Psyllid ID: psy3145


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MQVDLLKTIEDDEEVPNYSDDSDKEVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKVEAIEGEVQKILTEEKHDRLLNKADEQVSKAEKMLKEKKPLHENPPREWFQTKKERAAIKTSQAGEGLAALILYLQSHSKTLVCSLF
cHHHHHHHccccccccccccccccEEccEEEEEEcccccccccccccccccccccccccccccccccHHccccccHHHHccccHHHHHHHHHHcHHHHHccccccccccHHHHHHHHHHccccEEEEEEEEEEEccccccHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEHHHccccccccccEEEEEccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHccccccEEccc
ccEEEEEEcccHHHHHHHcHHHHHHcccEEEEccccccHHHHcccccccEEEEEccccccccccccEEEEEEcHHHHHHHcccHHHHHHHHHHccHHHccEEEEccccHHHHHHHHHHHccccccEEEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHccccEHHEcccccHHHHHHHHHHHHcccEEEEEEEEHHHccccHccccEEEEEcccccccHHEEEEccccccccccEEEEEEcHHHHHHHHHHHHHHHccccccccccccccccccccccccHcccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcc
MQVDLLKTieddeevpnysddsdkevEGLRVYVEteacpkanlgwypqtaivpnlprlkfsseyqpkkfktkkitdfdndfsFVSSIEEYNKDTEIVVAYCWskgtfqsnasmTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTfkdhtmifvptkreAHEMHILLGLLGIkagelhgnltqpsrLESLRKFKDEETDVLIATDVaargldirgVKTVINyrmphsleHYIHRVGrtaragkggvsvsmaGEVDRKLVKQVIKNaknpvkhriippgyprlktpsfpppplaeiVDKYRAKVEAIEGEVQKILTEEKHDRLLNKADEQVSKAEKMLKekkplhenpprewfqtKKERAAIKTSQAGEGLAALILYLQSHSKTLVCSLF
mqvdllktieddeevpnysddsdkeVEGLRVYVETEacpkanlgwypqtaivpnlprlkfsseyqpkkfktkkitdfdndFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLiatdvaargldirgVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQViknaknpvkhriippgyprlktpsfppPPLAEIVDKYRAKVEAIEGEVQKilteekhdrllnkaDEQVSKAEKmlkekkplhenpprewfqtkKERAAIKTSQAGEGLAALILYLQSHSKTLVCSLF
MQVDLLKTIEDDEEVPNYSDDSDKEVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPkkfktkkitdfdndfSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFlfllrppvllcllcfrIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKVEAIEGEVQKILTEEKHDRLLNKADEQVSKAEKMLKEKKPLHENPPREWFQTKKERAAIKTSQAGEGLAALILYLQSHSKTLVCSLF
***************************GLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLT*********KFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPP***************AEIVDKYRAKVEAIEGEVQKI*****************************************************GEGLAALILYLQSHSKTLVC***
*****LKTIEDDEEVPNYSDDSDKEVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTS*LFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKN************************************A**GEVQKILTEEKHDR*************************************************************TLVCSLF
MQVDLLKTIEDDEEVPNYSDDSDKEVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKVEAIEGEVQKILTEEKHDRLLNKADEQVSKAEKMLKEKKPLHENPPREWFQTKKERAAIKTSQAGEGLAALILYLQSHSKTLVCSLF
MQVDLLKTIEDDEEVPNYSDDSDKEVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGY******************************************LLNK****************************************AGEGLAALILYLQSHSKTLVCSLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVDLLKTIEDDEEVPNYSDDSDKEVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFLFLLRPPVLLCLLCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIxxxxxxxxxxxxxxxxxxxxxEKHDRLLNKADEQVSKAEKMLKEKKPLHENPPREWFQTKKERAAIKTSQAGEGLAALILYLQSHSKTLVCSLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
A1A4H6 765 Probable ATP-dependent RN yes N/A 0.573 0.296 0.5 2e-66
Q96GQ7 796 Probable ATP-dependent RN yes N/A 0.573 0.285 0.495 2e-66
Q921N6 760 Probable ATP-dependent RN yes N/A 0.573 0.298 0.5 7e-62
Q0INC5 802 DEAD-box ATP-dependent RN yes N/A 0.636 0.314 0.410 1e-51
Q4P9P3932 ATP-dependent RNA helicas N/A N/A 0.568 0.241 0.436 3e-50
Q9ZRZ8 789 DEAD-box ATP-dependent RN yes N/A 0.593 0.297 0.412 4e-50
P0CQ92 808 ATP-dependent RNA helicas yes N/A 0.560 0.274 0.460 1e-48
P0CQ93 808 ATP-dependent RNA helicas N/A N/A 0.560 0.274 0.460 1e-48
A4QYM6790 ATP-dependent RNA helicas N/A N/A 0.598 0.3 0.376 2e-44
A1D1R8819 ATP-dependent RNA helicas N/A N/A 0.575 0.278 0.376 4e-44
>sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 Back     alignment and function desciption
 Score =  253 bits (647), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 177/244 (72%), Gaps = 17/244 (6%)

Query: 131 FRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQ 190
            RIR +   DR+A++AAL+ RTF DH M+F  TK++AH MHILLGL+G++ GELHGNL+Q
Sbjct: 409 IRIRPNREGDREAIVAALLMRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQ 468

Query: 191 PSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGK 250
             RLE+LR+FKDE+ D+L+ATDVAARGLDI GVKTVIN+ MP++++HY+HRVGRTARAG+
Sbjct: 469 TQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGR 528

Query: 251 GGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKV 310
            G SVS+ GE +RK++K+++K AK PVK RI+P                 +++ K+R K+
Sbjct: 529 AGRSVSLVGEEERKMLKEIVKAAKAPVKARILP----------------QDVILKFRDKI 572

Query: 311 EAIEGEVQKILTEEKHDRLLNKADEQVSKAEKML-KEKKPLHENPPREWFQTKKERAAIK 369
           E +E +V  +L  E  ++ + K++ Q++ A+++L K K+  +  P R WFQTK+ER   K
Sbjct: 573 EKMEKDVYAVLQLEAEEKEMQKSEAQINTAQRLLEKGKEAPNPEPERSWFQTKEERKKEK 632

Query: 370 TSQA 373
            ++A
Sbjct: 633 IAKA 636




Probable ATP-dependent RNA helicase.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 Back     alignment and function description
>sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 Back     alignment and function description
>sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 Back     alignment and function description
>sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 Back     alignment and function description
>sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 Back     alignment and function description
>sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 Back     alignment and function description
>sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
345492254 787 PREDICTED: probable ATP-dependent RNA he 0.555 0.279 0.619 2e-79
332021296 740 Putative ATP-dependent RNA helicase DDX2 0.545 0.291 0.612 1e-76
307214987 734 Probable ATP-dependent RNA helicase DDX2 0.545 0.294 0.604 3e-75
195024659 790 GH21077 [Drosophila grimshawi] gi|193901 0.542 0.272 0.6 3e-73
328704199 771 PREDICTED: probable ATP-dependent RNA he 0.595 0.306 0.557 6e-73
322795050 725 hypothetical protein SINV_07122 [Solenop 0.502 0.274 0.627 8e-73
5901872 641 BcDNA.GM05306 [Drosophila melanogaster] 0.553 0.341 0.581 1e-72
195381768 784 GJ21693 [Drosophila virilis] gi|19414441 0.542 0.274 0.591 1e-72
195123476 787 GI18677 [Drosophila mojavensis] gi|19391 0.542 0.273 0.591 1e-72
195474630 782 GE19181 [Drosophila yakuba] gi|194175695 0.553 0.280 0.581 2e-72
>gi|345492254|ref|XP_001602245.2| PREDICTED: probable ATP-dependent RNA helicase DDX27-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  302 bits (774), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 184/239 (76%), Gaps = 19/239 (7%)

Query: 131 FRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQ 190
            RIRK+   DR+A+LAAL+CRTF DHTM+FV TK++AH +HI+LGLLG+K GELHGNL+Q
Sbjct: 376 IRIRKEREGDREAILAALICRTFHDHTMVFVQTKKQAHRLHIVLGLLGVKVGELHGNLSQ 435

Query: 191 PSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGK 250
           P RLE+LRKFKDEE DVL+ATDVAARGLDI GVKTVIN+ MP +L+HYIHRVGRTARAG+
Sbjct: 436 PQRLENLRKFKDEEIDVLLATDVAARGLDISGVKTVINFVMPATLQHYIHRVGRTARAGR 495

Query: 251 GGVSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKV 310
           GGVSVS+AGE +R LVK+VIK AKNPVK+RIIPP                +I++KY  K+
Sbjct: 496 GGVSVSLAGEQERSLVKEVIKQAKNPVKNRIIPP----------------DIIEKYNKKL 539

Query: 311 EAIEGEVQKILTEEKHDRLLNKADEQVSKAEKMLKEKKPLHENPPREWFQTKKERAAIK 369
           ++IE +V+ IL EE+ DR + K + Q ++AE MLKE     +   R WFQTKKER + K
Sbjct: 540 QSIEEDVENILEEERQDREIAKIENQANRAENMLKESDSKDQ---RSWFQTKKERQSEK 595




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332021296|gb|EGI61675.1| Putative ATP-dependent RNA helicase DDX27 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307214987|gb|EFN89832.1| Probable ATP-dependent RNA helicase DDX27 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195024659|ref|XP_001985916.1| GH21077 [Drosophila grimshawi] gi|193901916|gb|EDW00783.1| GH21077 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|328704199|ref|XP_001943651.2| PREDICTED: probable ATP-dependent RNA helicase DDX27-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322795050|gb|EFZ17898.1| hypothetical protein SINV_07122 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|5901872|gb|AAD55444.1|AF181659_1 BcDNA.GM05306 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195381768|ref|XP_002049617.1| GJ21693 [Drosophila virilis] gi|194144414|gb|EDW60810.1| GJ21693 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195123476|ref|XP_002006232.1| GI18677 [Drosophila mojavensis] gi|193911300|gb|EDW10167.1| GI18677 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195474630|ref|XP_002089594.1| GE19181 [Drosophila yakuba] gi|194175695|gb|EDW89306.1| GE19181 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
FB|FBgn0021995 782 Rs1 "Rs1" [Drosophila melanoga 0.555 0.281 0.549 2.3e-70
UNIPROTKB|J9P9C6 788 DDX27 "Uncharacterized protein 0.568 0.285 0.495 3.7e-64
UNIPROTKB|F1Q073 767 DDX27 "Uncharacterized protein 0.568 0.293 0.491 6.1e-64
MGI|MGI:2385884 760 Ddx27 "DEAD (Asp-Glu-Ala-Asp) 0.568 0.296 0.5 7.7e-64
UNIPROTKB|Q96GQ7 796 DDX27 "Probable ATP-dependent 0.568 0.282 0.495 7.7e-64
UNIPROTKB|A1A4H6 765 DDX27 "Probable ATP-dependent 0.568 0.294 0.5 2.6e-63
ZFIN|ZDB-GENE-031001-8 776 ddx27 "DEAD (Asp-Glu-Ala-Asp) 0.553 0.282 0.5 1.6e-61
UNIPROTKB|I3LIB1 442 LOC100625841 "Uncharacterized 0.568 0.509 0.5 1.9e-60
UNIPROTKB|E1C187 759 DDX27 "Uncharacterized protein 0.568 0.296 0.493 1e-59
UNIPROTKB|F1NQV5 758 DDX27 "Uncharacterized protein 0.568 0.296 0.493 1e-59
FB|FBgn0021995 Rs1 "Rs1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 647 (232.8 bits), Expect = 2.3e-70, Sum P(2) = 2.3e-70
 Identities = 133/242 (54%), Positives = 179/242 (73%)

Query:   133 IRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPS 192
             IR+D   DR+ +LA+L+CRTF DH M+FV TK++AH +HILLGLLG++AGELHGNLTQ  
Sbjct:   382 IREDKEGDREPILASLICRTFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQ 441

Query:   193 RLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGG 252
             RLESL+KFK+E+ DVLIATDVAARGLDI GVKTVIN+ MP + EHYIHRVGRTARAG+ G
Sbjct:   442 RLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAG 501

Query:   253 VSVSMAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKVEA 312
             +SVS+AGE +RK+VK +IKNA++ +K+RIIPP                EI++KYR K+ +
Sbjct:   502 ISVSLAGEKERKIVKDIIKNAESTIKNRIIPP----------------EIIEKYRNKLTS 545

Query:   313 IEGEVQKILTEEKHDRLLNKADEQVSKAEKML----KEKKPLHENPPREWFQTKKERAAI 368
             +E E+Q IL EE+ +R L K ++Q+SK E+ L     E++   +   +   + +K+R A+
Sbjct:   546 LEPEIQNILDEEQAERQLAKTEQQLSKTERKLLGQTNERRGWFQTKQQR--EAEKDRLAL 603

Query:   369 KT 370
              T
Sbjct:   604 TT 605


GO:0003724 "RNA helicase activity" evidence=ISS
GO:0042254 "ribosome biogenesis" evidence=NAS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|J9P9C6 DDX27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q073 DDX27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2385884 Ddx27 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 27" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96GQ7 DDX27 "Probable ATP-dependent RNA helicase DDX27" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4H6 DDX27 "Probable ATP-dependent RNA helicase DDX27" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031001-8 ddx27 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 27" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LIB1 LOC100625841 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C187 DDX27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQV5 DDX27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-38
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-31
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-31
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 7e-29
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 3e-26
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-26
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 7e-26
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 6e-24
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 9e-24
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-23
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-22
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 7e-21
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 9e-18
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-16
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 6e-12
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 5e-11
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 2e-08
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 3e-08
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 1e-07
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 9e-07
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-05
COG1205 851 COG1205, COG1205, Distinct helicase family with a 1e-04
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 4e-04
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  143 bits (361), Expect = 5e-38
 Identities = 69/225 (30%), Positives = 102/225 (45%), Gaps = 17/225 (7%)

Query: 140 DRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRK 199
           ++  LL  L+    +   ++FV TKR   E+   L   G K   LHG+L Q  R  +L K
Sbjct: 259 EKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEK 318

Query: 200 FKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMA- 258
           FKD E  VL+ATDVAARGLDI  V  VINY +P   E Y+HR+GRT RAG+ GV++S   
Sbjct: 319 FKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVT 378

Query: 259 GEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKVEAIEGEVQ 318
            E + K +K++ K  +  +   +                PL E  D    K       ++
Sbjct: 379 EEEEVKKLKRIEKRLERKLPSAV--------------LLPLDEPEDAKLLKT--TRPGLE 422

Query: 319 KILTEEKHDRLLNKADEQVSKAEKMLKEKKPLHENPPREWFQTKK 363
           +        + L  + + + +   +      L  N  +E      
Sbjct: 423 EESDISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPGAGD 467


Length = 513

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 396
KOG0338|consensus691 100.0
KOG0330|consensus476 100.0
KOG0328|consensus400 100.0
KOG0331|consensus519 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0333|consensus673 100.0
KOG0340|consensus442 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0326|consensus459 100.0
KOG0342|consensus543 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0336|consensus629 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0345|consensus567 100.0
KOG0332|consensus477 100.0
KOG0343|consensus 758 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335|consensus482 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0341|consensus610 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0327|consensus397 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0339|consensus731 100.0
KOG0347|consensus731 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.98
KOG0346|consensus569 99.98
KOG0348|consensus708 99.98
KOG0350|consensus620 99.97
KOG0334|consensus 997 99.97
KOG0344|consensus593 99.97
KOG4284|consensus 980 99.97
KOG0337|consensus529 99.96
KOG0351|consensus 941 99.96
PHA02653675 RNA helicase NPH-II; Provisional 99.95
KOG0352|consensus 641 99.95
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.94
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.94
PRK13767 876 ATP-dependent helicase; Provisional 99.94
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.94
PRK106891147 transcription-repair coupling factor; Provisional 99.94
PRK02362 737 ski2-like helicase; Provisional 99.93
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.93
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.93
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.92
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.92
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.92
PRK00254 720 ski2-like helicase; Provisional 99.91
PRK01172 674 ski2-like helicase; Provisional 99.91
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.91
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.9
PRK05298652 excinuclease ABC subunit B; Provisional 99.9
KOG0329|consensus387 99.9
PRK04914 956 ATP-dependent helicase HepA; Validated 99.89
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.89
COG1202 830 Superfamily II helicase, archaea-specific [General 99.89
PHA02558501 uvsW UvsW helicase; Provisional 99.88
PRK09401 1176 reverse gyrase; Reviewed 99.87
PRK14701 1638 reverse gyrase; Provisional 99.87
KOG0349|consensus725 99.86
KOG0353|consensus695 99.86
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.86
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.86
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.85
PRK13766 773 Hef nuclease; Provisional 99.84
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.84
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.83
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.82
KOG0354|consensus746 99.82
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.81
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.81
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.8
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.78
COG1204 766 Superfamily II helicase [General function predicti 99.77
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.76
PRK09694878 helicase Cas3; Provisional 99.75
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.74
KOG0922|consensus 674 99.74
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.74
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.74
COG1205 851 Distinct helicase family with a unique C-terminal 99.74
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.72
KOG0923|consensus 902 99.72
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.71
KOG0950|consensus 1008 99.71
PRK05580679 primosome assembly protein PriA; Validated 99.7
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.69
KOG0952|consensus 1230 99.69
KOG0947|consensus 1248 99.69
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.69
smart0049082 HELICc helicase superfamily c-terminal domain. 99.66
KOG0948|consensus 1041 99.66
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.66
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.64
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.58
KOG0951|consensus 1674 99.56
KOG0924|consensus 1042 99.55
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.55
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.53
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.53
KOG0385|consensus 971 99.5
KOG0926|consensus 1172 99.48
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.44
KOG0920|consensus 924 99.38
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.38
KOG0384|consensus 1373 99.36
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.35
KOG0953|consensus700 99.27
KOG4150|consensus 1034 99.26
KOG0925|consensus 699 99.24
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.04
KOG0391|consensus 1958 99.01
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.81
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.79
KOG0392|consensus1549 98.76
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.75
COG4096 875 HsdR Type I site-specific restriction-modification 98.73
PRK12326764 preprotein translocase subunit SecA; Reviewed 98.73
KOG0387|consensus 923 98.72
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.66
KOG0390|consensus776 98.66
KOG0388|consensus1185 98.65
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.6
KOG0389|consensus941 98.58
KOG1000|consensus689 98.58
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.56
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.54
KOG0386|consensus 1157 98.53
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.53
KOG1123|consensus776 98.51
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.48
KOG0949|consensus 1330 98.47
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.4
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.24
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.18
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.15
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.12
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.05
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.03
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.98
KOG1002|consensus791 97.95
KOG1015|consensus 1567 97.94
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.81
PRK14873665 primosome assembly protein PriA; Provisional 97.73
KOG0951|consensus1674 97.7
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.65
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.46
KOG0921|consensus 1282 97.4
KOG4439|consensus901 97.33
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.16
PF13871278 Helicase_C_4: Helicase_C-like 97.15
COG4889 1518 Predicted helicase [General function prediction on 97.08
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.01
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.86
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.81
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.77
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.77
KOG1016|consensus 1387 96.71
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.94
PRK05580 679 primosome assembly protein PriA; Validated 95.71
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.52
smart00487201 DEXDc DEAD-like helicases superfamily. 95.45
TIGR00595 505 priA primosomal protein N'. All proteins in this f 95.31
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.26
KOG1001|consensus674 95.15
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.79
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 94.71
PRK14873 665 primosome assembly protein PriA; Provisional 94.51
KOG0701|consensus 1606 94.24
COG1198 730 PriA Primosomal protein N' (replication factor Y) 94.12
PRK10689 1147 transcription-repair coupling factor; Provisional 93.6
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.27
PF04851184 ResIII: Type III restriction enzyme, res subunit; 93.16
KOG1513|consensus 1300 93.05
PRK14701 1638 reverse gyrase; Provisional 92.79
KOG2340|consensus698 92.72
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 92.45
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.34
KOG0331|consensus519 92.06
KOG0347|consensus 731 91.56
KOG0343|consensus 758 91.29
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 90.86
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 90.01
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 90.0
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 89.96
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 89.87
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 89.52
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 89.31
KOG0339|consensus 731 88.13
KOG0330|consensus476 86.92
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 86.42
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 84.71
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 84.06
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 84.04
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 84.03
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 83.36
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 82.95
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 82.79
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 82.1
KOG0298|consensus1394 81.5
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 81.39
KOG0338|consensus 691 80.98
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 80.74
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 80.67
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 80.01
>KOG0338|consensus Back     alignment and domain information
Probab=100.00  E-value=2.2e-58  Score=442.49  Aligned_cols=307  Identities=47%  Similarity=0.726  Sum_probs=280.5

Q ss_pred             CCCceEEeCCcccccccccCCCcccccccc--eeecccCCccccccHHHHHHHHHHCCCCCcEEEEeecCChhh-----h
Q psy3145          46 YPQTAIVPNLPRLKFSSEYQPKKFKTKKIT--DFDNDFSFVSSIEEYNKDTEIVVAYCWSKGTFQSNASMTSFL-----F  118 (396)
Q Consensus        46 ~~~~~Iv~t~~~l~~~~~~~~~~l~~~~id--~~De~~~~l~~~~~~~~i~~il~~~~~~~q~ll~SAT~~~~~-----~  118 (396)
                      +...+||+.||+-+..+..+..+|+...+.  ++|++++||.. +|.+++.+|++.||+++|++||||||+..+     .
T Consensus       300 Rs~PDIVIATPGRlIDHlrNs~sf~ldsiEVLvlDEADRMLee-gFademnEii~lcpk~RQTmLFSATMteeVkdL~sl  378 (691)
T KOG0338|consen  300 RSRPDIVIATPGRLIDHLRNSPSFNLDSIEVLVLDEADRMLEE-GFADEMNEIIRLCPKNRQTMLFSATMTEEVKDLASL  378 (691)
T ss_pred             hhCCCEEEecchhHHHHhccCCCccccceeEEEechHHHHHHH-HHHHHHHHHHHhccccccceeehhhhHHHHHHHHHh
Confidence            334444555554444444455555544444  55888888765 999999999999999999999999999999     7


Q ss_pred             ccCCCeEEEE------------EEEEEecCChhhHHHHHHHHHhhcCCCcEEEEeCChHHHHHHHHHHHhcCCceEEeeC
Q psy3145         119 LLRPPVLLCL------------LCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHG  186 (396)
Q Consensus       119 ~l~~p~~i~~------------~~~~~~~~~~~~k~~~l~~ll~~~~~~~~iIF~~t~~~~~~l~~~L~~~~~~~~~lhg  186 (396)
                      +|++|++|.+            +|+++++..+..+..+|..++.+.+..++|||+.|++.|+++.-+|...|++++.+||
T Consensus       379 SL~kPvrifvd~~~~~a~~LtQEFiRIR~~re~dRea~l~~l~~rtf~~~~ivFv~tKk~AHRl~IllGLlgl~agElHG  458 (691)
T KOG0338|consen  379 SLNKPVRIFVDPNKDTAPKLTQEFIRIRPKREGDREAMLASLITRTFQDRTIVFVRTKKQAHRLRILLGLLGLKAGELHG  458 (691)
T ss_pred             hcCCCeEEEeCCccccchhhhHHHheeccccccccHHHHHHHHHHhcccceEEEEehHHHHHHHHHHHHHhhchhhhhcc
Confidence            8999999998            7999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHhhcCCceEEEeecccccccccCCccEEEEecCCCChhHHHHHHhhcccCCCCceEEEEEcCccHHHH
Q psy3145         187 NLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLV  266 (396)
Q Consensus       187 ~~~~~~r~~~~~~f~~g~~~vLvaT~~~~~Gidi~~v~~VI~~~~p~s~~~y~qr~GRagR~g~~g~~i~l~~~~e~~~~  266 (396)
                      +++|.+|.+.+++|++++++||||||+++||+||++|.+||||++|.+...|+||+||++|+|+.|.+++|+++.|++++
T Consensus       459 sLtQ~QRlesL~kFk~~eidvLiaTDvAsRGLDI~gV~tVINy~mP~t~e~Y~HRVGRTARAGRaGrsVtlvgE~dRkll  538 (691)
T KOG0338|consen  459 SLTQEQRLESLEKFKKEEIDVLIATDVASRGLDIEGVQTVINYAMPKTIEHYLHRVGRTARAGRAGRSVTLVGESDRKLL  538 (691)
T ss_pred             cccHHHHHHHHHHHHhccCCEEEEechhhccCCccceeEEEeccCchhHHHHHHHhhhhhhcccCcceEEEeccccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHH---cCCCCccccCCCCCCCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHHhh
Q psy3145         267 KQVIKN---AKNPVKHRIIPPGYPRLKTPSFPPPPLAEIVDKYRAKVEAIEGEVQKILTEEKHDRLLNKADEQVSKAEKM  343 (396)
Q Consensus       267 ~~i~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~a~~~  343 (396)
                      +.+.++   .+.+++.+.+|+                +.+.+|..++++++..+..++.++..++++.++++++.+++|+
T Consensus       539 K~iik~~~~a~~klk~R~i~~----------------~~Iek~~~~ieemE~~iq~vl~eE~~ekel~~ae~ql~k~en~  602 (691)
T KOG0338|consen  539 KEIIKSSTKAGSKLKNRNIPP----------------EVIEKFRKKIEEMEDTIQAVLDEEREEKELSKAEAQLEKGENM  602 (691)
T ss_pred             HHHHhhhhhcccchhhcCCCH----------------HHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhHHHHHHHH
Confidence            999998   677788888888                9999999999999999999999999999999999999999999


Q ss_pred             ccccCCCccCCcccccccHHHHHHHH
Q psy3145         344 LKEKKPLHENPPREWFQTKKERAAIK  369 (396)
Q Consensus       344 l~~~~~i~~~~~~~w~~~~~~~~~~~  369 (396)
                      |++++++..+|+|+||+++++|+.++
T Consensus       603 Le~g~ei~arprRtWFqte~~kk~~K  628 (691)
T KOG0338|consen  603 LEHGDEIYARPRRTWFQTEKDKKASK  628 (691)
T ss_pred             HhhccccccCccchhhhhhHHHHHHH
Confidence            99999999999999999999998874



>KOG0330|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 5e-23
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 9e-23
2jgn_A185 Ddx3 Helicase Domain Length = 185 2e-21
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 7e-21
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-20
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 1e-18
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 4e-18
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 5e-16
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-16
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-16
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 6e-16
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 7e-16
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 9e-16
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-15
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-15
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-15
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-15
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-15
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-15
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 1e-14
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 7e-14
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 1e-13
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 1e-13
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 2e-13
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-13
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-13
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 2e-13
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 2e-13
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-12
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-12
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-12
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-12
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 3e-12
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 3e-12
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-12
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 4e-12
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 6e-12
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 1e-11
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-11
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 7e-11
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 8e-11
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 4e-09
2vso_A395 Crystal Structure Of A Translation Initiation Compl 8e-09
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-08
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 9e-08
3uwx_B683 Crystal Structure Of Uvra-Uvrb Complex Length = 683 7e-05
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 9e-05
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 1e-04
1d9z_A657 Crystal Structure Of The Dna Repair Protein Uvrb In 2e-04
1d9x_A658 Crystal Structure Of The Dna Repair Protein Uvrb Le 2e-04
2fdc_A658 Structural Basis Of Dna Damage Recognition And Proc 2e-04
1t5l_A658 Crystal Structure Of The Dna Repair Protein Uvrb Po 2e-04
4gl2_A699 Structural Basis For Dsrna Duplex Backbone Recognit 5e-04
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure

Iteration: 1

Score = 105 bits (262), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 48/112 (42%), Positives = 74/112 (66%), Gaps = 3/112 (2%) Query: 149 VCRTFKD---HTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEET 205 +CR K+ + ++F TKR+ E+ L +G KAG +HG+L+Q R + +R FK ++ Sbjct: 230 LCRLLKNKEFYGLVFCKTKRDTKELASXLRDIGFKAGAIHGDLSQSQREKVIRLFKQKKI 289 Query: 206 DVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSM 257 +LIATDV +RG+D+ + VINY +P + E Y HR+GRT RAGK G ++S+ Sbjct: 290 RILIATDVXSRGIDVNDLNCVINYHLPQNPESYXHRIGRTGRAGKKGKAISI 341
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|3UWX|B Chain B, Crystal Structure Of Uvra-Uvrb Complex Length = 683 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1D9Z|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb In Complex With Atp Length = 657 Back     alignment and structure
>pdb|1D9X|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Length = 658 Back     alignment and structure
>pdb|2FDC|A Chain A, Structural Basis Of Dna Damage Recognition And Processing By Uvrb: Crystal Structure Of A UvrbDNA COMPLEX Length = 658 Back     alignment and structure
>pdb|1T5L|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Point Mutant Y96a Revealing A Novel Fold For Domain 2 Length = 658 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 9e-46
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 4e-42
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 5e-42
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 9e-41
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-40
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 8e-40
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-39
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 6e-39
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 7e-39
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 6e-38
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-37
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 8e-36
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-35
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-34
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 9e-34
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-33
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 5e-33
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-33
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 7e-33
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 3e-32
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 4e-32
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-32
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 9e-31
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-30
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 7e-26
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 4e-16
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-10
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-09
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-09
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-09
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-09
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-07
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 3e-06
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 7e-06
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 3e-05
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-05
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-04
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 4e-04
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 7e-04
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
 Score =  154 bits (391), Expect = 9e-46
 Identities = 58/157 (36%), Positives = 91/157 (57%), Gaps = 1/157 (0%)

Query: 138 HLDRK-ALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLES 196
            L+ K ALL  L+ +     +++FV  +   HE+   L   GI    L G + Q  R E+
Sbjct: 13  DLEHKTALLVHLLKQPEATRSIVFVRKRERVHELANWLREAGINNCYLEGEMVQGKRNEA 72

Query: 197 LRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVS 256
           +++  +   +VL+ATDVAARG+DI  V  V N+ MP S + Y+HR+GRTARAG+ G ++S
Sbjct: 73  IKRLTEGRVNVLVATDVAARGIDIPDVSHVFNFDMPRSGDTYLHRIGRTARAGRKGTAIS 132

Query: 257 MAGEVDRKLVKQVIKNAKNPVKHRIIPPGYPRLKTPS 293
           +    D  L+ +V +  + P+K R+I    P+ + PS
Sbjct: 133 LVEAHDHLLLGKVGRYIEEPIKARVIDELRPKTRAPS 169


>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.97
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.97
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.97
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.96
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.96
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.96
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.96
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.96
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.96
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.96
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.96
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.95
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.95
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.94
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.94
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.9
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.94
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.94
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.94
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.93
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.93
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.93
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.93
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.93
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.93
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.93
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.93
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.93
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.93
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.92
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.92
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.92
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.92
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.92
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.92
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.92
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.92
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.92
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.91
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.91
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.91
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.9
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.89
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.89
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.89
3h1t_A590 Type I site-specific restriction-modification syst 99.87
3jux_A822 Protein translocase subunit SECA; protein transloc 99.86
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.84
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.83
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.8
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.69
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.69
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.7
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.49
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.46
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.43
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.33
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.31
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.3
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.3
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.29
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.27
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.27
3bor_A237 Human initiation factor 4A-II; translation initiat 98.26
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.21
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.18
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.16
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.12
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.11
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.08
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.91
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.43
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.29
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 96.65
3b6e_A216 Interferon-induced helicase C domain-containing P; 95.39
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.28
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 94.54
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 94.29
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.38
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 92.07
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 91.88
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 91.77
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.59
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 91.05
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 90.61
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 90.38
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 88.89
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 88.61
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 87.99
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 87.87
3bor_A237 Human initiation factor 4A-II; translation initiat 86.95
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 86.48
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 85.59
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 84.68
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 80.92
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 80.88
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 80.64
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 80.51
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 80.49
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=4.2e-35  Score=293.93  Aligned_cols=203  Identities=30%  Similarity=0.443  Sum_probs=171.6

Q ss_pred             cccceeEEEeccccccccCCCCCCceEEeCCcccccccccCCCcccccccceeecccCCccccccHHHHHHHHHHC--CC
Q psy3145          25 EVEGLRVYVETEACPKANLGWYPQTAIVPNLPRLKFSSEYQPKKFKTKKITDFDNDFSFVSSIEEYNKDTEIVVAY--CW  102 (396)
Q Consensus        25 ~~~~l~~lViDEAh~~~~~gf~~~~~Iv~t~~~l~~~~~~~~~~l~~~~id~~De~~~~l~~~~~~~~i~~il~~~--~~  102 (396)
                      .+.+++++|+||||++.++||.+.+                                            ..|+..+  ++
T Consensus       200 ~l~~~~~lVlDEah~~~~~gf~~~~--------------------------------------------~~i~~~~~~~~  235 (434)
T 2db3_A          200 TFEDTRFVVLDEADRMLDMGFSEDM--------------------------------------------RRIMTHVTMRP  235 (434)
T ss_dssp             CCTTCCEEEEETHHHHTSTTTHHHH--------------------------------------------HHHHHCTTSCS
T ss_pred             ccccCCeEEEccHhhhhccCcHHHH--------------------------------------------HHHHHhcCCCC
Confidence            3667899999999998887765444                                            6667664  67


Q ss_pred             CCcEEEEeecCChhh-----hccCCCeEEEE----------EEEEEecCChhhHHHHHHHHHhhcCCCcEEEEeCChHHH
Q psy3145         103 SKGTFQSNASMTSFL-----FLLRPPVLLCL----------LCFRIRKDTHLDRKALLAALVCRTFKDHTMIFVPTKREA  167 (396)
Q Consensus       103 ~~q~ll~SAT~~~~~-----~~l~~p~~i~~----------~~~~~~~~~~~~k~~~l~~ll~~~~~~~~iIF~~t~~~~  167 (396)
                      ++|+++||||+|+.+     .++.+|..+.+          ..... ......|...|..++..... ++||||+|++.|
T Consensus       236 ~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~-~~~~~~k~~~l~~~l~~~~~-~~lVF~~t~~~a  313 (434)
T 2db3_A          236 EHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIY-EVNKYAKRSKLIEILSEQAD-GTIVFVETKRGA  313 (434)
T ss_dssp             SCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEE-ECCGGGHHHHHHHHHHHCCT-TEEEECSSHHHH
T ss_pred             CceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEE-EeCcHHHHHHHHHHHHhCCC-CEEEEEeCcHHH
Confidence            899999999999987     56778877765          11111 22345677888888866554 499999999999


Q ss_pred             HHHHHHHHhcCCceEEeeCCCCHHHHHHHHHHhhcCCceEEEeecccccccccCCccEEEEecCCCChhHHHHHHhhccc
Q psy3145         168 HEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAARGLDIRGVKTVINYRMPHSLEHYIHRVGRTAR  247 (396)
Q Consensus       168 ~~l~~~L~~~~~~~~~lhg~~~~~~r~~~~~~f~~g~~~vLvaT~~~~~Gidi~~v~~VI~~~~p~s~~~y~qr~GRagR  247 (396)
                      +.++..|...|+.+..+||++++.+|..+++.|++|+.+|||||+++++|+|+|++++|||||+|++...|+||+||+||
T Consensus       314 ~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR  393 (434)
T 2db3_A          314 DFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGR  393 (434)
T ss_dssp             HHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSC
T ss_pred             HHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceEEEEEcC-ccHHHHHHHHHHc
Q psy3145         248 AGKGGVSVSMAGE-VDRKLVKQVIKNA  273 (396)
Q Consensus       248 ~g~~g~~i~l~~~-~e~~~~~~i~~~~  273 (396)
                      .|+.|.+++|+++ .+....+.+.+.+
T Consensus       394 ~g~~G~a~~~~~~~~~~~~~~~l~~~l  420 (434)
T 2db3_A          394 VGNNGRATSFFDPEKDRAIAADLVKIL  420 (434)
T ss_dssp             TTCCEEEEEEECTTTCGGGHHHHHHHH
T ss_pred             CCCCCEEEEEEeccccHHHHHHHHHHH
Confidence            9999999999994 4555555555544



>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-27
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-20
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-18
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-16
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-16
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-16
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 8e-14
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-13
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 3e-13
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 3e-12
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 5e-12
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 7e-12
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 1e-09
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 9e-09
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 5e-08
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-06
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]
 Score =  108 bits (271), Expect = 2e-27
 Identities = 23/111 (20%), Positives = 38/111 (34%), Gaps = 14/111 (12%)

Query: 157 TMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRL----------ESLRKFKDEETD 206
            +IF  +K++  E+   L  LGI A   +  L                ++L      + D
Sbjct: 39  HLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVATDALMTGFTGDFD 98

Query: 207 VLIATDVAARG---LDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVS 254
            +I  +          +    T+    +P        R GRT R GK G+ 
Sbjct: 99  SVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGR-GKPGIY 148


>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.97
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.97
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.95
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.95
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.91
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.89
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.85
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.85
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.82
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.82
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.82
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.8
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.73
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.61
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.56
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.54
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.35
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.79
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.75
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.73
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.72
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.72
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.68
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.59
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.52
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.39
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.2
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 97.8
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.36
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.94
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.87
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.56
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.21
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.01
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.75
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 93.71
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.24
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 91.15
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 89.57
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 87.01
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.65
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.36
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 80.21
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=8.6e-33  Score=238.07  Aligned_cols=143  Identities=27%  Similarity=0.456  Sum_probs=132.0

Q ss_pred             CChhhHHHHHHHHHhhcCCCcEEEEeCChHHHHHHHHHHHhcCCceEEeeCCCCHHHHHHHHHHhhcCCceEEEeecccc
Q psy3145         136 DTHLDRKALLAALVCRTFKDHTMIFVPTKREAHEMHILLGLLGIKAGELHGNLTQPSRLESLRKFKDEETDVLIATDVAA  215 (396)
Q Consensus       136 ~~~~~k~~~l~~ll~~~~~~~~iIF~~t~~~~~~l~~~L~~~~~~~~~lhg~~~~~~r~~~~~~f~~g~~~vLvaT~~~~  215 (396)
                      .....|...|..++......++||||+|+..++.++..|...|+.+..+||+|++.+|..+++.|+.|+.++||||++++
T Consensus         9 ~~~e~K~~~L~~ll~~~~~~k~iIF~~s~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~   88 (162)
T d1fuka_           9 EEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLA   88 (162)
T ss_dssp             ESGGGHHHHHHHHHHHTTCSCEEEEESSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEEEGGGT
T ss_pred             CCcHHHHHHHHHHHHhCCCCcEEEEEEEEchHHHHHHHHhhcCceEEEeccCCchhhHHHHHHHHhhcccceeecccccc
Confidence            34567999999999988889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCccEEEEecCCCChhHHHHHHhhcccCCCCceEEEEEcCccHHHHHHHHHHcCCCCc
Q psy3145         216 RGLDIRGVKTVINYRMPHSLEHYIHRVGRTARAGKGGVSVSMAGEVDRKLVKQVIKNAKNPVK  278 (396)
Q Consensus       216 ~Gidi~~v~~VI~~~~p~s~~~y~qr~GRagR~g~~g~~i~l~~~~e~~~~~~i~~~~~~~~~  278 (396)
                      ||+|+|+|++|||||+|+++..|+||+||+||.|+.|.|++|+++.|...++.+++.++..+.
T Consensus        89 rGiDi~~v~~VI~~d~P~~~~~yihR~GR~gR~g~~g~~i~~~~~~d~~~~~~i~~~~~~~~~  151 (162)
T d1fuka_          89 RGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIE  151 (162)
T ss_dssp             TTCCCCSCSEEEESSCCSSGGGGGGSSCSCC-----CEEEEEEETTTHHHHHHHHHHSSCCCE
T ss_pred             ccccCCCceEEEEeccchhHHHHHhhccccccCCCccEEEEEcCHHHHHHHHHHHHHHcCcCC
Confidence            999999999999999999999999999999999999999999999999999999999887655



>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure