Psyllid ID: psy3133

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------
MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKLNALKKKQVEKSKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTEKEKEEEKEGGEGEEEEKVVEDEMDEEEKELMKATKEIEELKDEERRELKRKKKKVSKERTKLQEKMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLITASKPEVFADSDEEHIDIVPKKIKYNVEKSELDDSGLYYKNPDDSDLEFESSSEDENDVEKKLVEEEFDTDEEDGLGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIRKVVEAKARKKKRQARRMDKMKKKLETLMEAPDVSDAEKARNIRAPSFLYYY
ccccccHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHccccEEEEcccccccccHHHHHHHcccccccccccccccHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHcccccccccccccccccccccHHHHcccccccHHHHHHHHHHccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccc
ccccccHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccccccccccccHHHHHHHcccccccccHcccccHccccccccccccEEEEEEEEHHHHHccccHHHHHHcccEEEEccccccccccccccccEEEEEcccccHHHEcccccEcccccccccccccccccHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHccccccccccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccccHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccHHHHHHHHHHHccccHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccEEEEc
MEDITTDKCRIAITRELKTWKVDVVlhdgspnvgmnwVYDAYHQCCLTLGALKLASGIlkeggwfvtkvfrsKDYTSLLWIFKQLFQRVhstkpqasrkesAEIFVVCQHyiapakldtkffdpkyafkelgaedgklNALKKKQVEKskalgypsdvnvlyknlpvskfiehetptVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVdlcaapggwmQVAKQNMMASsiihfddesvlkhpsttVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTEKEkeeekeggegeeeekvVEDEMDEEEKELMKATKEIEELKDEERRELKRKKKKVSKERTKLQEKMNLKMllkgdlgptenddeemfklsqirttDQLDLitaskpevfadsdeehidivpkkikynvekselddsglyyknpddsdlefesssedenDVEKKLVEeefdtdeeDGLGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIRKVVEAKARKKKRQARRMDKMKKKLETLmeapdvsdaekarnirapsflyyy
medittdkcriaitrelktwkvdvVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTkpqasrkesaEIFVVCQHYIapakldtkfFDPKYAFKElgaedgklnalKKKQVekskalgypsdvnvLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWkvlhdektekekeeekeggegeeeekvvedemdeEEKELMKATkeieelkdeerrelkrkkkkvskertklqekmnlkmllkgdlgptenDDEEMFKLSQIRTTDQLDLITASkpevfadsdeehidivpkkikynvekselddsglyyKNPDDSDLEfesssedendvekklveeefdtdeedglGKLLRYWEKSYnaaslvneyrkkrveinvrpirkvveakarkkkrqarrmdkmkkkletlmeapdvsdaekarnirapsflyyy
MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKLNALKKKQVEKSKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHdektekekeeekeggegeeeekvvedemdeeekeLMKATkeieelkdeerrelkrkkkkvskertklQEKMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLITASKPEVFADSDEEHIDIVPKKIKYNVEKSELDDSGLYYKNPddsdlefesssedendveKKLVEEEFDTDEEDGLGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIrkvveakarkkkrqarrmdkmkkkLETLMEAPDVSDAEKARNIRAPSFLYYY
******DKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVH***********AEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKL************ALGYPSDVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLH*************************************************************************************************************************************************************************************LGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIRKV*************************************************
MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAED*********************DVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHD************************************************************************************************************************************************************************************************************RVEINVRPIRK*******************************************PSFLYYY
MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRV***********SAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKLNALKKKQVEKSKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDE********************************LMKATKEIEEL********************KLQEKMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLITASKPEVFADSDEEHIDIVPKKIKYNVEKSELDDSGLYYKNPDD****************KKLVEEEFDTDEEDGLGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIRKVVE*************DKMKKKLETLMEAPDVSDAEKARNIRAPSFLYYY
*EDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKP**SRKESAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKLNALKKKQ*E*SKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTE***************************KELMKATKEIEELKDEERRELKRKK*KVSKERTKLQEKMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLITA*****************************LDDSGLYYK*PDD*****E*****ENDVEKKLVEEEFDTDEEDGLGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIRKVVEAKARKKKRQARRMDKMKKKLETLMEAPDVSDAEKARNIRAPSFLYYY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKLNALKKKQVEKSKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFDDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTEKEKEEEKEGGEGEEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLITASKPEVFADSDEEHIDIVPKKIKYNVEKSELDDSGLYYKNPDDSDLEFESSSEDENDVEKKLVEEEFDTDEEDGLGKLLRYWEKSYNAASLVNEYRKKRVEINVRPIRKVxxxxxxxxxxxxxxxxxxxxxxxxxxxxPDVSDAEKARNIRAPSFLYYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query547 2.2.26 [Sep-21-2011]
Q5RAS1 841 pre-rRNA processing prote yes N/A 0.606 0.394 0.414 1e-66
Q8IY81 847 pre-rRNA processing prote yes N/A 0.597 0.386 0.408 3e-66
Q9DBE9 838 pre-rRNA processing prote yes N/A 0.606 0.396 0.418 7e-66
Q5ZKM1 832 pre-rRNA processing prote yes N/A 0.436 0.287 0.464 2e-65
Q5RJT2 829 pre-rRNA processing prote yes N/A 0.742 0.489 0.373 2e-65
Q4WVH3 795 AdoMet-dependent rRNA met yes N/A 0.725 0.499 0.344 2e-57
Q52C47 865 AdoMet-dependent rRNA met N/A N/A 0.634 0.401 0.367 3e-57
Q5BH88 806 AdoMet-dependent rRNA met yes N/A 0.577 0.392 0.382 6e-57
Q9P6V8 831 AdoMet-dependent rRNA met N/A N/A 0.632 0.416 0.356 2e-54
Q54NX0 833 Putative rRNA methyltrans yes N/A 0.411 0.270 0.425 2e-52
>sp|Q5RAS1|SPB1_PONAB pre-rRNA processing protein FTSJ3 OS=Pongo abelii GN=FTSJ3 PE=2 SV=1 Back     alignment and function desciption
 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 224/398 (56%), Gaps = 66/398 (16%)

Query: 2   EDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKE 61
           EDITT++CR A+ +ELKTWKVDVVL+DG+PNVG +WV+DAY Q  LTL AL+LA   L  
Sbjct: 91  EDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLAR 150

Query: 62  GGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKF 121
           GG F+TKVFRS+DY  LLWIF+QLF+RV +TKPQASR ESAEIFVVCQ ++AP K+D+KF
Sbjct: 151 GGSFITKVFRSRDYQPLLWIFQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKF 210

Query: 122 FDPKYAFKELGAEDGKLNALKKKQVEKSKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQ 181
           FDPK+AFKE+  +   +  L  K+  K KA GY      LY    V+ F+    P   L 
Sbjct: 211 FDPKFAFKEVEVQAKTVTELVTKK--KPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLS 268

Query: 182 HATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFD 241
            A+E                                                    I  D
Sbjct: 269 KASE----------------------------------------------------IMVD 276

Query: 242 DESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTEKEKEEEK-------- 293
           DE + +HP+TT +I+ CC+DIRVLGRK++R+LL W   L     +K KE+ K        
Sbjct: 277 DEELAQHPATTEDIRVCCQDIRVLGRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSS 336

Query: 294 ---EGGEGEEEEKVVEDEMDEEEKELMKATKEIEELKDEERRELKRKKKKVSKERTKLQE 350
              + G  E+      ++  +EE+E  +  + + E+K +E  ELKRKKKK+ +E+ K +E
Sbjct: 337 GEEDEGNEEDSTAGTTEQPSKEEEEEEQLNQTLAEMKAQEVAELKRKKKKLLREQRKQRE 396

Query: 351 KMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLIT 388
           ++ LKM L G +   +  +  MF L  IR    L+ +T
Sbjct: 397 RVELKMDLPG-VSIADEGETGMFSLRTIRGQQLLEEVT 433
Probable methyltransferase.
Pongo abelii (taxid: 9601)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q8IY81|SPB1_HUMAN pre-rRNA processing protein FTSJ3 OS=Homo sapiens GN=FTSJ3 PE=1 SV=2 Back     alignment and function description
>sp|Q9DBE9|SPB1_MOUSE pre-rRNA processing protein FTSJ3 OS=Mus musculus GN=Ftsj3 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZKM1|SPB1_CHICK pre-rRNA processing protein FTSJ3 OS=Gallus gallus GN=FTSJ3 PE=2 SV=2 Back     alignment and function description
>sp|Q5RJT2|SPB1_RAT pre-rRNA processing protein FTSJ3 OS=Rattus norvegicus GN=Ftsj3 PE=2 SV=1 Back     alignment and function description
>sp|Q4WVH3|SPB1_ASPFU AdoMet-dependent rRNA methyltransferase spb1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb1 PE=3 SV=1 Back     alignment and function description
>sp|Q52C47|SPB1_MAGO7 AdoMet-dependent rRNA methyltransferase SPB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPB1 PE=3 SV=2 Back     alignment and function description
>sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 Back     alignment and function description
>sp|Q9P6V8|SPB1_NEUCR AdoMet-dependent rRNA methyltransferase spb1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb1 PE=3 SV=2 Back     alignment and function description
>sp|Q54NX0|SPB1_DICDI Putative rRNA methyltransferase OS=Dictyostelium discoideum GN=fsjC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
345481436 874 PREDICTED: putative rRNA methyltransfera 0.705 0.441 0.493 1e-105
357610723 847 putative ribosomal RNA methyltransferase 0.705 0.455 0.48 1e-104
193690534 834 PREDICTED: putative rRNA methyltransfera 0.702 0.460 0.485 1e-100
383850870 831 PREDICTED: putative rRNA methyltransfera 0.683 0.450 0.508 2e-96
307199137 853 Putative rRNA methyltransferase 3 [Harpe 0.683 0.438 0.483 7e-96
332025804 836 Putative rRNA methyltransferase 3 [Acrom 0.711 0.465 0.453 8e-96
328784537 844 PREDICTED: putative rRNA methyltransfera 0.672 0.436 0.486 4e-93
110760837 817 PREDICTED: putative rRNA methyltransfera 0.672 0.450 0.486 7e-93
380029605 853 PREDICTED: LOW QUALITY PROTEIN: putative 0.674 0.432 0.489 1e-91
307176560 844 Putative rRNA methyltransferase 3 [Campo 0.725 0.470 0.467 8e-90
>gi|345481436|ref|XP_001599955.2| PREDICTED: putative rRNA methyltransferase 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  389 bits (998), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 290/450 (64%), Gaps = 64/450 (14%)

Query: 3   DITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEG 62
           DITTDKCRI + RELKTWK DVVL+DG+PNVG NW+ DAY Q  LTL ALKLA+  L+ G
Sbjct: 92  DITTDKCRIDLARELKTWKADVVLNDGAPNVGKNWLIDAYQQATLTLSALKLATQFLRPG 151

Query: 63  GWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFF 122
           GWFVTKVFRSKDY  L+W+FKQ+F++VH+TKPQASR ESAEIFVVCQHY+APAK+D KF 
Sbjct: 152 GWFVTKVFRSKDYNPLIWVFKQMFKKVHATKPQASRNESAEIFVVCQHYLAPAKIDPKFL 211

Query: 123 DPKYAFKELGAED-GKLNALKKKQVEKSKALGYPSDVNVLYKNLPVSKFIEHETPTVLLQ 181
           DPK+ F EL  E   KLN    ++ +K+KALGYP +   LY  L V  +I+ E+    LQ
Sbjct: 212 DPKHVFAELDLEPKNKLNVFNPEKQKKAKALGYPENDYTLYHRLSVKDYIKSESAIDALQ 271

Query: 182 HATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHFD 241
             +E                           + +D                         
Sbjct: 272 DISE---------------------------IVID------------------------- 279

Query: 242 DESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTEKEKEEEKEGGEGEEE 301
           DE++L H  TT E+ ECCKDI+VLG+KD+R LL W K+L DE ++K+ E+EK+  E ++E
Sbjct: 280 DEAILNHKKTTKEVIECCKDIKVLGKKDLRLLLNWHKILKDE-SDKKAEQEKD-SENQKE 337

Query: 302 EKVVEDEMDEEEKELMKATKEIEELKDEERRELKRKKKKVSKERTKLQEKMNLKMLLKGD 361
           E+  +   + E++E  + TK+IE LK+E+ RELKRK+KKV+KERTKL +K+NL M+LKGD
Sbjct: 338 EETPKTLEEVEDEEDEQITKDIERLKEEKLRELKRKRKKVNKERTKLNQKLNLNMVLKGD 397

Query: 362 LGPT-ENDDEEMFKLSQIRTTDQLDLITASKPEVFADSDEEHIDIV--PKKIKYNVEKSE 418
           +GP  E DD  MF L QI+T DQL  +T   P+V A+SD +    V  PK ++Y  +   
Sbjct: 398 VGPVMEGDD--MFSLKQIQTYDQLHQVTDQSPDVVAESDSDSDSEVKKPKIVRYEKDSGH 455

Query: 419 LDDSGLYYKNPDDSDLEFESSSEDENDVEK 448
           LD  GLYYK+ +DS+LEF   SED++  EK
Sbjct: 456 LDSKGLYYKD-EDSELEF---SEDDSASEK 481

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357610723|gb|EHJ67114.1| putative ribosomal RNA methyltransferase [Danaus plexippus] Back     alignment and taxonomy information
>gi|193690534|ref|XP_001942837.1| PREDICTED: putative rRNA methyltransferase 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383850870|ref|XP_003700997.1| PREDICTED: putative rRNA methyltransferase 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307199137|gb|EFN79847.1| Putative rRNA methyltransferase 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332025804|gb|EGI65961.1| Putative rRNA methyltransferase 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328784537|ref|XP_003250462.1| PREDICTED: putative rRNA methyltransferase 3-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|110760837|ref|XP_391900.3| PREDICTED: putative rRNA methyltransferase 3-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380029605|ref|XP_003698459.1| PREDICTED: LOW QUALITY PROTEIN: putative rRNA methyltransferase 3-like [Apis florea] Back     alignment and taxonomy information
>gi|307176560|gb|EFN66047.1| Putative rRNA methyltransferase 3 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
FB|FBgn0030720 817 CG8939 [Drosophila melanogaste 0.330 0.221 0.565 1.7e-85
ZFIN|ZDB-GENE-030131-9828 838 ftsj "FtsJ homolog 3 (E. coli) 0.334 0.218 0.562 1.5e-70
UNIPROTKB|Q8IY81 847 FTSJ3 "pre-rRNA processing pro 0.334 0.216 0.567 6.2e-70
MGI|MGI:1860295 838 Ftsj3 "FtsJ homolog 3 (E. coli 0.334 0.218 0.572 5.8e-68
RGD|1307110 829 Ftsj3 "FtsJ homolog 3 (E. coli 0.334 0.220 0.572 5.9e-68
UNIPROTKB|F1RSJ8 836 FTSJ3 "Uncharacterized protein 0.334 0.218 0.572 1.5e-67
UNIPROTKB|Q5ZKM1 832 FTSJ3 "pre-rRNA processing pro 0.340 0.223 0.574 3.2e-67
UNIPROTKB|F1MY97 836 FTSJ3 "Uncharacterized protein 0.334 0.218 0.567 6.8e-67
UNIPROTKB|E2RHC4 837 FTSJ3 "Uncharacterized protein 0.334 0.218 0.572 2e-66
UNIPROTKB|E1C6Y7498 E1C6Y7 "Uncharacterized protei 0.340 0.373 0.574 4.4e-65
FB|FBgn0030720 CG8939 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 1.7e-85, Sum P(4) = 1.7e-85
 Identities = 103/182 (56%), Positives = 135/182 (74%)

Query:     1 MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILK 60
             +EDITT+KCR ++T+EL++WK DVVLHDG+PNVG NW+YDAY Q CLTL ALKL++  L+
Sbjct:    90 VEDITTEKCRQSLTKELQSWKADVVLHDGAPNVGRNWLYDAYQQICLTLNALKLSTQFLR 149

Query:    61 EGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTK 120
              GGWFVTKVFRSKDY +LLW+ KQLF++VH+TKP ASRKESAEIFVVCQ Y+AP  +D +
Sbjct:   150 NGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKESAEIFVVCQGYLAPDHIDPR 209

Query:   121 FFDPKYAFKELGAEDGKLNALKKKQVEKS-KALGYPSDVNVLYKNLPVSKFIEHETPTVL 179
               D KY F+EL  +  K ++L   + +K  KA GY +    L  +L  ++F++ E     
Sbjct:   210 LLDSKYVFEELDLDAKKKSSLLHPEKQKRIKAEGYTAQDIALRNDLAATEFLKAENALAA 269

Query:   180 LQ 181
             LQ
Sbjct:   270 LQ 271
GO:0006364 "rRNA processing" evidence=ISS
GO:0005730 "nucleolus" evidence=ISS
GO:0008649 "rRNA methyltransferase activity" evidence=ISS
GO:0001510 "RNA methylation" evidence=IEA
ZFIN|ZDB-GENE-030131-9828 ftsj "FtsJ homolog 3 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IY81 FTSJ3 "pre-rRNA processing protein FTSJ3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1860295 Ftsj3 "FtsJ homolog 3 (E. coli)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307110 Ftsj3 "FtsJ homolog 3 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSJ8 FTSJ3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKM1 FTSJ3 "pre-rRNA processing protein FTSJ3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY97 FTSJ3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHC4 FTSJ3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6Y7 E1C6Y7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691
4th Layer2.1.1.166LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 1e-30
pfam01728177 pfam01728, FtsJ, FtsJ-like methyltransferase 2e-29
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 7e-23
pfam01728177 pfam01728, FtsJ, FtsJ-like methyltransferase 3e-17
pfam07780212 pfam07780, Spb1_C, Spb1 C-terminal domain 9e-16
TIGR00438188 TIGR00438, rrmJ, cell division protein FtsJ 2e-15
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 7e-15
TIGR00438188 TIGR00438, rrmJ, cell division protein FtsJ 3e-11
PRK11188209 PRK11188, rrmJ, 23S rRNA methyltransferase J; Prov 8e-09
PRK11188209 PRK11188, rrmJ, 23S rRNA methyltransferase J; Prov 5e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 8e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  118 bits (297), Expect = 1e-30
 Identities = 43/112 (38%), Positives = 60/112 (53%)

Query: 3   DITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEG 62
           DIT +     +   L    VDVVL D +PN   N   D      L   AL+ A  +LK G
Sbjct: 93  DITDEDTLEKLLEALGGAPVDVVLSDMAPNTSGNRSVDHARSMYLCELALEFALEVLKPG 152

Query: 63  GWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAP 114
           G FV KVF+ +D+  LL   ++LF++V   KP+ASRK S EI++V + +   
Sbjct: 153 GSFVAKVFQGEDFEDLLKALRRLFRKVKIFKPKASRKRSREIYLVAKGFKGK 204

Length = 205
>gnl|CDD|216666 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|216666 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information
>gnl|CDD|219572 pfam07780, Spb1_C, Spb1 C-terminal domain Back     alignment and domain information
>gnl|CDD|232976 TIGR00438, rrmJ, cell division protein FtsJ Back     alignment and domain information
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232976 TIGR00438, rrmJ, cell division protein FtsJ Back     alignment and domain information
>gnl|CDD|183025 PRK11188, rrmJ, 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>gnl|CDD|183025 PRK11188, rrmJ, 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 547
KOG1098|consensus780 100.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 99.97
KOG1099|consensus294 99.96
PF11861159 DUF3381: Domain of unknown function (DUF3381); Int 99.96
KOG4589|consensus232 99.94
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 99.92
PF07780215 Spb1_C: Spb1 C-terminal domain; InterPro: IPR01292 99.91
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 99.89
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.88
KOG4589|consensus232 99.86
KOG1098|consensus 780 99.73
KOG1099|consensus294 99.68
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.65
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 99.65
KOG3674|consensus696 99.63
TIGR00438188 rrmJ cell division protein FtsJ. 99.62
KOG3673|consensus845 99.6
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 99.54
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 99.16
TIGR00438188 rrmJ cell division protein FtsJ. 98.99
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.96
COG2933358 Predicted SAM-dependent methyltransferase [General 98.8
PF14314675 Methyltrans_Mon: Virus-capping methyltransferase 98.24
PTZ00146293 fibrillarin; Provisional 97.65
PF06460299 NSP13: Coronavirus NSP13; InterPro: IPR009461 This 97.61
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.45
PRK04266226 fibrillarin; Provisional 97.43
PLN02336475 phosphoethanolamine N-methyltransferase 97.42
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.27
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.98
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 96.98
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 96.91
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 96.8
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.78
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 96.75
PRK11524284 putative methyltransferase; Provisional 96.73
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 96.72
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.69
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.63
PRK14967223 putative methyltransferase; Provisional 96.63
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.6
PRK08317241 hypothetical protein; Provisional 96.6
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 96.55
PRK14902444 16S rRNA methyltransferase B; Provisional 96.5
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 96.46
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.42
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.38
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.37
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 96.36
PRK10901427 16S rRNA methyltransferase B; Provisional 96.35
PRK07402196 precorrin-6B methylase; Provisional 96.3
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 96.29
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 96.21
PLN02244340 tocopherol O-methyltransferase 96.21
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.13
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.11
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.1
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 96.08
TIGR00740239 methyltransferase, putative. A simple BLAST search 96.08
PRK00811283 spermidine synthase; Provisional 95.99
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.98
TIGR00452314 methyltransferase, putative. Known examples to dat 95.95
PRK14904445 16S rRNA methyltransferase B; Provisional 95.86
PLN02233261 ubiquinone biosynthesis methyltransferase 95.86
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 95.84
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 95.83
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 95.72
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 95.7
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 95.67
PRK14901434 16S rRNA methyltransferase B; Provisional 95.63
PRK14902444 16S rRNA methyltransferase B; Provisional 95.6
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.55
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 95.53
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 95.46
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 95.42
PRK14903431 16S rRNA methyltransferase B; Provisional 95.33
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 95.32
smart00650169 rADc Ribosomal RNA adenine dimethylases. 95.32
TIGR03438301 probable methyltransferase. This model represents 95.3
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 95.24
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 95.19
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 95.18
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 95.18
PRK06202232 hypothetical protein; Provisional 95.15
PRK10258251 biotin biosynthesis protein BioC; Provisional 95.14
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 95.08
PRK11207197 tellurite resistance protein TehB; Provisional 95.04
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 95.03
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 94.97
PRK05785226 hypothetical protein; Provisional 94.97
PLN02490340 MPBQ/MSBQ methyltransferase 94.92
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 94.88
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 94.85
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 94.85
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 94.82
PRK12335287 tellurite resistance protein TehB; Provisional 94.73
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 94.71
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 94.68
PRK14968188 putative methyltransferase; Provisional 94.66
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 94.59
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 94.5
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 94.49
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 94.48
PRK10901427 16S rRNA methyltransferase B; Provisional 94.47
COG4106257 Tam Trans-aconitate methyltransferase [General fun 94.44
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 94.4
PRK06922677 hypothetical protein; Provisional 94.29
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 94.28
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 94.26
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 94.25
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 94.19
COG2263198 Predicted RNA methylase [Translation, ribosomal st 94.12
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 93.93
PLN02585315 magnesium protoporphyrin IX methyltransferase 93.92
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 93.91
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 93.89
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 93.83
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 93.79
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 93.73
PTZ00146293 fibrillarin; Provisional 93.7
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 93.68
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 93.61
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 93.55
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 93.52
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 93.4
PRK13699227 putative methylase; Provisional 93.4
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 93.4
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 93.1
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 93.03
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 92.99
PHA03411279 putative methyltransferase; Provisional 92.85
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 92.8
PTZ00338294 dimethyladenosine transferase-like protein; Provis 92.69
PLN02336 475 phosphoethanolamine N-methyltransferase 92.68
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 92.67
KOG2198|consensus375 92.39
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 92.36
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 92.26
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 92.16
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 92.14
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 92.04
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 92.02
KOG1499|consensus346 91.9
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 91.8
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 91.76
KOG3420|consensus185 91.53
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 91.41
PF06016 1289 Reovirus_L2: Reovirus core-spike protein lambda-2 91.08
PLN02366308 spermidine synthase 91.03
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 91.02
PLN03075296 nicotianamine synthase; Provisional 90.97
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 90.85
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 90.75
COG1092393 Predicted SAM-dependent methyltransferases [Genera 90.56
TIGR00536284 hemK_fam HemK family putative methylases. The gene 90.29
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 90.19
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 90.14
PRK04266226 fibrillarin; Provisional 90.12
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 90.02
PRK00536262 speE spermidine synthase; Provisional 90.0
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 89.61
PRK14901434 16S rRNA methyltransferase B; Provisional 89.56
COG4123248 Predicted O-methyltransferase [General function pr 89.21
KOG1122|consensus460 88.94
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 88.85
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 88.32
PRK04457262 spermidine synthase; Provisional 88.22
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 87.86
PRK01581374 speE spermidine synthase; Validated 87.82
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 87.62
PRK04148134 hypothetical protein; Provisional 87.43
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 87.14
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 86.81
PRK04457262 spermidine synthase; Provisional 86.72
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 86.69
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 86.47
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 86.36
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 86.25
PRK00811283 spermidine synthase; Provisional 86.17
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 85.99
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 85.97
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 85.73
PRK13255218 thiopurine S-methyltransferase; Reviewed 85.7
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 85.64
KOG1540|consensus296 85.49
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 84.74
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 84.71
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 84.42
PF13679141 Methyltransf_32: Methyltransferase domain 84.33
PHA03412241 putative methyltransferase; Provisional 83.3
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 83.11
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 83.01
KOG3673|consensus 845 83.01
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 82.24
PLN02823336 spermine synthase 82.04
KOG2899|consensus288 81.54
COG0421282 SpeE Spermidine synthase [Amino acid transport and 81.41
PF11861159 DUF3381: Domain of unknown function (DUF3381); Int 81.06
KOG1270|consensus282 80.66
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 80.51
PF05206259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 80.43
KOG0820|consensus315 80.37
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 80.29
PLN02672 1082 methionine S-methyltransferase 80.08
>KOG1098|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.5e-100  Score=816.67  Aligned_cols=469  Identities=43%  Similarity=0.683  Sum_probs=394.7

Q ss_pred             CCCCCChHHHHHHHHHhCCCcccEEecCCCCCCCCChhhhHHHHHHHHHHHHHHHHhhccCCCEEEEEeccCcCHHHHHH
Q psy3133           1 MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLW   80 (547)
Q Consensus         1 qGDIt~~~~~~~I~~~l~~~kvDVVLSDgAPnvsG~~~~D~~~q~~L~~~AL~LA~~~Lr~GGtFV~KVFrg~d~~~Ll~   80 (547)
                      |+|||+..|+..|+.+++.|++|||||||||||||+|.+|+|.|++|++.||.||+++|+.|||||+|||++.+|+.|+|
T Consensus        90 v~dIttd~cr~~l~k~l~t~~advVLhDgapnVg~~w~~DA~~q~~L~l~al~LA~~~l~~~g~fvtkvfrs~dy~~ll~  169 (780)
T KOG1098|consen   90 VEDITTDECRSKLRKILKTWKADVVLHDGAPNVGGNWVQDAFQQACLTLRALKLATEFLAKGGTFVTKVFRSEDYNGLLR  169 (780)
T ss_pred             hhhhhHHHHHHHHHHHHHhCCCcEEeecCCCccchhHHHHHHHhhHHHHHHHHHHHHHHHhcCccccccccCCcchHHHH
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcccCeEEEecCCCCCCCCceEEEEEeeccCCCCCCcccCChhhhhhhccccccchhhhcccccccccCccccCCCce
Q psy3133          81 IFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFFDPKYAFKELGAEDGKLNALKKKQVEKSKALGYPSDVNV  160 (547)
Q Consensus        81 ~lkqlF~kV~~~KP~ASR~~SsEiYvVC~gfk~p~~idp~llD~k~vF~e~~~~~~~~~~~~~~~~kk~~~~GY~~~~~~  160 (547)
                      +|.|||.+|+++||+|||+.|+||||||.||++|.++||+++||++||+++.......+.+|+|++++|. +||++|+++
T Consensus       170 v~~qLf~kv~~tkp~asr~~saeif~vc~~~l~P~~~dp~~ld~~~vf~e~~~~a~~~~~~l~~eKkkr~-eGY~~~d~~  248 (780)
T KOG1098|consen  170 VFGQLFKKVEATKPAASRSESAEIFVVCLGYLAPKKVDPRLLDPKLVFEEFPDGAKKQVKLLGPEKKKRA-EGYEDDDLA  248 (780)
T ss_pred             HHHHHHHHHHhcCChhhhhhccceeeeeecccCccccCccccCHHHHHhhcccccccchhhcCccccccc-cCcccchHH
Confidence            9999999999999999999999999999999999999999999999999988666788999999988877 999999999


Q ss_pred             eeeccccccccccCChhHhhhhhccccCCccchhHHHHHHHHHhcCCcCCCCeeeecCCCCCchHHHHHHhhcCCeEEee
Q psy3133         161 LYKNLPVSKFIEHETPTVLLQHATEVGKGYRSRAAFKLIQLNRKFEFLQKSKVCVDLCAAPGGWMQVAKQNMMASSIIHF  240 (547)
Q Consensus       161 l~~~~ss~~fi~~~Dp~~~~a~~~e~~~gy~sRaa~KL~ei~~kf~l~~~g~~VlDLGaaPGgWsqva~~~~g~~~vv~v  240 (547)
                      ||+..++.+|+...+|+.+++..+                                                    .|.|
T Consensus       249 L~~~~satdFlrsenpld~Lg~~~----------------------------------------------------~I~i  276 (780)
T KOG1098|consen  249 LHKTLSATDFLRSENPLDILGTAN----------------------------------------------------EITI  276 (780)
T ss_pred             HHHHhHHHHHHhhcCHHHHHhccc----------------------------------------------------eEEe
Confidence            999999999999999999888877                                                    8999


Q ss_pred             cccccccCCCcchhHHHhhccccccCHHHHHhhhhHHHHHhHHhhhhhhhhhhcCCCCcccccccccccchHHHHHHHHH
Q psy3133         241 DDESVLKHPSTTVEIQECCKDIRVLGRKDVRNLLKWWKVLHDEKTEKEKEEEKEGGEGEEEEKVVEDEMDEEEKELMKAT  320 (547)
Q Consensus       241 D~~~~~~~p~~~~~i~~~~~Di~vl~~~~~r~LlkWr~~l~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~  320 (547)
                      |...+..|+.||++|..||.|++|||+++|+.||+||+.|++.+...    .+...  .+..++++.++++    +++|+
T Consensus       277 DDe~~~nh~~TTeEi~~cc~DLkVLGkkd~r~iLrWRk~ire~l~~~----~~v~~--~e~~e~e~~plte----Eeeld  346 (780)
T KOG1098|consen  277 DDEEWKNHKKTTEEILECCKDLKVLGKKDFRVILRWRKKIRETLGEQ----KKVVD--GEADEVEEEPLTE----EEELD  346 (780)
T ss_pred             CCHHHhcCccCcHHHHHHHHHhhhhChHHHHHHHHHHHHHHHHhccc----ccccc--ccccccccCCCcH----HHHHH
Confidence            98888789999999999999999999999999999999999998543    11111  1112222344554    44799


Q ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHhcCCccCCCCCCCCCCcccccccccccChhhhhHhhhCCCCccCCCcc
Q psy3133         321 KEIEELKDEERRELKRKKKKVSKERTKLQEKMNLKMLLKGDLGPTENDDEEMFKLSQIRTTDQLDLITASKPEVFADSDE  400 (547)
Q Consensus       321 ~e~~~~~~~~~~~~kr~kkk~~~~~~k~~~r~~l~m~~~~d~~~~~~~~~~~F~l~~i~~~~~l~~~~~~~~~~~~~~~~  400 (547)
                      +.|++|.+.+++.+||+|||.++.++|+++||+|+|.+|||+|+..+ +.+||+|++|++++.|..|+++.+  ++|++.
T Consensus       347 ~~l~~l~E~e~~~lkRkkkk~~k~k~k~~~r~~l~m~~~gd~g~~~e-e~elF~L~~ir~~~~L~el~~~~~--avD~e~  423 (780)
T KOG1098|consen  347 KLLAELSEDEKAALKRKKKKALKAKAKELERMELKMIIPGDIGPEAE-EQELFSLKTIRKSKELAELTKDTQ--AVDEEL  423 (780)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCChhhh-hhhHHHHHHHhcchhHHHHhcCCc--CCChhh
Confidence            99999999999999999999999999999999999999999999865 889999999999999999999999  224443


Q ss_pred             hhcccccccccccccCCcCCCCCCccCCCCCCCcc----------------------------CCCCCc-----------
Q psy3133         401 EHIDIVPKKIKYNVEKSELDDSGLYYKNPDDSDLE----------------------------FESSSE-----------  441 (547)
Q Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------------------------~~~~~~-----------  441 (547)
                      .   ..+...+|.++ +  |.+..|.+|.|+..++                            |++.++           
T Consensus       424 ~---~d~~~~~d~~d-~--De~~~l~sdld~~~~~y~~~~~e~~~~~r~~~~~~~~~eee~~gl~e~d~de~~~ie~~~~  497 (780)
T KOG1098|consen  424 S---EDGDSDIDESD-E--DEDDGLNSDLDEMELDYTERRDESEMKKRAKKAEGQIEEEEWSGLEEGDEDEKNAIEKNGR  497 (780)
T ss_pred             h---ccCCccccccc-c--ccccccccchhhhHhhhhhhhhHHHHHHHhhhhhhhhhhhhhcCCccccchhhhhhhhccc
Confidence            2   22223333332 1  1112233333322211                            111000           


Q ss_pred             --cchhhhh--cc-----------------------------------------------cc------------------
Q psy3133         442 --DENDVEK--KL-----------------------------------------------VE------------------  452 (547)
Q Consensus       442 --~~~~~~~--~~-----------------------------------------------~~------------------  452 (547)
                        +.++.++  ++                                               +.                  
T Consensus       498 e~~se~~~~~~~~~dk~~~kegk~~~~f~~~if~~ed~d~~~e~s~~~~~~~~~~~~e~l~~~d~~~d~~de~~~~~~E~  577 (780)
T KOG1098|consen  498 EKKSENDELTVSFDDKKGKKEGKARMWFEDDIFNNEDADEGTEDSESSDAEMKKKKKEKLSKSDDDIDKSDEDEEERYED  577 (780)
T ss_pred             cccccccccccchhhcccchhhhccccccCccccccccccccccccchHHHHhhhhhhhcCcccccccccchhhhhhccc
Confidence              0000000  00                                               00                  


Q ss_pred             --------c---cCCCh-------------hHHHHHHHHhhhcc--------CCC-------------------------
Q psy3133         453 --------E---EFDTD-------------EEDGLGKLLRYWEK--------SYN-------------------------  475 (547)
Q Consensus       453 --------~---~~~~~-------------~~~~l~~~~~~~~k--------~~n-------------------------  475 (547)
                              +   +.|+|             ++||||++|++|+|        |||                         
T Consensus       578 ~~~~s~se~~d~~~dsd~~~~~~k~~~lt~E~mal~~~~a~~kK~r~dliDea~NRyaf~dE~LP~WF~dDEk~h~~~~k  657 (780)
T KOG1098|consen  578 LPNSSASESCDADIDSDSLKPVEKKRILTPEEMALGAQMARSKKARRDLIDEAWNRYAFNDEGLPDWFVDDEKQHYKKQK  657 (780)
T ss_pred             cccccccccccccccccccCchhhhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCccccchHHHhhHHHhccCCC
Confidence                    0   11111             23699999999999        777                         


Q ss_pred             --hHHHHHHHHHHHhhhhCCcchhHHHHHHhhhHHHHHHHHHHHHHHHHhhcCCCCChHHHHHhhccc
Q psy3133         476 --AASLVNEYRKKRVEINVRPIRKVVEAKARKKKRQARRMDKMKKKLETLMEAPDVSDAEKARNIRAP  541 (547)
Q Consensus       476 --tke~~~~~k~k~~~in~RpiKKv~EAkaRKK~r~~~klek~kkka~~i~~~~~~~~~eK~~~i~~~  541 (547)
                        |||+|++||+||++|||||||||+||||||||||++|||+++|||++|+++.|||++||+++|++|
T Consensus       658 PvtKe~v~a~rer~keiNARPiKKVaEAkARKkrra~kRLek~kKKAe~I~d~~d~te~eK~kei~kl  725 (780)
T KOG1098|consen  658 PVTKEEVAAYRERMKEINARPIKKVAEAKARKKRRAQKRLEKVKKKAELISDTSDITEREKAKEIKKL  725 (780)
T ss_pred             CCCHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccchhHHHHHHHHH
Confidence              999999999999999999999999999999999999999999999999999999999999999986

>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1099|consensus Back     alignment and domain information
>PF11861 DUF3381: Domain of unknown function (DUF3381); InterPro: IPR024576 This uncharacterised domain is found in eukaryotic rRNA methyltransferases like yeast Spb1 and mammalian homologue Ftsj3 Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF07780 Spb1_C: Spb1 C-terminal domain; InterPro: IPR012920 This presumed domain is found at the C terminus of a family of FtsJ-like methyltransferases Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>KOG1099|consensus Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG3674|consensus Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG3673|consensus Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF14314 Methyltrans_Mon: Virus-capping methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF06016 Reovirus_L2: Reovirus core-spike protein lambda-2 (L2); InterPro: IPR010311 This family consists of several Reovirus core-spike protein lambda-2 (L2) sequences Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>KOG3673|consensus Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF11861 DUF3381: Domain of unknown function (DUF3381); InterPro: IPR024576 This uncharacterised domain is found in eukaryotic rRNA methyltransferases like yeast Spb1 and mammalian homologue Ftsj3 Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
2plw_A201 Crystal Structure Of A Ribosomal Rna Methyltransfer 7e-12
2plw_A201 Crystal Structure Of A Ribosomal Rna Methyltransfer 1e-06
2nyu_A196 Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) 1e-07
2nyu_A196 Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) 1e-05
1eiz_A180 Ftsj Rna Methyltransferase Complexed With S- Adenos 2e-07
3dou_A191 Crystal Structure Of Methyltransferase Involved In 7e-04
>pdb|2PLW|A Chain A, Crystal Structure Of A Ribosomal Rna Methyltransferase, Putative, From Plasmodium Falciparum (Pf13_0052) Length = 201 Back     alignment and structure 
Iteration: 1

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 58/101 (57%), Gaps = 2/101 (1%)
Query: 17  LKTWKVDVVLHDGS-PNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDY 75
           L+  K+D++L D + P +G N + D  + C LTL         +  GG ++ K++     
Sbjct: 102 LQDKKIDIILSDAAVPCIG-NKIDDHLNSCELTLSITHFMEQYINIGGTYIVKMYLGSQT 160
Query: 76  TSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAK 116
            +L    K +FQ VH+TKP+ASR ES EI++VC++++   K
Sbjct: 161 NNLKTYLKGMFQLVHTTKPKASRNESREIYLVCKNFLGRKK 201
>pdb|2PLW|A Chain A, Crystal Structure Of A Ribosomal Rna Methyltransferase, Putative, From Plasmodium Falciparum (Pf13_0052) Length = 201 Back     alignment and structure
>pdb|2NYU|A Chain A, Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) Protein In Complex With S-Adenosylmethionine Length = 196 Back     alignment and structure
>pdb|2NYU|A Chain A, Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) Protein In Complex With S-Adenosylmethionine Length = 196 Back     alignment and structure
>pdb|1EIZ|A Chain A, Ftsj Rna Methyltransferase Complexed With S- Adenosylmethionine Length = 180 Back     alignment and structure
>pdb|3DOU|A Chain A, Crystal Structure Of Methyltransferase Involved In Cell Division From Thermoplasma Volcanicum Gss1 Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 4e-48
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 5e-21
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 4e-48
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 2e-21
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 3e-47
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 3e-23
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 2e-44
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 1e-20
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 6e-24
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 2e-09
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 1e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-06
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 8e-04
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 8e-04
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196 Back     alignment and structure
 Score =  164 bits (418), Expect = 4e-48
 Identities = 35/123 (28%), Positives = 51/123 (41%), Gaps = 5/123 (4%)

Query: 3   DITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEG 62
           D+T  +    I   L   + DV+L D +PN       D      L L  L +   IL+ G
Sbjct: 79  DVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPG 138

Query: 63  GWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAPAKLDTKFF 122
           G F+ K +       L     + FQ V   KP+ASRKES+E++ +   Y        K  
Sbjct: 139 GTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGR-----KGT 193

Query: 123 DPK 125
             +
Sbjct: 194 VKQ 196
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Length = 375 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Length = 305 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.92
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 99.89
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 99.88
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 99.88
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 99.87
2px2_A269 Genome polyprotein [contains: capsid protein C (co 99.86
2hwk_A320 Helicase NSP2; rossman fold, alpha/beta/alpha, mul 99.83
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.72
2px2_A269 Genome polyprotein [contains: capsid protein C (co 99.72
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.7
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.62
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 99.6
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 99.59
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 99.56
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 99.56
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.54
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 99.54
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 99.5
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.49
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.49
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 99.42
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.4
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.39
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.39
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 99.32
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.28
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.23
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.19
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.18
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.86
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.81
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.72
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.16
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.59
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.55
3trk_A324 Nonstructural polyprotein; hydrolase; 2.40A {Chiku 97.5
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.38
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.37
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.29
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.26
4gua_A670 Non-structural polyprotein; viral precursor polypr 97.26
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.18
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.15
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.11
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.11
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.11
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.06
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.05
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.04
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.04
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.0
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 96.95
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.95
3f4k_A257 Putative methyltransferase; structural genomics, P 96.95
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.95
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 96.92
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 96.91
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 96.9
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.88
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 96.86
3dtn_A234 Putative methyltransferase MM_2633; structural gen 96.85
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.85
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 96.85
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 96.83
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 96.82
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 96.8
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.79
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.76
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.75
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.74
2b25_A336 Hypothetical protein; structural genomics, methyl 96.74
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 96.73
3lpm_A259 Putative methyltransferase; structural genomics, p 96.72
3lpm_A259 Putative methyltransferase; structural genomics, p 96.71
2frn_A278 Hypothetical protein PH0793; structural genomics, 96.71
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.7
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 96.68
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 96.66
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 96.66
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 96.65
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.64
1ne2_A200 Hypothetical protein TA1320; structural genomics, 96.64
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 96.64
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.63
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.63
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 96.62
3gu3_A284 Methyltransferase; alpha-beta protein, structural 96.61
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 96.61
3ege_A261 Putative methyltransferase from antibiotic biosyn 96.59
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.58
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 96.57
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 96.57
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.56
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 96.56
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.55
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 96.55
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.55
1jsx_A207 Glucose-inhibited division protein B; methyltransf 96.54
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 96.54
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.52
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 96.52
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 96.52
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.51
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.5
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 96.49
1vl5_A260 Unknown conserved protein BH2331; putative methylt 96.48
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 96.48
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 96.48
3dh0_A219 SAM dependent methyltransferase; cystal structure, 96.48
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.47
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 96.46
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 96.45
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.45
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 96.44
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.44
3m33_A226 Uncharacterized protein; structural genomics, PSI- 96.44
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.44
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 96.43
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.43
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.43
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 96.42
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.41
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.4
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.38
4hg2_A257 Methyltransferase type 11; structural genomics, PS 96.37
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.35
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 96.34
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.33
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.33
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 96.32
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 96.31
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.3
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.3
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.29
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 96.27
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.27
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 96.27
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.23
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.23
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 96.23
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.23
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.22
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.22
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 96.21
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.21
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.21
3hnr_A220 Probable methyltransferase BT9727_4108; structural 96.19
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.19
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 96.19
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.17
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 96.17
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 96.16
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 96.16
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.15
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.14
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 96.14
2p7i_A250 Hypothetical protein; putative methyltransferase, 96.12
1wzn_A252 SAM-dependent methyltransferase; structural genomi 96.11
3cc8_A230 Putative methyltransferase; structural genomics, j 96.11
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 96.11
2h00_A254 Methyltransferase 10 domain containing protein; st 96.1
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.1
3k6r_A278 Putative transferase PH0793; structural genomics, 96.08
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.07
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.07
1xxl_A239 YCGJ protein; structural genomics, protein structu 96.06
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.06
2b3t_A276 Protein methyltransferase HEMK; translation termin 96.06
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 96.05
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 96.04
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 96.04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.03
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.01
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.0
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 96.0
2fyt_A340 Protein arginine N-methyltransferase 3; structural 96.0
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 95.99
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 95.98
2fpo_A202 Methylase YHHF; structural genomics, putative meth 95.97
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 95.97
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 95.97
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 95.96
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 95.96
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.95
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 95.95
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.94
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 95.92
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 95.92
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 95.9
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 95.89
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 95.88
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 95.87
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 95.86
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 95.86
3ocj_A305 Putative exported protein; structural genomics, PS 95.85
2r3s_A335 Uncharacterized protein; methyltransferase domain, 95.85
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 95.82
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 95.81
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.81
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 95.8
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 95.8
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 95.79
3m70_A286 Tellurite resistance protein TEHB homolog; structu 95.78
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 95.77
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 95.77
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 95.71
2kw5_A202 SLR1183 protein; structural genomics, northeast st 95.67
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 95.67
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 95.65
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 95.64
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 95.64
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 95.63
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 95.62
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 95.59
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 95.59
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 95.58
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 95.54
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 95.53
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 95.53
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 95.53
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 95.51
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 95.49
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 95.45
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 95.44
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 95.44
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 95.43
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 95.41
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 95.4
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 95.34
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 95.27
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 95.23
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 95.22
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 95.22
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 95.2
2i62_A265 Nicotinamide N-methyltransferase; structural genom 95.19
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 95.15
2b78_A385 Hypothetical protein SMU.776; structure genomics, 95.13
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 95.11
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 95.1
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 95.03
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 94.98
3fut_A271 Dimethyladenosine transferase; methyltransferase, 94.97
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 94.91
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 94.89
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 94.88
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 94.87
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.86
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 94.83
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 94.81
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 94.77
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 94.75
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 94.74
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 94.73
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 94.67
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 94.45
3lcc_A235 Putative methyl chloride transferase; halide methy 94.44
3dp7_A363 SAM-dependent methyltransferase; structural genomi 94.44
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 94.41
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 94.38
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 94.37
3sso_A419 Methyltransferase; macrolide, natural product, ros 94.34
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 94.26
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 94.23
1ej6_A 1289 Lambda2; icosahedral, non-equivalence, dsRNA virus 94.19
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 94.17
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 94.15
3gjy_A317 Spermidine synthase; APC62791, structural genomics 94.14
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 94.06
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 93.97
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 93.96
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 93.94
3iyl_W 1299 VP1; non-enveloped virus, membrane penetration pro 93.92
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 93.89
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 93.87
2i7c_A283 Spermidine synthase; transferase, structural genom 93.87
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 93.82
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 93.7
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 93.7
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 93.6
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 93.55
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 93.53
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 93.3
2pt6_A321 Spermidine synthase; transferase, structural genom 93.25
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 93.18
2cmg_A262 Spermidine synthase; transferase, putrescine amino 93.13
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 93.04
3ll7_A410 Putative methyltransferase; methytransferase, stru 92.91
1vlm_A219 SAM-dependent methyltransferase; possible histamin 92.83
2i7c_A283 Spermidine synthase; transferase, structural genom 92.78
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 92.73
1xj5_A334 Spermidine synthase 1; structural genomics, protei 92.66
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 92.57
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 92.54
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 92.43
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 92.41
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 92.35
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 92.2
3sso_A419 Methyltransferase; macrolide, natural product, ros 92.14
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 92.12
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 92.08
2o07_A304 Spermidine synthase; structural genomics, structur 91.91
2pt6_A321 Spermidine synthase; transferase, structural genom 91.88
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 91.81
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 91.74
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 91.73
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 91.55
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 91.53
2qm3_A373 Predicted methyltransferase; putative methyltransf 91.35
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 91.11
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 90.87
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 90.63
3giw_A277 Protein of unknown function DUF574; rossmann-fold 90.37
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 90.17
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 90.02
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 89.57
2cmg_A262 Spermidine synthase; transferase, putrescine amino 89.56
2frn_A278 Hypothetical protein PH0793; structural genomics, 89.32
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 88.86
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 88.57
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 88.4
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 88.25
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 88.0
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 87.89
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 87.56
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 87.48
2zig_A297 TTHA0409, putative modification methylase; methylt 87.43
3gjy_A317 Spermidine synthase; APC62791, structural genomics 87.31
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 87.01
2b3t_A276 Protein methyltransferase HEMK; translation termin 86.78
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 86.36
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 85.94
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 85.38
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 85.38
2o07_A304 Spermidine synthase; structural genomics, structur 85.38
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 85.34
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 84.56
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 84.39
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 84.09
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 83.1
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 82.84
1jsx_A207 Glucose-inhibited division protein B; methyltransf 82.03
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 81.97
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 81.93
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 81.89
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 81.03
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 80.55
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 80.14
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
Probab=99.92  E-value=4.7e-25  Score=207.36  Aligned_cols=113  Identities=26%  Similarity=0.306  Sum_probs=102.1

Q ss_pred             CCCCCChHHHHHHHHHhC----CCcccEEecCCCCCCCCChhhhHHHHHHHHHHHHHHHHhhccCCCEEEEEeccCcCHH
Q psy3133           1 MEDITTDKCRIAITRELK----TWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYT   76 (547)
Q Consensus         1 qGDIt~~~~~~~I~~~l~----~~kvDVVLSDgAPnvsG~~~~D~~~q~~L~~~AL~LA~~~Lr~GGtFV~KVFrg~d~~   76 (547)
                      +|||++..+...+...+.    + +||+|+|||+|+++|.+..|+..++.|+..+|..|..+|+|||+||+|+|++..+.
T Consensus        68 ~~D~~~~~~~~~~~~~~~~~~~~-~~D~Vlsd~~~~~~g~~~~d~~~~~~l~~~~l~~a~~~LkpGG~lv~k~~~~~~~~  146 (191)
T 3dou_A           68 RCDIFKETIFDDIDRALREEGIE-KVDDVVSDAMAKVSGIPSRDHAVSYQIGQRVMEIAVRYLRNGGNVLLKQFQGDMTN  146 (191)
T ss_dssp             ECCTTSSSHHHHHHHHHHHHTCS-SEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEECSTHHH
T ss_pred             EccccCHHHHHHHHHHhhcccCC-cceEEecCCCcCCCCCcccCHHHHHHHHHHHHHHHHHHccCCCEEEEEEcCCCCHH
Confidence            589999999988888775    4 89999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcccCeEEEecCCCCCCCCceEEEEEeeccCC
Q psy3133          77 SLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHYIAP  114 (547)
Q Consensus        77 ~Ll~~lkqlF~kV~~~KP~ASR~~SsEiYvVC~gfk~p  114 (547)
                      .+++.|+.+|.+|+++||.|||+.|+|+|+||+||++.
T Consensus       147 ~~~~~l~~~F~~v~~~kP~asR~~s~E~y~v~~~~~~~  184 (191)
T 3dou_A          147 DFIAIWRKNFSSYKISKPPASRGSSSEIYIMFFGFKAE  184 (191)
T ss_dssp             HHHHHHGGGEEEEEEECC------CCEEEEEEEEECCC
T ss_pred             HHHHHHHHhcCEEEEECCCCccCCCceEEEEEeeeccc
Confidence            99999999999999999999999999999999999974
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1ej6_A Lambda2; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_U Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3iyl_W VP1; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_A Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 547
d1ej0a_180 c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric 5e-21
d1ej0a_180 c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric 5e-15
d2p41a1257 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)- 5e-15
d2p41a1257 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)- 3e-10
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]

 Score = 88.3 bits (218), Expect = 5e-21
 Identities = 32/111 (28%), Positives = 50/111 (45%)

Query: 1   MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILK 60
             D   +    A+   +   KV VV+ D +PN+      D      L   AL++   +L 
Sbjct: 68  QGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLA 127

Query: 61  EGGWFVTKVFRSKDYTSLLWIFKQLFQRVHSTKPQASRKESAEIFVVCQHY 111
            GG FV KVF+ + +   L   + LF +V   KP +SR  S E+++V    
Sbjct: 128 PGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGR 178
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257 Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 99.97
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 99.77
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 99.65
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 99.46
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.72
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.68
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.58
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.5
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.49
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.43
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.42
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.42
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.31
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.2
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.03
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 96.92
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.88
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 96.83
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.8
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 96.8
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.77
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 96.77
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.73
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 96.7
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 96.63
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 96.61
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 96.54
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 96.51
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.51
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 96.49
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.48
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.47
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 96.47
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.43
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.41
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.4
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.35
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 96.32
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 96.32
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 96.32
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.29
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 96.29
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 96.28
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 96.26
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.22
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 96.21
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.16
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.15
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 96.09
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 95.95
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 95.87
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 95.86
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 95.81
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 95.76
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 95.72
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.67
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 95.61
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 95.54
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 95.31
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 95.13
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.01
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 94.96
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 94.95
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 94.93
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 94.81
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 94.8
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 94.76
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 94.75
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 94.49
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.47
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 94.45
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 94.44
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 94.13
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 93.89
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 93.01
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 92.94
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 92.82
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 92.24
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 92.21
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 92.17
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 91.79
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 91.24
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 90.68
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 90.59
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 90.15
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 90.01
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 89.58
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 89.36
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 89.02
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 88.77
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 88.65
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 88.43
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 87.33
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 86.69
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 83.92
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 82.72
d2h00a1250 Methyltransferase 10 domain containing protein MET 82.04
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=2.8e-31  Score=249.03  Aligned_cols=112  Identities=29%  Similarity=0.409  Sum_probs=109.7

Q ss_pred             CCCCCChHHHHHHHHHhCCCcccEEecCCCCCCCCChhhhHHHHHHHHHHHHHHHHhhccCCCEEEEEeccCcCHHHHHH
Q psy3133           1 MEDITTDKCRIAITRELKTWKVDVVLHDGSPNVGMNWVYDAYHQCCLTLGALKLASGILKEGGWFVTKVFRSKDYTSLLW   80 (547)
Q Consensus         1 qGDIt~~~~~~~I~~~l~~~kvDVVLSDgAPnvsG~~~~D~~~q~~L~~~AL~LA~~~Lr~GGtFV~KVFrg~d~~~Ll~   80 (547)
                      +|||++..+...+...+...++||||||||||+||++..|++.+++|++++|.+|..+|++||+||||+|+|.++..|++
T Consensus        68 ~~d~~~~~~~~~~~~~~~~~~~DlVlSD~ap~~sg~~~~d~~~~~~L~~~~l~~a~~~Lk~gG~fV~K~F~g~~~~~l~~  147 (180)
T d1ej0a_          68 QGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLR  147 (180)
T ss_dssp             ESCTTSHHHHHHHHHHHTTCCEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEESSTTHHHHHH
T ss_pred             ecccccchhhhhhhhhccCcceeEEEecccchhcccchhHHHHHHHHHHHHHHhhhhccCCCCcEEEEEecCccHHHHHH
Confidence            58999999999999999889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcccCeEEEecCCCCCCCCceEEEEEeecc
Q psy3133          81 IFKQLFQRVHSTKPQASRKESAEIFVVCQHYI  112 (547)
Q Consensus        81 ~lkqlF~kV~~~KP~ASR~~SsEiYvVC~gfk  112 (547)
                      .|+.+|++|+++||.|||++|+|+|+||+||+
T Consensus       148 ~l~~~F~~V~~~KP~aSR~~SsE~Ylv~~g~K  179 (180)
T d1ej0a_         148 EIRSLFTKVKVRKPDSSRARSREVYIVATGRK  179 (180)
T ss_dssp             HHHHHEEEEEEECCTTSCTTCCEEEEEEEEEC
T ss_pred             HHHhhcCEEEEECCCCcccCCceEEEEEecCC
Confidence            99999999999999999999999999999997
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure