synthetic Agonist Tipp204 Length = 276 Back     alignment and structure
>pdb|1Y0S|A Chain A, Crystal Structure Of Ppar Delta Complexed With Gw2331 Length = 272 Back     alignment and structure
>pdb|2AWH|A Chain A, Human Nuclear Receptor-Ligand Complex 1 Length = 268 Back     alignment and structure
>pdb|2J14|A Chain A, 3,4,5-Trisubstituted Isoxazoles As Novel Ppardelta Agonists: Part2 Length = 285 Back     alignment and structure
>pdb|3SP9|A Chain A, Structural Basis For Iloprost As A Dual PparalphaDELTA AGONIST Length = 281 Back     alignment and structure
>pdb|2GWX|A Chain A, Molecular Recognition Of Fatty Acids By Peroxisome Proliferator-Activated Receptors Length = 267 Back     alignment and structure
>pdb|3TKM|A Chain A, Crystal Structure Ppar Delta Binding Gw0742 Length = 275 Back     alignment and structure
>pdb|1GWX|A Chain A, Molecular Recognition Of Fatty Acids By Peroxisome Proliferator-Activated Receptors Length = 271 Back     alignment and structure
>pdb|1UHL|B Chain B, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 242 Back     alignment and structure
>pdb|3GZ9|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Delta (Ppard) In Complex With A Full Agonist Length = 269 Back     alignment and structure
>pdb|3FC6|B Chain B, Hrxralpha & Mlxralpha With An Indole Pharmacophore, Sb786875 Length = 266 Back     alignment and structure
>pdb|2ACL|B Chain B, Liver X-Receptor Alpha Ligand Binding Domain With Sb313987 Length = 244 Back     alignment and structure
>pdb|1R1K|D Chain D, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 266 Back     alignment and structure
>pdb|3P88|A Chain A, Fxr Bound To Isoquinolinecarboxylic Acid Length = 229 Back     alignment and structure
>pdb|3HC6|A Chain A, Fxr With Src1 And Gsk088 Length = 232 Back     alignment and structure
>pdb|3GD2|A Chain A, Isoxazole Ligand Bound To Farnesoid X Receptor (Fxr) Length = 229 Back     alignment and structure
>pdb|3P89|A Chain A, Fxr Bound To A Quinolinecarboxylic Acid Length = 229 Back     alignment and structure
>pdb|2NXX|E Chain E, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 248 Back     alignment and structure
>pdb|3L0E|A Chain A, X-Ray Crystal Structure Of A Potent Liver X Receptor Modulator Length = 253 Back     alignment and structure
>pdb|3JZC|A Chain A, Crystal Structure Of Tr-Beta Bound To The Selective Thyromimetic Triac Length = 263 Back     alignment and structure
>pdb|1Z5X|E Chain E, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 310 Back     alignment and structure
>pdb|2H79|A Chain A, Crystal Structure Of Human Tr Alpha Bound T3 In Orthorhombic Space Group Length = 269 Back     alignment and structure
>pdb|3GWS|X Chain X, Crystal Structure Of T3-Bound Thyroid Hormone Receptor Length = 259 Back     alignment and structure
>pdb|3HZF|A Chain A, Structure Of Tr-alfa Bound To Selective Thyromimetic Gc-1 In C2 Space Group Length = 269 Back     alignment and structure
>pdb|3JZB|A Chain A, Crystal Structure Of Tr-Alfa Bound To The Selective Thyromimetic Triac Length = 267 Back     alignment and structure
>pdb|3IMY|A Chain A, Structure Of Tr-Beta Bound To Selective Thyromimetic Gc-1 Length = 261 Back     alignment and structure
>pdb|3P8X|A Chain A, Synthesis, Structure, And Biological Activity Of Des-Side Chain Analogues Of 1alpha,25-Dihydroxyvitamin D3 With Substituents At C-18 Length = 280 Back     alignment and structure
>pdb|1DB1|A Chain A, Crystal Structure Of The Nuclear Receptor For Vitamin D Complexed To Vitamin D Length = 259 Back     alignment and structure
>pdb|1NQ0|A Chain A, Tr Receptor Mutations Conferring Hormone Resistance And Reduced Corepressor Release Exhibit Decreased Stability In The Nterminal Lbd Length = 263 Back     alignment and structure
>pdb|1NQ1|A Chain A, Tr Receptor Mutations Conferring Hormone Resistance And Reduced Corepressor Release Exhibit Decreased Stability In The Nterminal Lbd Length = 263 Back     alignment and structure
>pdb|3B0T|A Chain A, Human Vdr Ligand Binding Domain In Complex With Maxacalcitol Length = 254 Back     alignment and structure
>pdb|1R6G|A Chain A, Crystal Structure Of The Thyroid Hormone Receptor Beta Ligand Binding Domain In Complex With A Beta Selective Compound Length = 259 Back     alignment and structure
>pdb|3AZ1|A Chain A, Crystal Structure Analysis Of Vitamin D Receptor Length = 253 Back     alignment and structure
>pdb|1S0Z|A Chain A, Crystal Structure Of The Vdr Lbd Complexed To Seocalcitol. Length = 263 Back     alignment and structure
>pdb|1NAX|A Chain A, Thyroid Receptor Beta1 In Complex With A Beta-Selective Ligand Length = 252 Back     alignment and structure
>pdb|1N46|A Chain A, Crystal Structure Of Human Tr Beta Ligand-Binding Domain Complexed With A Potent Subtype-Selective Thyromimetic Length = 258 Back     alignment and structure
>pdb|1BSX|A Chain A, Structure And Specificity Of Nuclear Receptor-Coactivator Interactions Length = 260 Back     alignment and structure
>pdb|1Q4X|A Chain A, Crystal Structure Of Human Thyroid Hormone Receptor Beta Lbd In Complex With Specific Agonist Gc-24 Length = 253 Back     alignment and structure
>pdb|1RJK|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With 2md And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 292 Back     alignment and structure
>pdb|1XZX|X Chain X, Thyroxine-Thyroid Hormone Receptor Interactions Length = 281 Back     alignment and structure
>pdb|2ZL9|A Chain A, 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26,27- Dimethyl-19-Norvitamin D3 Analogs: Synthesis, Biological Evaluation And Crystal Structure Length = 271 Back     alignment and structure
>pdb|3M7R|A Chain A, Crystal Structure Of Vdr H305q Mutant Length = 253 Back     alignment and structure
>pdb|2H77|A Chain A, Crystal Structure Of Human Tr Alpha Bound T3 In Monoclinic Space Group Length = 269 Back     alignment and structure
>pdb|3UVV|A Chain A, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 265 Back     alignment and structure
>pdb|3FXV|A Chain A, Identification Of An N-Oxide Pyridine Gw4064 Analogue As A Potent Fxr Agonist Length = 233 Back     alignment and structure
>pdb|2ZFX|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With Yr301 And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 265 Back     alignment and structure
>pdb|3BEJ|A Chain A, Structure Of Human Fxr In Complex With Mfa-1 And Co- Activator Peptide Length = 238 Back     alignment and structure
>pdb|1NAV|A Chain A, Thyroid Receptor Alpha In Complex With An Agonist Selective For Thyroid Receptor Beta1 Length = 263 Back     alignment and structure
>pdb|3DCT|A Chain A, Fxr With Src1 And Gw4064 Length = 235 Back     alignment and structure
>pdb|3A2I|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305f) Ligand Binding Domain Complexed With Tei-9647 Length = 263 Back     alignment and structure
>pdb|1NQ2|A Chain A, Two Rth Mutants With Impaired Hormone Binding Length = 264 Back     alignment and structure
>pdb|3HC5|A Chain A, Fxr With Src1 And Gsk826 Length = 232 Back     alignment and structure
>pdb|3L1B|A Chain A, Complex Structure Of Fxr Ligand-Binding Domain With A Tetrahydroazepinoindole Compound Length = 233 Back     alignment and structure
>pdb|1OSH|A Chain A, A Chemical, Genetic, And Structural Analysis Of The Nuclear Bile Acid Receptor Fxr Length = 232 Back     alignment and structure
>pdb|3FLI|A Chain A, Discovery Of Xl335, A Highly Potent, Selective And Orally- Active Agonist Of The Farnesoid X Receptor (Fxr) Length = 231 Back     alignment and structure
>pdb|3RUT|A Chain A, Fxr With Src1 And Gsk359 Length = 229 Back     alignment and structure
>pdb|1UPV|A Chain A, Crystal Structure Of The Human Liver X Receptor Beta Ligand Binding Domain In Complex With A Synthetic Agonist Length = 257 Back     alignment and structure
>pdb|1P8D|A Chain A, X-Ray Crystal Structure Of Lxr Ligand Binding Domain With 24(S),25- Epoxycholesterol Length = 250 Back     alignment and structure
>pdb|1PQ6|A Chain A, Human Lxr Beta Hormone Receptor / Gw3965 Complex Length = 253 Back     alignment and structure
>pdb|2J4A|A Chain A, Human Thyroid Hormone Receptor Beta Ligand Binding Domain In Complex With Kb131084 Length = 253 Back     alignment and structure
>pdb|4DK8|A Chain A, Crystal Structure Of Lxr Ligand Binding Domain In Complex With Partial Agonist 5 Length = 247 Back     alignment and structure
>pdb|1NUO|A Chain A, Two Rth Mutants With Impaired Hormone Binding Length = 261 Back     alignment and structure
>pdb|1OSV|A Chain A, Structural Basis For Bile Acid Binding And Activation Of The Nuclear Receptor Fxr Length = 230 Back     alignment and structure
>pdb|1OT7|A Chain A, Structural Basis For 3-Deoxy-Cdca Binding And Activation Of Fxr Length = 229 Back     alignment and structure
>pdb|3D57|A Chain A, Tr Variant D355r Length = 266 Back     alignment and structure
>pdb|2PIN|A Chain A, Thyroid Receptor Beta In Complex With Inhibitor Length = 253 Back     alignment and structure
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure
>pdb|4DK7|A Chain A, Crystal Structure Of Lxr Ligand Binding Domain In Complex With Full Agonist 1 Length = 247 Back     alignment and structure
>pdb|1XNX|A Chain A, Crystal Structure Of Constitutive Androstane Receptor Length = 256 Back     alignment and structure
>pdb|3A2J|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305fH397F) LIGAND Binding Domain Complexed With Tei-9647 Length = 263 Back     alignment and structure
>pdb|1XLS|E Chain E, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 242 Back     alignment and structure
>pdb|2HBH|A Chain A, Crystal Structure Of Vitamin D Nuclear Receptor Ligand Binding Domain Bound To A Locked Side-Chain Analog Of Calcitriol And Src-1 Peptide Length = 302 Back     alignment and structure
>pdb|4FHH|A Chain A, Development Of Synthetically Accessible Non-Secosteroidal Hybrid Molecules Combining Vitamin D Receptor Agonism And Histone Deacetylase Inhibition Length = 300 Back     alignment and structure
>pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 Back     alignment and structure
>pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 Back     alignment and structure
>pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 Back     alignment and structure
>pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 Back     alignment and structure
>pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 Back     alignment and structure
>pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 Back     alignment and structure
>pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 Back     alignment and structure
>pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 Back     alignment and structure
>pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 Back     alignment and structure
>pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 Back     alignment and structure
>pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 Back     alignment and structure
>pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 Back     alignment and structure
>pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 Back     alignment and structure
>pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 Back     alignment and structure
>pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 Back     alignment and structure
>pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 Back     alignment and structure
>pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 Back     alignment and structure
>pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 Back     alignment and structure
>pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 Back     alignment and structure
>pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 Back     alignment and structure
>pdb|3CTB|A Chain A, Tethered Pxr-LbdSRC-1p Apoprotein Length = 344 Back     alignment and structure
>pdb|1ILG|A Chain A, Crystal Structure Of Apo Human Pregnane X Receptor Ligand Binding Domain Length = 316 Back     alignment and structure
>pdb|1SKX|A Chain A, Structural Disorder In The Complex Of Human Pxr And The Macrolide Antibiotic Rifampicin Length = 313 Back     alignment and structure
>pdb|2O9I|A Chain A, Crystal Structure Of The Human Pregnane X Receptor Lbd In Complex With An Src-1 Coactivator Peptide And T0901317 Length = 293 Back     alignment and structure
>pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 Back     alignment and structure
>pdb|1XV9|B Chain B, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 246 Back     alignment and structure
>pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 Back     alignment and structure
>pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 Back     alignment and structure
>pdb|1PDU|A Chain A, Ligand-Binding Domain Of Drosophila Orphan Nuclear Receptor Dhr38 Length = 244 Back     alignment and structure
>pdb|1OVL|A Chain A, Crystal Structure Of Nurr1 Lbd Length = 271 Back     alignment and structure
>pdb|2QW4|A Chain A, Human Nr4a1 Ligand-Binding Domain Length = 273 Back     alignment and structure
>pdb|1OVL|B Chain B, Crystal Structure Of Nurr1 Lbd Length = 271 Back     alignment and structure
>pdb|3V3E|B Chain B, Crystal Structure Of The Human Nur77 Ligand-Binding Domain Length = 257 Back     alignment and structure
>pdb|1YJE|A Chain A, Crystal Structure Of The Rngfi-B Ligand-Binding Domain Length = 264 Back     alignment and structure
>pdb|1M7W|A Chain A, Hnf4a Ligand Binding Domain With Bound Fatty Acid Length = 250 Back     alignment and structure
>pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 Back     alignment and structure
>pdb|1HG4|A Chain A, Ultraspiracle Ligand Binding Domain From Drosophila Melanogaster Length = 279 Back     alignment and structure
>pdb|3UP0|A Chain A, Nuclear Receptor Daf-12 From Hookworm Ancylostoma Ceylanicum In Complex With (25s)-Delta7-Dafachronic Acid Length = 243 Back     alignment and structure
>pdb|1LV2|A Chain A, Hepatocyte Nuclear Factor 4 Is A Transcription Factor That Constitutively Binds Fatty Acids Length = 229 Back     alignment and structure
>pdb|3GYT|A Chain A, Nuclear Receptor Daf-12 From Parasitic Nematode Strongyloides Stercoralis In Complex With Its Physiological Ligand Dafachronic Acid Delta 4 Length = 244 Back     alignment and structure
>pdb|1PZL|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Src-1 Peptide Length = 237 Back     alignment and structure
>pdb|3FS1|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Pgc-1a Fragment Length = 230 Back     alignment and structure
>pdb|3TX7|B Chain B, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 352 Back     alignment and structure
>pdb|1KV6|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Err3 Ligand- Binding Domain In The Constitutively Active Conformation Length = 230 Back     alignment and structure
>pdb|2E2R|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Gamma Ligand Binding Domain Complex With Bisphenol A Length = 244 Back     alignment and structure
>pdb|1VJB|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4- Hydroxytamoxifen Length = 251 Back     alignment and structure
>pdb|1S9Q|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4-Hydroxytamoxifen Length = 251 Back     alignment and structure
>pdb|3OS8|C Chain C, Estrogen Receptor Length = 258 Back     alignment and structure
>pdb|1S9P|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With Diethylstilbestrol Length = 227 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query585
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 2e-72
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 1e-68
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 2e-68
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 5e-67
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 7e-67
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 7e-67
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 9e-66
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 9e-66
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 4e-65
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 5e-65
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 2e-64
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 2e-63
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 1e-61
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 2e-61
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 4e-61
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 1e-60
2p54_A267 PPAR-alpha, peroxisome proliferator-activated rece 1e-60
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 4e-59
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 6e-58
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 6e-58
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 3e-56
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 1e-54
1yje_A264 Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga 9e-54
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 1e-52
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 2e-52
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 3e-44
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 2e-43
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 9e-42
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 3e-41
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 3e-41
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 6e-39
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 1e-36
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 1e-35
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 3e-33
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 3e-33
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 7e-33
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 3e-32
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 5e-32
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 2e-30
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 2e-29
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 3e-28
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 3e-28
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 7e-28
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 9e-27
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 4e-26
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 2e-23
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 2e-23
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 2e-23
1t7r_A269 Androgen receptor; nuclear receptor, transcription 3e-23
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 7e-22
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 1e-21
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 3e-21
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 2e-19
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 4e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 Back     alignment and structure
 Score =  231 bits (590), Expect = 2e-72
 Identities = 87/238 (36%), Positives = 139/238 (58%), Gaps = 8/238 (3%)

Query: 62  QRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELL 121
           + ++S V RAH +   +  DK+         +               P+    +  QE+ 
Sbjct: 16  EDVISQVARAHREIFTYAHDKLGSSPGNFNANHAS--------GSPYPHGRSGRTVQEIW 67

Query: 122 QDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMI 181
           +DFS  F+P +R+VVEFAK IPGF  L   DQVTLLKAG FEVL+VR A +F+ +  +++
Sbjct: 68  EDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVM 127

Query: 182 CLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNK 241
            L+        + +     L+ +MFDF+E+LN L L++ E+GLF+++V++S  RSG+ N 
Sbjct: 128 FLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENS 187

Query: 242 ELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQ 299
             VE+++  L   L  ++ +N P + +   +L+  LPDLRTLN +HSEKL++F++  Q
Sbjct: 188 ASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ 245
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 Back     alignment and structure
>2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 Back     alignment and structure
>1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query585
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 100.0
3vi8_A273 Peroxisome proliferator-activated receptor alpha; 100.0
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 100.0
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 100.0
3v3e_B257 Nuclear receptor subfamily 4 group A member 1; orp 100.0
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 100.0
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 100.0
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 100.0
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 100.0
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 100.0
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 100.0
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 100.0
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 100.0
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 100.0
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 100.0
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 100.0
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 100.0
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 100.0
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 100.0
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 100.0
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 100.0
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 100.0
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 100.0
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 100.0
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 100.0
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 100.0
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 100.0
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 100.0
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 100.0
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 100.0
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 100.0
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 100.0
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 100.0
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 100.0
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 100.0
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 100.0
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 100.0
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 100.0
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 100.0
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 100.0
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 100.0
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 100.0
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 100.0
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 100.0
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 100.0
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 100.0
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 100.0
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 100.0
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 100.0
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 100.0
1t7r_A269 Androgen receptor; nuclear receptor, transcription 100.0
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 100.0
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 100.0
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 99.98
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 92.06
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 83.86
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure
Probab=100.00  E-value=2.7e-42  Score=357.20  Aligned_cols=266  Identities=25%  Similarity=0.406  Sum_probs=207.6

Q ss_pred             cCCCccccCCccchHHHHHHHHHhhcCCccchhHHHHhhhhhHHHHHHHHHHHhhhcccChhhhhhhhhhhhcCCCCcCC
Q psy3123          19 YHNAPVRFGRVPKREKARILAAMQQSTNTKCTEKALAAELDDEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTA   98 (585)
Q Consensus        19 MSrdAVR~GRvPKreK~~l~~elq~~~~~~s~ed~~~~~l~d~~~Li~~Iv~Ah~~tc~~T~ekvr~~l~~~~~~~~~~~   98 (585)
                      |+++|||+||+|++++....      ....  .   .....+++.+++.|++||.++++.... .          ..|..
T Consensus         1 M~rEaVr~~R~~~~~~~~~~------~~~~--~---~~~~~~~~~li~~l~~a~~~~~~~~~~-~----------~~~~~   58 (303)
T 1xdk_B            1 MSKESVRNDRNKKKKEPSKQ------ECTE--S---YEMTAELDDLTEKIRKAHQETFPSLCQ-L----------GKYTT   58 (303)
T ss_dssp             ----------------------------------------CCTHHHHHHHHHHHHHHSCCSSS-S----------CCBCC
T ss_pred             CCHHHHhhcccccccccccc------CCCC--C---CCCCHHHHHHHHHHHHHHHHhCccHhh-h----------cccCC
Confidence            78889999999987543110      0000  0   111224567999999999998764321 0          01111


Q ss_pred             CCCCCCCCCCCCCCCccchHHHHHHHHHhhhHHHHHHHHhhhcCCCCccccchhhHHHHHHHHHHHHHHHHHhhccCCCc
Q psy3123          99 CPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTN  178 (585)
Q Consensus        99 ~~~~~~c~l~~~~~~~~~r~e~~~~~~e~~~~~I~~vVeFAK~LPgF~~Ls~eDQi~LLK~s~~ElllLr~A~r~~~~~~  178 (585)
                      ..        ........+.+.|+.++++++..++.+|+|||+||+|.+|+.+||++|||++|+|+++|++|+++....+
T Consensus        59 ~~--------~~~~~~~~~~~~~~~~~~~~~~~l~~~VewaK~iP~F~~L~~~DQi~LLk~~~~el~lL~~a~~s~~~~~  130 (303)
T 1xdk_B           59 NS--------SADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQD  130 (303)
T ss_dssp             CT--------TCSSCCSCCHHHHHHHHHHHHHHHHHHHHHHHTSTTTSSSCHHHHHHHHHHHHHHHHHHHHHTTEETTTT
T ss_pred             CC--------CccccccchHHHHHHHHHHHHHHHHHHHHHHHcCcccccCCHHHHHHHHHhhHHHHHHHHHHHHhcccCC
Confidence            00        0011122346789999999999999999999999999999999999999999999999999999988889


Q ss_pred             eeEecCCeeecchhhcccchHHHHHHHHHHHHHHhhcCCChhHHHHHHHHHhhcCCCCCCCcHHHHHHHHHHHHHHHHHH
Q psy3123         179 SMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHV  258 (585)
Q Consensus       179 ~ll~~nG~~i~rd~l~~~~~~~li~~m~~f~~~L~~LqLde~E~ALLkAIvLfsPDr~GLsd~~~Ve~lQer~l~aL~~y  258 (585)
                      .|+|++|..+.++.+...+...+++.+++|+.+|++|++|++||+||+||+||+||++||++...|+++|++|..+|++|
T Consensus       131 ~l~~~~g~~~~~~~~~~~g~~~~~~~i~~~~~~l~~L~ld~~E~~lLkAivL~~pd~~gL~~~~~ve~lq~~~~~aL~~y  210 (303)
T 1xdk_B          131 TMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIY  210 (303)
T ss_dssp             EEECTTCBEEEHHHHHHTTTGGGHHHHHHHHHHHGGGCCCHHHHHHHHHHHHSCSCSSSCSSHHHHHHHTHHHHHHHHHH
T ss_pred             eEEecCCceecHHHHhhcCcHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHhCCCCCCCccHHHHHHHHHHHHHHHHHH
Confidence            99999999999888765555578899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCchhHHHHHHHhhHHHHHHHHHHHHHHHHHhhccccchhHHHHHHhcCCC
Q psy3123         259 LNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQQQQLAAQQQQWHGED  314 (585)
Q Consensus       259 i~~~~p~~p~RF~kLLllLp~LR~Ls~~h~E~L~~~kl~~~i~l~~Ll~Emf~~~~  314 (585)
                      |..+||+++.||++||++|+.||+++..+.|.++++++++.+++++|+.|||....
T Consensus       211 ~~~~~p~~~~Rf~~LL~~L~~Lr~l~~~~~e~l~~~~~~~~~~~~~Ll~Eml~~~~  266 (303)
T 1xdk_B          211 IRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSE  266 (303)
T ss_dssp             HHHHCTTCTTHHHHHHTHHHHHHHHHHHHHHHHHHHTTTCSSCCCHHHHHHHCCCC
T ss_pred             HHHhCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCccHHHHHHHcCCC
Confidence            99999999999999999999999999999999999999999999999999998654
>3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Back     alignment and structure
>3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 585
d1n46a_251 a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b 7e-52
d1fcya_236 a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g 3e-50
d1nq7a_244 a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R 6e-50
d1n83a_251 a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { 2e-48
d2fvja1271 a.123.1.1 (A:207-477) Peroxisome proliferator acti 3e-48
d1pq9a_239 a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human 4e-46
d1xvpb_246 a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) 4e-46
d1nrla_292 a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho 8e-45
d1pdua_230 a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui 9e-45
d2qw4a1233 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 1e-44
d1ie9a_255 a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( 1e-44
d1ovla_236 a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma 2e-44
d1xnxa_232 a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) 1e-43
d2b50b1265 a.123.1.1 (B:211-475) Peroxisome proliferator-acti 5e-41
d2r40d1243 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m 1e-40
d1osha_231 a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo 3e-40
d2p54a1267 a.123.1.1 (A:202-468) Peroxisome proliferator acti 3e-37
d2p1ta1230 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R 2e-33
d1pzla_233 a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { 3e-33
d2e2ra1223 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 3e-33
d1pk5a_242 a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- 1e-32
d3d24a1227 a.123.1.1 (A:194-420) Steroid hormone receptor ERR 2e-32
d1hg4a_265 a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph 2e-29
d1xpca_245 a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom 9e-29
d1g2na_256 a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth 1e-28
d2j7ya1236 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat 5e-26
d1t7ra_250 a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan 3e-25
d1sqna_251 a.123.1.1 (A:) Progesterone receptor {Human (Homo 4e-24
d1nhza_247 a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom 4e-23
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure

class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Thyroid hormone receptor beta (TR-beta)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  176 bits (447), Expect = 7e-52
 Identities = 55/248 (22%), Positives = 107/248 (43%), Gaps = 10/248 (4%)

Query: 57  ELDDEQRML-STVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQ 115
           E  DE+  L  TV  AH+ T A  +   +       +             P+       +
Sbjct: 3   EPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDI---------GQAPIVNAPEGGK 53

Query: 116 GQQELLQDFSERFSPTIRDVVEFAKRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDS 175
              E    F++  +P I  VV+FAK++P F  L  +DQ+ LLK    E++ +R A  +D 
Sbjct: 54  VDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDP 113

Query: 176 QTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSDTEIGLFSSIVVISPSR 235
           ++ ++       + R  + +     + D++FD    L+  +L DTE+ L  +++++S  R
Sbjct: 114 ESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDR 173

Query: 236 SGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQ 295
            GL   E +E+ +        H +N       +   +L+  + DLR +   H+ + +  +
Sbjct: 174 PGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMK 233

Query: 296 MTEQQQQL 303
           +    +  
Sbjct: 234 VECPTELF 241
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query585
d1fcya_236 Retinoic acid receptor gamma (RAR-gamma) {Human (H 100.0
d1n46a_251 Thyroid hormone receptor beta (TR-beta) {Human (Ho 100.0
d1xvpb_246 Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s 100.0
d1ie9a_255 Vitamin D nuclear receptor {Human (Homo sapiens) [ 100.0
d1nq7a_244 Orphan nuclear receptor ROR-beta {Rat (Rattus norv 100.0
d1n83a_251 Orphan nuclear receptor ROR-alpha {Human (Homo sap 100.0
d1pq9a_239 Oxysterols receptor LXR-beta {Human (Homo sapiens) 100.0
d1ovla_236 Orphan nuclear receptor NURR1 {Human (Homo sapiens 100.0
d2fvja1271 Peroxisome proliferator activated receptor gamma, 100.0
d2qw4a1233 Orphan nuclear receptor NR4A1 {Human (Homo sapiens 100.0
d1pdua_230 Nuclear hormone receptor HR38 {Fruit fly (Drosophi 100.0
d1xnxa_232 Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu 100.0
d2r40d1243 Ecdysone receptor {Noctuid moth (Heliothis viresce 100.0
d1nrla_292 Pregnane x receptor, PXR {Human (Homo sapiens) [Ta 100.0
d2p54a1267 Peroxisome proliferator activated receptor alpha, 100.0
d2b50b1265 Peroxisome proliferator-activated receptor delta, 100.0
d2e2ra1223 Orphan nuclear receptor ERR3 {Human (Homo sapiens) 100.0
d1osha_231 Bile acid receptor FXR {Human (Homo sapiens) [TaxI 100.0
d3d24a1227 Steroid hormone receptor ERR1 {Human (Homo sapiens 100.0
d1hg4a_265 Ultraspiracle protein, usp {Drosophila melanogaste 100.0
d1g2na_256 Ultraspiracle protein, usp {Heliothis virescens [T 100.0
d1pk5a_242 Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus 100.0
d2p1ta1230 Retinoid-X receptor alpha (RXR-alpha) {Human (Homo 100.0
d1pzla_233 Hepatocyte nuclear factor 4-alpha {Human (Homo sap 100.0
d1xpca_245 Estrogen receptor alpha {Human (Homo sapiens) [Tax 100.0
d2j7ya1236 Estrogen receptor beta {Rat (Rattus norvegicus) [T 100.0
d1t7ra_250 Androgen receptor {Chimpanzee (Pan troglodytes) [T 99.98
d1sqna_251 Progesterone receptor {Human (Homo sapiens) [TaxId 99.98
d1nhza_247 Glucocorticoid receptor {Human (Homo sapiens) [Tax 99.98
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Retinoic acid receptor gamma (RAR-gamma)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-42  Score=344.54  Aligned_cols=233  Identities=28%  Similarity=0.440  Sum_probs=211.0

Q ss_pred             hHHHHHHHHHHHhhhcccChhhhhhhhhhhhcCCCCcCCCCCCCCCCCCCCCCCccchHHHHHHHHHhhhHHHHHHHHhh
Q psy3123          60 DEQRMLSTVVRAHLDTCAFTADKIEPMLRRAREHPTYTACPSTLACPLNPNSHPLQGQQELLQDFSERFSPTIRDVVEFA  139 (585)
Q Consensus        60 d~~~Li~~Iv~Ah~~tc~~T~ekvr~~l~~~~~~~~~~~~~~~~~c~l~~~~~~~~~r~e~~~~~~e~~~~~I~~vVeFA  139 (585)
                      +++.+|+.|++||.+||+...+ +          ..++..        ...+.......++|++|++.++..|+.+|+||
T Consensus         4 e~~~li~~v~~ah~~t~~~~~~-~----------~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~i~~iV~fa   64 (236)
T d1fcya_           4 QLEELITKVSKAHQETFPSLCQ-L----------GKYTTN--------SSADHRVQLDLGLWDKFSELATKCIIKIVEFA   64 (236)
T ss_dssp             HHHHHHHHHHHHHHHHSCCGGG-S----------CCBCCC--------TTCSSCCSCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHhcCccHHH-h----------cccCcC--------CCCCCCCcccHHHHHHHHHHHHHHHHHHHHHH
Confidence            3557999999999999987543 1          111110        01112233456799999999999999999999


Q ss_pred             hcCCCCccccchhhHHHHHHHHHHHHHHHHHhhccCCCceeEecCCeeecchhhcccchHHHHHHHHHHHHHHhhcCCCh
Q psy3123         140 KRIPGFSLLCHDDQVTLLKAGVFEVLLVRLACMFDSQTNSMICLNGEVLVRDSIHSSNARFLMDSMFDFAERLNGLHLSD  219 (585)
Q Consensus       140 K~LPgF~~Ls~eDQi~LLK~s~~ElllLr~A~r~~~~~~~ll~~nG~~i~rd~l~~~~~~~li~~m~~f~~~L~~LqLde  219 (585)
                      |+||||.+|+.+||++|||++|+|++++++|++|+...+++.|.+|..+.++.....+..++++.+++|+.+|++|++|+
T Consensus        65 K~ip~F~~L~~~DQi~LLk~~~~el~~l~~a~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~~~~~~~l~~L~ld~  144 (236)
T d1fcya_          65 KRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDD  144 (236)
T ss_dssp             HTSTTGGGSCHHHHHHHHHHHHHHHHHHHHHHTEETTTTEEECTTCBEEEHHHHHHHTTGGGHHHHHHHHHHHGGGCCCH
T ss_pred             hcCCCcccCCHHHHHHHHHHHHHHHHHHHHHHHhcccCCeeeccCCceecHHHHhhcccHHHHHHHHHHHHHHHHcCCCH
Confidence            99999999999999999999999999999999999999999999999999999987777889999999999999999999


Q ss_pred             hHHHHHHHHHhhcCCCCCCCcHHHHHHHHHHHHHHHHHHHHhcCCCchhHHHHHHHhhHHHHHHHHHHHHHHHHHhhccc
Q psy3123         220 TEIGLFSSIVVISPSRSGLRNKELVERMRGKLENMLMHVLNQNHPEQMNLCAELISMLPDLRTLNQLHSEKLVAFQMTEQ  299 (585)
Q Consensus       220 ~E~ALLkAIvLfsPDr~GLsd~~~Ve~lQer~l~aL~~yi~~~~p~~p~RF~kLLllLp~LR~Ls~~h~E~L~~~kl~~~  299 (585)
                      +||+||+||+||+||++||.+...|+++|++|..+|+.||..+||+++.||++||++||+||+++..|.|.++++++.+.
T Consensus       145 ~E~alL~Ai~L~~pd~~gL~~~~~Ve~lq~~~~~aL~~y~~~~~~~~~~rf~~LL~~Lp~LR~l~~~~~e~l~~~k~~~~  224 (236)
T d1fcya_         145 TETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIP  224 (236)
T ss_dssp             HHHHHHHHHHHSCTTSTTCSCHHHHHHHHHHHHHHHHHHHHHHCTTCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHhhccCCCCCcccccHHHHHHHHHHHHHHHHHHHhCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhHHHHHHhc
Q psy3123         300 QQQLAAQQQQWH  311 (585)
Q Consensus       300 i~l~~Ll~Emf~  311 (585)
                      .++++|+.|||+
T Consensus       225 ~~~~~L~~E~~d  236 (236)
T d1fcya_         225 GPMPPLIREMLE  236 (236)
T ss_dssp             SCCCHHHHHHHC
T ss_pred             CCccHHHHHHcC
Confidence            999999999995
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure