Psyllid ID: psy3185

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MKVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEPIKLISPLPNSTDLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVES
cccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccccHHHHHHHHHHccEEEEEccHHHHHHHHHHHHccccccccEEEEcccccccccccccccccEEEccccccccccccccEEEEEccccccccccccccEEEEEEHHHcHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccHHHHHHHHHHcccEEEEEc
cccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccHHHcccEEEcccccccccccccccEEEcccEEEEccccccccEEEEEEEEccHHHHHHHHHHHHHHcccccEEEEccccHHHHccccccccEcccHHHHHHHHHHcccEEEEcc
MKVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGvmfenvpssepiklisplpnstdlEKVQTTLKQFVRDWseegseerktcyEPIISEilarfppetinpkdvnilvpgaglgRLAFEIARRGYVCQGNEFSLFMLFASNFILnkcreknvykiypwvqqtdnnilthhqtmavtfpdintsdynddcdfsmaagdflqvyvhpnkwdcvaTCFFIDCANNIVSFIETIFNIlkpggiwinlgpLLYHysnmlnedsiepSYEVVKQVIQGLGFVYEVES
mkvkrneqyleslpeKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSepiklisplpnstdLEKVQTTLKQFVrdwseegseerktcYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVES
MKVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEPIKLISPLPNSTDLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVES
*********************SKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVP******L**************TTLKQFVRDW********KTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYE***
MKVKRN*QYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVP******************KVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVE*
********YLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEPIKLISPLPNSTDLEKVQTTLKQFVR**********KTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVES
MKVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENV********ISPLPNSTDLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEPIKLISPLPNSTDLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
Q80UY1400 UPF0586 protein C9orf41 h yes N/A 0.989 0.737 0.542 8e-91
Q8N4J0409 UPF0586 protein C9orf41 O yes N/A 0.989 0.721 0.545 3e-90
Q5BJZ6400 UPF0586 protein C9orf41 h yes N/A 0.989 0.737 0.531 5e-89
Q9I7X6439 UPF0586 protein CG11596 O yes N/A 0.986 0.669 0.479 1e-79
Q9Y7J3373 UPF0586 protein C1778.07 yes N/A 0.956 0.764 0.388 3e-54
Q54ST2463 UPF0586 protein OS=Dictyo yes N/A 0.946 0.609 0.382 2e-48
P53934400 UPF0586 protein YNL092W O yes N/A 0.852 0.635 0.313 5e-34
Q03648457 Uncharacterized protein Y no N/A 0.600 0.391 0.276 5e-07
>sp|Q80UY1|CI041_MOUSE UPF0586 protein C9orf41 homolog OS=Mus musculus PE=2 SV=1 Back     alignment and function desciption
 Score =  333 bits (854), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 205/297 (69%), Gaps = 2/297 (0%)

Query: 2   KVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEP 61
           +V R E+   SLPE  QKLL ++  HL+ ++ CID N EI+  I+ D   MFEN    E 
Sbjct: 74  RVNRTERQFRSLPENQQKLLPQFPLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYGED 133

Query: 62  IKLISPLPNST-DLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKD 120
                 +P ST D++K+++TLKQFVRDWSE G  ER  CY+PII EI+  FP E  +P  
Sbjct: 134 ANG-KIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYKPIIKEIIKNFPKERWDPSK 192

Query: 121 VNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTD 180
           VNILVPGAGLGRLA+E+A  GY CQGNE+S FMLF+SNF+LN+C E N YK+YPW+ Q  
Sbjct: 193 VNILVPGAGLGRLAWEVAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFS 252

Query: 181 NNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNI 240
           NN  +  Q   + FPD++        +FSM AGDF ++Y   N WDC+ATCFFID A+N+
Sbjct: 253 NNRRSADQIRPILFPDVDPHSLPPGSNFSMTAGDFQEIYSECNAWDCIATCFFIDTAHNV 312

Query: 241 VSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVE 297
           + +I+TI+ ILKPGGIWINLGPLLYH+ N+ NE SIE SYE +K V+   GF  EVE
Sbjct: 313 IDYIDTIWRILKPGGIWINLGPLLYHFENLANELSIELSYEDIKNVVLQYGFQLEVE 369

Mus musculus (taxid: 10090)
>sp|Q8N4J0|CI041_HUMAN UPF0586 protein C9orf41 OS=Homo sapiens GN=C9orf41 PE=1 SV=1 Back     alignment and function description
>sp|Q5BJZ6|CI041_RAT UPF0586 protein C9orf41 homolog OS=Rattus norvegicus PE=2 SV=1 Back     alignment and function description
>sp|Q9I7X6|U586_DROME UPF0586 protein CG11596 OS=Drosophila melanogaster GN=CG11596 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y7J3|YOI7_SCHPO UPF0586 protein C1778.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 Back     alignment and function description
>sp|Q54ST2|U586_DICDI UPF0586 protein OS=Dictyostelium discoideum GN=DDB_G0282239 PE=3 SV=1 Back     alignment and function description
>sp|P53934|YNJ2_YEAST UPF0586 protein YNL092W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL092W PE=1 SV=1 Back     alignment and function description
>sp|Q03648|YM59_YEAST Uncharacterized protein YMR209C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR209C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
383854597 402 PREDICTED: UPF0586 protein C9orf41 homol 0.993 0.736 0.661 1e-114
328785109398 PREDICTED: UPF0586 protein C9orf41 homol 0.996 0.746 0.649 1e-113
380022359398 PREDICTED: UPF0586 protein C9orf41 homol 0.996 0.746 0.649 1e-113
340724696393 PREDICTED: UPF0586 protein C9orf41 homol 0.996 0.755 0.652 1e-113
350398180 399 PREDICTED: UPF0586 protein C9orf41 homol 0.996 0.744 0.642 1e-112
307169373393 UPF0586 protein C9orf41-like protein [Ca 0.996 0.755 0.638 1e-111
307201516396 UPF0586 protein C9orf41-like protein [Ha 0.993 0.747 0.634 1e-111
345493499397 PREDICTED: UPF0586 protein C9orf41 homol 0.993 0.745 0.651 1e-110
332027213396 UPF0586 protein C9orf41-like protein [Ac 0.996 0.75 0.628 1e-110
321476561356 hypothetical protein DAPPUDRAFT_43139 [D 0.986 0.825 0.584 1e-103
>gi|383854597|ref|XP_003702807.1| PREDICTED: UPF0586 protein C9orf41 homolog [Megachile rotundata] Back     alignment and taxonomy information
 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 236/304 (77%), Gaps = 8/304 (2%)

Query: 2   KVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENV-PSS- 59
           +VK+ E YL SLP KHQKLLSKY++HL ++K CI+ N EIIKLIIKDV  +FENV PSS 
Sbjct: 42  RVKKTESYLSSLPTKHQKLLSKYREHLQEVKRCIENNDEIIKLIIKDVAHIFENVSPSSA 101

Query: 60  --EPIK----LISPLPNSTDLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPP 113
             E ++     ++P P   D EKVQ T+KQ VRDWS EG+EER  CY+PII EI+ +FP 
Sbjct: 102 QTESVRKVHLTLNPRPVMADQEKVQATIKQLVRDWSVEGTEERSACYQPIIDEIMNQFPL 161

Query: 114 ETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIY 173
           +   P DV ILVPGAGLGRLA+EIARRGY CQGNEFSLFMLFAS+F+LNKCR  N Y+++
Sbjct: 162 DYCTPSDVQILVPGAGLGRLAYEIARRGYTCQGNEFSLFMLFASHFVLNKCRGINSYQVH 221

Query: 174 PWVQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFF 233
           PWV Q  NN+   HQT AV FPD+N SD  ++  FSMAAGDFL+VY   N WDCVATCFF
Sbjct: 222 PWVHQYMNNLKPEHQTQAVFFPDVNPSDLPENAQFSMAAGDFLEVYTEDNHWDCVATCFF 281

Query: 234 IDCANNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFV 293
           IDCANN+V FIETI+ ILKPGGIWINLGPLLYH+S+M  EDSIEPSY+VV+ VIQG GF 
Sbjct: 282 IDCANNVVQFIETIYKILKPGGIWINLGPLLYHFSDMPMEDSIEPSYDVVRDVIQGFGFE 341

Query: 294 YEVE 297
            E E
Sbjct: 342 LEKE 345

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328785109|ref|XP_623835.3| PREDICTED: UPF0586 protein C9orf41 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|380022359|ref|XP_003695017.1| PREDICTED: UPF0586 protein C9orf41 homolog [Apis florea] Back     alignment and taxonomy information
>gi|340724696|ref|XP_003400717.1| PREDICTED: UPF0586 protein C9orf41 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398180|ref|XP_003485110.1| PREDICTED: UPF0586 protein C9orf41 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|307169373|gb|EFN62094.1| UPF0586 protein C9orf41-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307201516|gb|EFN81279.1| UPF0586 protein C9orf41-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345493499|ref|XP_001601476.2| PREDICTED: UPF0586 protein C9orf41 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332027213|gb|EGI67302.1| UPF0586 protein C9orf41-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|321476561|gb|EFX87521.1| hypothetical protein DAPPUDRAFT_43139 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
ZFIN|ZDB-GENE-050306-48373 zgc:112985 "zgc:112985" [Danio 0.993 0.793 0.538 4.1e-88
MGI|MGI:1914633400 2410127L17Rik "RIKEN cDNA 2410 0.989 0.737 0.542 3e-85
FB|FBgn0023522439 CG11596 [Drosophila melanogast 0.986 0.669 0.479 1.5e-74
POMBASE|SPBC1778.07373 SPBC1778.07 "methyltransferase 0.949 0.758 0.394 1.5e-51
TAIR|locus:2045542571 AT2G32170 [Arabidopsis thalian 0.781 0.408 0.423 6.8e-51
TAIR|locus:2045547463 AT2G32160 "AT2G32160" [Arabido 0.755 0.485 0.445 1.1e-50
DICTYBASE|DDB_G0282239463 DDB_G0282239 "N2227-like domai 0.979 0.630 0.378 2.6e-47
ASPGD|ASPL0000056516418 AN0865 [Emericella nidulans (t 0.885 0.631 0.366 1.9e-44
CGD|CAL0000364395 orf19.592 [Candida albicans (t 0.694 0.524 0.334 6.5e-39
UNIPROTKB|Q59X87395 CaO19.592 "Putative uncharacte 0.694 0.524 0.334 6.5e-39
ZFIN|ZDB-GENE-050306-48 zgc:112985 "zgc:112985" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 880 (314.8 bits), Expect = 4.1e-88, P = 4.1e-88
 Identities = 160/297 (53%), Positives = 212/297 (71%)

Query:     2 KVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEP 61
             +V R E+    LP+ HQ+LL+ +  HLN L+ CID+N E+++ ++ +   MFEN+   + 
Sbjct:    45 RVNRAERQFRCLPDHHQQLLTNFLPHLNKLRYCIDQNQEVLQAVVHNCLHMFENMEYGQD 104

Query:    62 IKLISPLPNST-DLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKD 120
             +      P+ST D++K+++T+KQFVRDWSE G  ER +CY+PII EI   FPP+  +   
Sbjct:   105 VDPRKVRPSSTFDMDKLKSTIKQFVRDWSEAGKAERDSCYKPIIDEIQRLFPPDQCDVSQ 164

Query:   121 VNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTD 180
             V +LVPGAGLGRLA+EIA  GY CQGNE+S FMLF+SNF+LN+C ++N   +YPW+ Q  
Sbjct:   165 VRVLVPGAGLGRLAWEIAHLGYSCQGNEWSFFMLFSSNFVLNRCDKENALTLYPWIHQFS 224

Query:   181 NNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNI 240
             NN  +  QT  V+FPD+N     +D DFSM AGDF +VY  P  WDCVATCFFID A+N+
Sbjct:   225 NNKASSDQTRPVSFPDVNPQSLPEDSDFSMVAGDFQEVYNDPEMWDCVATCFFIDTAHNV 284

Query:   241 VSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVE 297
             + +IETI+NILKPGG+W+NLGPLLYHY NM NE SIE SYE +K V    GFV E+E
Sbjct:   285 LDYIETIWNILKPGGVWLNLGPLLYHYENMANELSIELSYEDIKAVAMKYGFVLELE 341
GO:0008150 "biological_process" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
MGI|MGI:1914633 2410127L17Rik "RIKEN cDNA 2410127L17 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0023522 CG11596 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPBC1778.07 SPBC1778.07 "methyltransferase N2227 family" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2045542 AT2G32170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045547 AT2G32160 "AT2G32160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282239 DDB_G0282239 "N2227-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056516 AN0865 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0000364 orf19.592 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59X87 CaO19.592 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54ST2U586_DICDINo assigned EC number0.38250.94630.6090yesN/A
Q5BJZ6CI041_RATNo assigned EC number0.53190.98990.7375yesN/A
P53934YNJ2_YEASTNo assigned EC number0.31310.85230.635yesN/A
Q9Y7J3YOI7_SCHPONo assigned EC number0.38830.95630.7640yesN/A
Q8N4J0CI041_HUMANNo assigned EC number0.54540.98990.7212yesN/A
Q80UY1CI041_MOUSENo assigned EC number0.54200.98990.7375yesN/A
Q9I7X6U586_DROMENo assigned EC number0.47970.98650.6697yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
pfam07942268 pfam07942, N2227, N2227-like protein 1e-108
>gnl|CDD|219653 pfam07942, N2227, N2227-like protein Back     alignment and domain information 
 Score =  315 bits (809), Expect = e-108
 Identities = 114/234 (48%), Positives = 147/234 (62%), Gaps = 2/234 (0%)

Query: 67  PLPNSTDLEKVQTTLKQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVP 126
              +  D+ KV++TL+Q VRDWS EG  ER   Y+PII E+   FP  + +   + ILVP
Sbjct: 5   VNVSRGDMSKVRSTLRQIVRDWSAEGQVERDPLYKPIIEELNRLFPSRSHDRSKIRILVP 64

Query: 127 GAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTH 186
           GAGLGRLA+E+A  GY  QGNEFS FML  SNFILN C+E+N   IYP++    N +   
Sbjct: 65  GAGLGRLAYELATLGYQVQGNEFSYFMLLCSNFILNYCKEENQITIYPFIHSFSNQLTRD 124

Query: 187 HQTMAVTFPDINTSDYND-DCDFSMAAGDFLQVYVHPNK-WDCVATCFFIDCANNIVSFI 244
            Q   V  PD++         +FSM AGDFL+VY      +D V TCFFID A+N++ +I
Sbjct: 125 DQLRPVQIPDVHPLSELGPRGNFSMCAGDFLEVYGEDANSYDVVVTCFFIDTAHNVLEYI 184

Query: 245 ETIFNILKPGGIWINLGPLLYHYSNMLNEDSIEPSYEVVKQVIQGLGFVYEVES 298
           +TI  ILKPGG WINLGPLLYH+  + +E SIE S E +K++    GF  E E 
Sbjct: 185 DTIEKILKPGGHWINLGPLLYHFEPLPDEMSIELSLEDIKRLATKRGFKDEKEE 238

This family features sequences that are similar to a region of hypothetical yeast gene product N2227. This is thought to be expressed during meiosis and may be involved in the defence response to stressful conditions. Length = 268

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
KOG2798|consensus369 100.0
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 100.0
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.84
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.81
PLN02233261 ubiquinone biosynthesis methyltransferase 99.8
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.8
PRK11207197 tellurite resistance protein TehB; Provisional 99.8
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.79
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.79
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.78
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.74
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.74
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.73
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.73
PLN02244340 tocopherol O-methyltransferase 99.73
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.69
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.69
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.69
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.69
PRK12335287 tellurite resistance protein TehB; Provisional 99.69
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.68
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.68
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.67
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.67
TIGR00452314 methyltransferase, putative. Known examples to dat 99.66
PRK05785226 hypothetical protein; Provisional 99.66
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.66
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.65
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 99.65
PLN02490340 MPBQ/MSBQ methyltransferase 99.65
KOG1540|consensus296 99.65
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.64
KOG1270|consensus282 99.63
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.63
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.62
PLN02336475 phosphoethanolamine N-methyltransferase 99.61
PRK13256226 thiopurine S-methyltransferase; Reviewed 99.61
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.61
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.61
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.6
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.6
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.59
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.58
PRK06202232 hypothetical protein; Provisional 99.57
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.57
KOG1271|consensus227 99.56
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.56
PRK08317241 hypothetical protein; Provisional 99.55
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.55
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.55
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.54
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.54
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.53
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.52
PLN02336 475 phosphoethanolamine N-methyltransferase 99.51
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.5
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.49
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.49
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.47
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.46
TIGR03438301 probable methyltransferase. This model represents 99.45
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.43
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.42
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.41
PRK14968188 putative methyltransferase; Provisional 99.41
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.41
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.4
PRK04266226 fibrillarin; Provisional 99.39
PRK06922 677 hypothetical protein; Provisional 99.38
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.38
PRK14967223 putative methyltransferase; Provisional 99.37
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.36
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.35
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.35
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.34
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.33
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.33
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.33
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.31
KOG4300|consensus252 99.3
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.29
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.29
PHA03411279 putative methyltransferase; Provisional 99.29
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.28
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.25
PTZ00146293 fibrillarin; Provisional 99.24
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.23
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.23
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 99.22
PLN02232160 ubiquinone biosynthesis methyltransferase 99.22
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.19
KOG2361|consensus264 99.18
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.18
PRK07402196 precorrin-6B methylase; Provisional 99.17
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.17
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.16
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.16
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.16
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.15
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.15
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.15
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.14
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 99.1
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.09
COG4123248 Predicted O-methyltransferase [General function pr 99.08
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.07
PRK00811283 spermidine synthase; Provisional 99.07
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 99.06
PLN03075296 nicotianamine synthase; Provisional 99.06
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.06
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 99.05
KOG1541|consensus270 99.04
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.03
PHA03412241 putative methyltransferase; Provisional 99.03
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 99.03
TIGR00438188 rrmJ cell division protein FtsJ. 99.01
KOG2940|consensus325 99.01
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.99
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.98
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.98
PRK03612521 spermidine synthase; Provisional 98.97
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.95
PRK01581374 speE spermidine synthase; Validated 98.93
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.91
PRK04457262 spermidine synthase; Provisional 98.9
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.9
PRK10901427 16S rRNA methyltransferase B; Provisional 98.9
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.89
KOG3045|consensus325 98.88
PRK14904445 16S rRNA methyltransferase B; Provisional 98.86
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.85
PLN02366308 spermidine synthase 98.84
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.84
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.83
PRK14901434 16S rRNA methyltransferase B; Provisional 98.81
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.8
KOG2899|consensus288 98.78
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.77
KOG3010|consensus261 98.77
PRK14902444 16S rRNA methyltransferase B; Provisional 98.75
PRK14903431 16S rRNA methyltransferase B; Provisional 98.72
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.7
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.69
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.68
COG2521287 Predicted archaeal methyltransferase [General func 98.68
COG1041347 Predicted DNA modification methylase [DNA replicat 98.68
PLN02476278 O-methyltransferase 98.67
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.66
PLN02672 1082 methionine S-methyltransferase 98.66
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 98.66
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.65
PRK04148134 hypothetical protein; Provisional 98.65
COG2890280 HemK Methylase of polypeptide chain release factor 98.64
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.6
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.6
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.59
KOG1975|consensus 389 98.58
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.58
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.57
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 98.57
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.54
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.5
PLN02589247 caffeoyl-CoA O-methyltransferase 98.5
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.49
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.49
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.48
KOG1269|consensus 364 98.48
KOG1499|consensus 346 98.46
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 98.45
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.45
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.42
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.42
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.4
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.4
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.4
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.39
KOG1661|consensus237 98.33
PLN02823336 spermine synthase 98.33
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 98.3
COG4122219 Predicted O-methyltransferase [General function pr 98.29
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.28
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.26
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.21
PRK00536262 speE spermidine synthase; Provisional 98.2
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.2
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.18
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.18
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.18
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.06
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.04
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.98
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.97
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.96
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.95
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.95
KOG1500|consensus 517 97.92
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.91
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.88
KOG3987|consensus288 97.87
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.85
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.84
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.84
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.81
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.8
KOG3178|consensus342 97.76
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.71
KOG0820|consensus 315 97.7
KOG2904|consensus328 97.68
KOG2352|consensus 482 97.63
COG4076252 Predicted RNA methylase [General function predicti 97.6
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.6
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.58
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 97.53
KOG3420|consensus185 97.53
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.5
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 97.48
PF13679141 Methyltransf_32: Methyltransferase domain 97.46
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.44
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.4
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.4
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.36
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.34
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.28
KOG3191|consensus209 97.22
KOG1709|consensus271 97.22
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.18
KOG1663|consensus237 97.16
KOG1331|consensus 293 97.14
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.1
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.08
COG2520341 Predicted methyltransferase [General function pred 97.03
PRK10742250 putative methyltransferase; Provisional 96.99
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 96.98
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.95
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.95
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 96.8
KOG2915|consensus314 96.74
COG4262508 Predicted spermidine synthase with an N-terminal m 96.64
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 96.52
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 96.5
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.48
PLN02668386 indole-3-acetate carboxyl methyltransferase 96.45
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.35
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 96.31
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.18
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.09
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 95.84
KOG2730|consensus263 95.79
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 95.78
PRK13699 227 putative methylase; Provisional 95.76
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.74
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.65
KOG0822|consensus 649 95.54
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 95.51
COG4798238 Predicted methyltransferase [General function pred 95.47
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 95.29
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 95.27
KOG3201|consensus201 95.25
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 95.2
KOG1562|consensus337 95.08
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 95.05
COG2384226 Predicted SAM-dependent methyltransferase [General 94.88
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 94.83
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 94.81
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 94.74
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.59
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 94.57
KOG1501|consensus 636 94.52
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 94.32
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 94.2
COG3897218 Predicted methyltransferase [General function pred 94.2
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 94.11
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 93.97
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.96
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.84
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 93.77
COG0286 489 HsdM Type I restriction-modification system methyl 93.56
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.49
KOG4058|consensus199 93.42
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 93.35
KOG2872|consensus359 93.33
PF11312315 DUF3115: Protein of unknown function (DUF3115); In 93.23
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 93.05
PRK07417279 arogenate dehydrogenase; Reviewed 93.04
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 92.97
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 92.88
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 92.84
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 92.75
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 92.67
KOG2187|consensus534 92.54
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 92.43
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 92.1
PHA01634156 hypothetical protein 92.08
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 91.89
COG4627185 Uncharacterized protein conserved in bacteria [Fun 91.83
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 91.58
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 91.5
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 91.23
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 91.19
KOG2651|consensus 476 91.18
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 91.15
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 91.13
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 90.95
PRK13699227 putative methylase; Provisional 90.93
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 90.93
KOG3115|consensus249 90.87
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 90.87
PLN02494477 adenosylhomocysteinase 90.85
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 90.59
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 90.48
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 90.47
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 90.34
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 90.34
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 90.27
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 90.15
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 89.74
PTZ00357 1072 methyltransferase; Provisional 89.61
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 89.57
PRK11524 284 putative methyltransferase; Provisional 89.52
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 89.29
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 89.28
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 89.27
PRK11524284 putative methyltransferase; Provisional 89.1
PRK08265261 short chain dehydrogenase; Provisional 89.04
PTZ00075476 Adenosylhomocysteinase; Provisional 88.96
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 88.69
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 88.42
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 88.2
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 87.69
PLN02586360 probable cinnamyl alcohol dehydrogenase 87.65
KOG2920|consensus282 87.6
PRK10458 467 DNA cytosine methylase; Provisional 87.48
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 87.47
KOG1596|consensus317 87.37
PRK12480330 D-lactate dehydrogenase; Provisional 86.96
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 86.95
KOG1201|consensus300 86.94
PRK08339263 short chain dehydrogenase; Provisional 86.83
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 86.69
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 86.67
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 86.67
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 86.64
KOG0023|consensus360 86.62
PLN02712 667 arogenate dehydrogenase 86.49
KOG2671|consensus421 86.34
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 86.3
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.25
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 86.25
PRK07576264 short chain dehydrogenase; Provisional 86.16
PLN02712 667 arogenate dehydrogenase 86.13
PRK12939250 short chain dehydrogenase; Provisional 85.92
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 85.81
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 85.68
PRK08507275 prephenate dehydrogenase; Validated 85.49
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 85.45
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 85.34
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 85.33
KOG2793|consensus248 85.29
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 85.1
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 85.04
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 84.75
PRK06182273 short chain dehydrogenase; Validated 84.53
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 84.45
PLN02253280 xanthoxin dehydrogenase 84.31
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 84.29
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 84.23
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 84.18
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 84.04
COG1565 370 Uncharacterized conserved protein [Function unknow 84.02
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 84.02
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 83.58
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 83.55
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 83.47
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 83.36
PRK07806248 short chain dehydrogenase; Provisional 83.19
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 83.14
PTZ00354334 alcohol dehydrogenase; Provisional 83.11
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 83.03
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 82.96
PF02086260 MethyltransfD12: D12 class N6 adenine-specific DNA 82.89
PLN02256304 arogenate dehydrogenase 82.75
PRK05867253 short chain dehydrogenase; Provisional 82.66
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 82.57
PRK09242257 tropinone reductase; Provisional 82.53
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 82.51
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 82.4
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 82.25
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 82.19
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 81.75
PLN02514357 cinnamyl-alcohol dehydrogenase 81.35
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 81.33
PRK08267260 short chain dehydrogenase; Provisional 81.32
PRK07677252 short chain dehydrogenase; Provisional 81.09
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 80.87
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 80.73
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 80.49
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 80.25
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 80.24
PRK08277278 D-mannonate oxidoreductase; Provisional 80.21
>KOG2798|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-79  Score=554.68  Aligned_cols=294  Identities=44%  Similarity=0.786  Sum_probs=271.2

Q ss_pred             hhhhHHHHHhcCcHHHHHHHhhHHHHHHHHHHHHHHhHHHHHHHHHHHhhcccCCCCCCccccCCCCCCCcchHHHHHHH
Q psy3185           2 KVKRNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEPIKLISPLPNSTDLEKVQTTL   81 (298)
Q Consensus         2 ~~~r~~~~~~~l~~~~~~ll~~y~~~l~~~~~~i~~N~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l   81 (298)
                      ++.|+++....+|.+||++|.+|.++|+.++.||++|+.++++|++.+...|... +...  .....+++-+|.||.++|
T Consensus        36 ~l~~~~~~~n~~s~d~q~~l~~f~k~l~n~k~~I~~N~~v~r~Ia~~~~~~f~ed-~~~~--~~~~~~n~~~m~kv~s~l  112 (369)
T KOG2798|consen   36 LLFRRRRQLNGISEDHQQLLGNFTKHLKNNKGCIEENSRVIRAIAEECPFEFTED-HDQK--GELAQVNPDFMSKVSSTL  112 (369)
T ss_pred             HHHHHHHHhcCCCHHHHHHHHHHHHHHHhhHHHHHhhhHHHHHHHhhCccccchh-hhcc--cceecCCHHHHHHHHHHH
Confidence            4789999999999999999999999999999999999999999999766666542 1111  124556667899999999


Q ss_pred             HHHHhhhccCChHHHhhhhHHHHHHHHhhCCCCCCCCCCCeEEEecccCcHHHHHHHHcCCeEEEeeCCHHHHHHHHHHH
Q psy3185          82 KQFVRDWSEEGSEERKTCYEPIISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFIL  161 (298)
Q Consensus        82 ~~~~RdWs~~g~~ER~~~~~~i~~~l~~~~p~~~~~~~~~~VLdpGcG~Grla~ela~~G~~v~g~D~S~~Ml~~a~~~l  161 (298)
                      +|++||||+||..||+++|.||+++|..++|+....+.+.+||+||||+||||++||..||.|+|+|+|++|+.++.|+|
T Consensus       113 ~~i~RdwssE~~~ERd~~ykpii~~l~~lfp~~~~~r~ki~iLvPGaGlGRLa~dla~~G~~~qGNEfSy~Mli~S~FiL  192 (369)
T KOG2798|consen  113 KQICRDWSSEGQRERDQLYKPIIEELNSLFPSRGKERTKIRILVPGAGLGRLAYDLACLGFKCQGNEFSYFMLICSSFIL  192 (369)
T ss_pred             HHHHHHhhhccchhhhhhhhhHHHHHHhhCCCccccccCceEEecCCCchhHHHHHHHhcccccccHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999998888888999999999999999999999999999999999999999999


Q ss_pred             hhhhhccccccccccccccccccccccccccccCCCCCC-CCCCCCCeeEEeccccccccCC---CceeEEEecccccCc
Q psy3185         162 NKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDINTS-DYNDDCDFSMAAGDFLQVYVHP---NKWDCVATCFFIDCA  237 (298)
Q Consensus       162 ~~~~~~~~~~i~p~~~~~s~~~~~~~~~r~~~ipd~~~~-~~~~~~~~~~~~gDf~~~~~~~---~~fD~V~t~ffidta  237 (298)
                      |.++..++++||||||++||+++.+||+||+++||+.|. ..+..+.++|++|||+++|...   +.||+|+||||||||
T Consensus       193 N~~~~~nq~~IYPfIh~~sn~~~~dDQlrpi~~PD~~p~~~~~~~~~fsicaGDF~evy~~s~~~~~~d~VvTcfFIDTa  272 (369)
T KOG2798|consen  193 NYCKQENQFTIYPFIHQYSNSLSRDDQLRPISIPDIHPASSNGNTGSFSICAGDFLEVYGTSSGAGSYDVVVTCFFIDTA  272 (369)
T ss_pred             HhhccCCcEEEEeeeeccccccccccccccccCccccccccCCCCCCccccccceeEEecCcCCCCccceEEEEEEeech
Confidence            999999999999999999999999999999999999997 4555688999999999999754   489999999999999


Q ss_pred             chHHHHHHHHHHhccCCeEEEEeccccccccCCCC---CCccCCCHHHHHHHHHhCCCEEEEeC
Q psy3185         238 NNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLN---EDSIEPSYEVVKQVIQGLGFVYEVES  298 (298)
Q Consensus       238 ~n~~~yl~~I~~~LkpGG~~In~gPl~y~~~~~~~---~~~~~ls~eEl~~~~~~~GF~i~~~~  298 (298)
                      +|+.+||++|+++|||||+|||+|||+|||++..+   +++++||.|+|..+++..||++++++
T Consensus       273 ~NileYi~tI~~iLk~GGvWiNlGPLlYHF~d~~g~~~~~siEls~edl~~v~~~~GF~~~ke~  336 (369)
T KOG2798|consen  273 HNILEYIDTIYKILKPGGVWINLGPLLYHFEDTHGVENEMSIELSLEDLKRVASHRGFEVEKER  336 (369)
T ss_pred             HHHHHHHHHHHHhccCCcEEEeccceeeeccCCCCCcccccccccHHHHHHHHHhcCcEEEEee
Confidence            99999999999999999999999999999998654   78999999999999999999999874

>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG0822|consensus Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG3201|consensus Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG1562|consensus Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG2872|consensus Back     alignment and domain information
>PF11312 DUF3115: Protein of unknown function (DUF3115); InterPro: IPR021463 This eukaryotic family of proteins has no known function Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 8e-05
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 1e-04
2i62_A265 Nicotinamide N-methyltransferase; structural genom 1e-04
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 1e-04
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 2e-04
2kw5_A202 SLR1183 protein; structural genomics, northeast st 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 55.6 bits (133), Expect = 8e-09
 Identities = 47/333 (14%), Positives = 106/333 (31%), Gaps = 87/333 (26%)

Query: 5   RNEQYLESLPEKHQKLLSKYKDHLNDLKSCIDKNYEIIKLIIKDVGVMFENVPSSEPIKL 64
           R +Q  + L       +S     L+     +  + E+  L++K +    +++P    +  
Sbjct: 273 RFKQVTDFLSAATTTHIS-----LDHHSMTLTPD-EVKSLLLKYLDCRPQDLPRE--VLT 324

Query: 65  ISPL------------PNSTD------LEKVQTTLKQFVRDWSEEGSEERKTCYEPIISE 106
            +P               + D       +K+ T ++  +         E +  ++     
Sbjct: 325 TNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLE---PAEYRKMFDR---- 377

Query: 107 ILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFM-LFASNFILNKCR 165
            L+ FP         +I  P   L  + F++ +        +  + +       ++ K  
Sbjct: 378 -LSVFP------PSAHI--PTILLSLIWFDVIKS-------DVMVVVNKLHKYSLVEKQP 421

Query: 166 EKNVYKIYPW---VQQTDNNILTHHQTMAVTFPDINTSDYNDDCDFSMAAGD--FLQ--V 218
           +++   I      ++    N    H+++   +    T D +   D      D  F     
Sbjct: 422 KESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSD---DLIPPYLDQYFYSHIG 478

Query: 219 YVH------PNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPL------LYH 266
           + H      P +       F  D       F+E    I      W   G +      L  
Sbjct: 479 H-HLKNIEHPERMTLFRMVFL-D-----FRFLEQ--KIRHDSTAWNASGSILNTLQQLKF 529

Query: 267 YSNMLNEDSIEPSYE-VVKQVIQGLGFVYEVES 298
           Y   + ++  +P YE +V  ++    F+ ++E 
Sbjct: 530 YKPYICDN--DPKYERLVNAILD---FLPKIEE 557
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Length = 265 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.84
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.83
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.82
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.81
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.8
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.8
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.8
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.8
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.8
3lcc_A235 Putative methyl chloride transferase; halide methy 99.79
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.79
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.78
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.78
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.78
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.78
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.77
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.77
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.77
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.77
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.77
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.77
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.76
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.76
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.76
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.76
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.76
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.76
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.76
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.76
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.75
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.75
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.75
3f4k_A257 Putative methyltransferase; structural genomics, P 99.75
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.75
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.75
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.74
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.74
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.74
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.74
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.74
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.74
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.73
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.73
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.73
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.73
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.73
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.73
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.72
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.72
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.72
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.72
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.72
3cc8_A230 Putative methyltransferase; structural genomics, j 99.72
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.71
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.71
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.7
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.7
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.7
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.7
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.7
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.7
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.69
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.69
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.69
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.68
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.67
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.66
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.66
3ocj_A305 Putative exported protein; structural genomics, PS 99.66
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.66
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.66
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.66
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.65
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.64
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.64
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.64
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.64
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.64
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.63
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.62
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.62
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.61
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.6
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.6
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.59
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.59
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.58
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.58
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.58
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.58
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.57
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.55
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.55
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.55
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.55
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.55
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.55
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.54
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.54
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.54
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.54
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.54
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.54
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.54
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.53
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.53
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.53
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.53
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.53
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.52
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.52
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.52
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.51
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.51
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.51
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.51
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.51
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.51
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.51
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.5
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.5
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.5
3lpm_A259 Putative methyltransferase; structural genomics, p 99.5
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.5
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.49
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.49
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.48
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.48
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.48
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.48
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.47
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.47
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.47
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.47
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.47
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.47
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.47
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.46
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.45
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.45
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.44
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.44
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.44
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.44
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.44
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.43
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.43
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.43
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.43
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.43
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.43
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.43
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.42
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.42
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.42
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.42
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.42
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.42
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.42
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.41
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.41
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.41
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.41
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.4
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.4
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.39
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.39
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.39
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.39
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.38
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.38
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.37
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.37
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.36
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.36
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.36
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.34
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.34
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.34
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.34
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.34
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.33
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.33
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.33
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.33
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.32
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.32
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.32
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.31
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.3
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.3
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.3
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.29
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.29
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.29
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.29
2h00_A254 Methyltransferase 10 domain containing protein; st 99.29
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.29
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.29
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.28
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.28
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.27
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.26
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.25
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.24
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.23
2b25_A336 Hypothetical protein; structural genomics, methyl 99.23
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.23
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.22
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.21
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.21
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.21
2i7c_A283 Spermidine synthase; transferase, structural genom 99.21
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.21
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.2
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.2
2o07_A304 Spermidine synthase; structural genomics, structur 99.19
2pt6_A321 Spermidine synthase; transferase, structural genom 99.18
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.18
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.18
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.17
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.17
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.17
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.17
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.16
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.16
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.16
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.16
3k6r_A278 Putative transferase PH0793; structural genomics, 99.14
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.14
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.13
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.11
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.1
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.09
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.08
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.07
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.06
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.05
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.05
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.04
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.03
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.01
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.99
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.99
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.98
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.97
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.97
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.96
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.95
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.94
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.85
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.85
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.84
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.84
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.84
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.83
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.83
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.81
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.78
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.75
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.69
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.68
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.66
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.63
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.56
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.55
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.54
3lkd_A 542 Type I restriction-modification system methyltrans 98.53
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.52
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 98.52
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.52
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.5
3khk_A 544 Type I restriction-modification system methylation 98.49
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.47
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.42
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.41
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 98.4
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.4
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.39
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.34
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.33
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.32
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.17
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.11
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 97.94
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.92
2zig_A297 TTHA0409, putative modification methylase; methylt 97.9
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.87
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.84
3ufb_A 530 Type I restriction-modification system methyltran 97.8
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.72
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.25
2px2_A269 Genome polyprotein [contains: capsid protein C (co 97.14
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.07
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.06
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.8
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 96.8
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 96.73
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 96.61
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 96.47
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 96.32
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.24
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.18
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.16
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 96.13
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.07
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 96.06
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.89
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 95.86
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.77
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 95.7
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 95.66
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 95.65
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 95.65
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 95.64
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.62
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 95.59
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.57
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 95.55
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 95.51
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.47
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.43
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.4
2zig_A 297 TTHA0409, putative modification methylase; methylt 95.4
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 95.32
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 95.3
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.29
3gms_A340 Putative NADPH:quinone reductase; structural genom 95.29
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 95.26
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.18
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.17
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 95.09
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 95.08
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.08
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 95.05
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 94.95
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.92
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 94.89
3me5_A 482 Cytosine-specific methyltransferase; structural ge 94.88
4eye_A342 Probable oxidoreductase; structural genomics, niai 94.81
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 94.79
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 94.77
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 94.75
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 94.65
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 94.55
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 94.53
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 94.53
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 94.52
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 94.5
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.47
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.4
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 94.32
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 94.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.24
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 94.22
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 94.21
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 94.16
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 94.09
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.09
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 94.03
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 93.97
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 93.97
3krt_A456 Crotonyl COA reductase; structural genomics, prote 93.91
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 93.9
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 93.82
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 93.78
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 93.69
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 93.65
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 93.42
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 93.33
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 93.29
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 93.22
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.19
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 93.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 92.99
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 92.98
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 92.96
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 92.92
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 92.86
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.86
2oo3_A283 Protein involved in catabolism of external DNA; st 92.85
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 92.72
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 92.7
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 92.65
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 92.56
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.45
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 92.15
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 92.12
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.11
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 92.06
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 91.94
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.83
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.8
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 91.59
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 91.48
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 91.24
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 91.2
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.19
3fbg_A346 Putative arginate lyase; structural genomics, unkn 91.17
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 91.14
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 91.12
3qha_A 296 Putative oxidoreductase; seattle structural genomi 91.08
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 90.89
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 90.64
4ezb_A 317 Uncharacterized conserved protein; structural geno 90.6
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 90.42
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 90.42
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 90.32
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 90.12
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 90.07
3tjr_A301 Short chain dehydrogenase; structural genomics, se 89.84
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 89.81
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 89.74
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 89.5
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 89.48
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 89.26
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 89.19
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 88.91
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 88.9
1id1_A153 Putative potassium channel protein; RCK domain, E. 88.62
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 88.58
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 88.48
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 88.37
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.23
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 88.16
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 88.07
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 88.0
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 87.88
2rir_A300 Dipicolinate synthase, A chain; structural genomic 87.57
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 87.47
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 87.38
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 87.32
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 87.28
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 87.24
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 87.07
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 87.03
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 86.96
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 86.92
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 86.88
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 86.86
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 86.84
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 86.78
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 86.7
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 86.41
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 86.4
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 86.17
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 86.17
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 86.09
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 86.09
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 86.08
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 85.99
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 85.95
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 85.9
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 85.82
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 85.6
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 85.59
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 85.56
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 85.53
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 85.49
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 85.3
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 85.19
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 85.18
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 85.16
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 85.14
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 85.14
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 85.12
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 84.84
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 84.81
3imf_A257 Short chain dehydrogenase; structural genomics, in 84.81
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 84.7
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 84.67
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 84.65
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 84.65
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 84.58
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 84.51
2duw_A145 Putative COA-binding protein; ligand binding prote 84.5
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 84.43
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 84.38
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 84.26
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 84.04
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 84.04
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 83.96
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 83.87
3tox_A280 Short chain dehydrogenase; structural genomics, PS 83.83
4dqx_A277 Probable oxidoreductase protein; structural genomi 83.76
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 83.74
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 83.69
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 83.63
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 83.55
1nff_A260 Putative oxidoreductase RV2002; directed evolution 83.47
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 83.45
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 83.44
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 83.42
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 83.42
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 83.34
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 83.21
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 83.16
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 83.07
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 82.91
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 82.88
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
Probab=99.84  E-value=1.7e-20  Score=163.19  Aligned_cols=148  Identities=12%  Similarity=0.117  Sum_probs=103.3

Q ss_pred             CCCeEEEecccCcHHHHHHHHcCCeEEEeeCCHHHHHHHHHHHhhhhhccccccccccccccccccccccccccccCCCC
Q psy3185         119 KDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDIN  198 (298)
Q Consensus       119 ~~~~VLdpGcG~Grla~ela~~G~~v~g~D~S~~Ml~~a~~~l~~~~~~~~~~i~p~~~~~s~~~~~~~~~r~~~ipd~~  198 (298)
                      ++.+|||+|||+|+++..||++|++|+|+|+|+.|+..|+.....   .  ..    ...               ..+..
T Consensus        22 ~~~~vLD~GCG~G~~~~~la~~g~~V~gvD~S~~~l~~a~~~~~~---~--~~----~~~---------------~~~~~   77 (203)
T 1pjz_A           22 PGARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYFTERGE---Q--PH----ITS---------------QGDFK   77 (203)
T ss_dssp             TTCEEEETTTCCSHHHHHHHHHCCEEEEEEECHHHHHHHHHHHCS---C--SE----EEE---------------ETTEE
T ss_pred             CCCEEEEeCCCCcHhHHHHHHCCCeEEEEeCCHHHHHHHHHHccC---C--cc----ccc---------------ccccc
Confidence            467999999999999999999999999999999999988763210   0  00    000               00000


Q ss_pred             CCCCCCCCCeeEEeccccccccCC-CceeEEEecccccCc--chHHHHHHHHHHhccCCeEEEEeccccccccCCCCCCc
Q psy3185         199 TSDYNDDCDFSMAAGDFLQVYVHP-NKWDCVATCFFIDCA--NNIVSFIETIFNILKPGGIWINLGPLLYHYSNMLNEDS  275 (298)
Q Consensus       199 ~~~~~~~~~~~~~~gDf~~~~~~~-~~fD~V~t~ffidta--~n~~~yl~~I~~~LkpGG~~In~gPl~y~~~~~~~~~~  275 (298)
                         .....++.+..+|+.++...+ ++||+|++..++++.  ++...++++++++|||||+++.+. +.|.... ...+.
T Consensus        78 ---~~~~~~v~~~~~d~~~l~~~~~~~fD~v~~~~~l~~l~~~~~~~~l~~~~r~LkpgG~~~l~~-~~~~~~~-~~~~~  152 (203)
T 1pjz_A           78 ---VYAAPGIEIWCGDFFALTARDIGHCAAFYDRAAMIALPADMRERYVQHLEALMPQACSGLLIT-LEYDQAL-LEGPP  152 (203)
T ss_dssp             ---EEECSSSEEEEECCSSSTHHHHHSEEEEEEESCGGGSCHHHHHHHHHHHHHHSCSEEEEEEEE-ESSCSSS-SSSCC
T ss_pred             ---cccCCccEEEECccccCCcccCCCEEEEEECcchhhCCHHHHHHHHHHHHHHcCCCcEEEEEE-EecCccc-cCCCC
Confidence               000137889999999987654 799999987666544  456679999999999999833221 1222111 11234


Q ss_pred             cCCCHHHHHHHHHhCCCEEEE
Q psy3185         276 IEPSYEVVKQVIQGLGFVYEV  296 (298)
Q Consensus       276 ~~ls~eEl~~~~~~~GF~i~~  296 (298)
                      ..++.+|+.+++.+ ||+++.
T Consensus       153 ~~~~~~el~~~~~~-gf~i~~  172 (203)
T 1pjz_A          153 FSVPQTWLHRVMSG-NWEVTK  172 (203)
T ss_dssp             CCCCHHHHHHTSCS-SEEEEE
T ss_pred             CCCCHHHHHHHhcC-CcEEEE
Confidence            55899999999998 999865
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d2g72a1263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 7e-09
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 1e-05
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arylamine N-methyltransferase
domain: Phenylethanolamine N-methyltransferase, PNMTase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.3 bits (127), Expect = 7e-09
 Identities = 22/200 (11%), Positives = 58/200 (29%), Gaps = 18/200 (9%)

Query: 103 IISEILARFPPETINPKDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFML-FASNFIL 161
            +  +   F    ++ + +  +  G  + +L              +F          ++ 
Sbjct: 40  KLRCLAQTFATGEVSGRTLIDIGSGPTVYQL-LSACSHFEDITMTDFLEVNRQELGRWLQ 98

Query: 162 NKCREKNVYKIYPWVQQTDNNILT---HHQTMAVTFPDINTSDYNDDCDFSMAAGDFLQV 218
            +    N           +          + +      +   D +               
Sbjct: 99  EEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQP-------QPLGAG 151

Query: 219 YVHPNKWDCVATCFFIDCA-NNIVSFIETIFNI---LKPGGIWINLGPLLYHY--SNMLN 272
              P   D + + F ++    ++ SF   + +I   L+PGG  + +G L   +  +    
Sbjct: 152 SPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEAR 211

Query: 273 EDSIEPSYEVVKQVIQGLGF 292
              +  S E V++ +   G+
Sbjct: 212 LTVVPVSEEEVREALVRSGY 231
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.87
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.86
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.85
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.84
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.84
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.83
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.83
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.83
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.83
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.82
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.82
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.82
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.8
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.79
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.79
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.79
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.78
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.77
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.76
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.71
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.71
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.7
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.68
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.68
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.67
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.66
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.64
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.64
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.62
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.61
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.6
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.59
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.58
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.51
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.49
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.48
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.48
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.48
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.47
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.45
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.44
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.41
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.39
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.37
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.36
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.32
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.31
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.28
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.19
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.15
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.15
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.13
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.13
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.07
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.05
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.04
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.03
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.0
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.92
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.9
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.88
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.86
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.84
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.84
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.8
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.78
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.77
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.74
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.74
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.72
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.64
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.61
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.57
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.57
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.56
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.56
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.55
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.46
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.44
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.38
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.37
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.36
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.35
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.28
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.25
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.2
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.13
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.98
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.94
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.83
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.81
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.68
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.63
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.42
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.33
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.21
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.21
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.21
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.98
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.93
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.5
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 96.45
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.38
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.32
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.29
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.28
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.18
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.12
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.04
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 96.02
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.98
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.87
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.85
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.8
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.76
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.66
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.66
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 95.54
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 95.48
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 95.29
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.21
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.92
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 94.8
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 94.52
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.39
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.97
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 93.75
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 93.71
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.68
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 93.54
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.51
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.5
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.45
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.29
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.17
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.15
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.99
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.61
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.08
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 91.92
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 91.85
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.75
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 91.67
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 91.23
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 91.03
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 91.0
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.98
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.9
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 90.61
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.59
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.46
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.29
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.22
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.17
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 90.16
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 89.96
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 89.83
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 89.72
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 89.43
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.18
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 89.17
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 88.97
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 88.94
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 88.93
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 88.77
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 88.71
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 88.62
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 88.24
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 88.23
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 88.19
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 87.31
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 87.02
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 86.88
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 86.46
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.42
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 85.76
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 85.63
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 85.41
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 85.23
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 84.69
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 84.37
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 84.11
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 83.96
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 83.89
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.83
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 83.72
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.33
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 83.32
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 83.06
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 81.97
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 81.24
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 80.86
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.68
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 80.4
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.24
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]

Probab=99.87  E-value=1.3e-21  Score=169.96  Aligned_cols=139  Identities=16%  Similarity=0.155  Sum_probs=111.0

Q ss_pred             CCCeEEEecccCcHHHHHHHHcCCeEEEeeCCHHHHHHHHHHHhhhhhccccccccccccccccccccccccccccCCCC
Q psy3185         119 KDVNILVPGAGLGRLAFEIARRGYVCQGNEFSLFMLFASNFILNKCREKNVYKIYPWVQQTDNNILTHHQTMAVTFPDIN  198 (298)
Q Consensus       119 ~~~~VLdpGcG~Grla~ela~~G~~v~g~D~S~~Ml~~a~~~l~~~~~~~~~~i~p~~~~~s~~~~~~~~~r~~~ipd~~  198 (298)
                      ++.+|||+|||+|.++..++++|.+|+|+|+|+.|+..|+......                                  
T Consensus        15 ~~~rVLDiGcG~G~~~~~l~~~~~~v~gvD~s~~~i~~A~~~~~~~----------------------------------   60 (231)
T d1vl5a_          15 GNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGN----------------------------------   60 (231)
T ss_dssp             SCCEEEEETCTTCHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHT----------------------------------
T ss_pred             CcCEEEEecccCcHHHHHHHHhCCEEEEEECCHHHHhhhhhccccc----------------------------------
Confidence            5689999999999999999999999999999999999988743321                                  


Q ss_pred             CCCCCCCCCeeEEeccccccccCCCceeEEEecccccCcchHHHHHHHHHHhccCCeEEEEeccc---------ccccc-
Q psy3185         199 TSDYNDDCDFSMAAGDFLQVYVHPNKWDCVATCFFIDCANNIVSFIETIFNILKPGGIWINLGPL---------LYHYS-  268 (298)
Q Consensus       199 ~~~~~~~~~~~~~~gDf~~~~~~~~~fD~V~t~ffidta~n~~~yl~~I~~~LkpGG~~In~gPl---------~y~~~-  268 (298)
                           ...++.++.+|+.+++.++++||+|++.+.+++.+++...+++++++|||||+++...+-         .|++. 
T Consensus        61 -----~~~~i~~~~~d~~~l~~~~~~fD~v~~~~~l~~~~d~~~~l~~~~r~LkpgG~l~i~~~~~~~~~~~~~~~~~~~  135 (231)
T d1vl5a_          61 -----GHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVE  135 (231)
T ss_dssp             -----TCCSEEEEECCC-CCCSCTTCEEEEEEESCGGGCSCHHHHHHHHHHHEEEEEEEEEEEEEBCSSHHHHHHHHHHH
T ss_pred             -----ccccccccccccccccccccccccccccccccccCCHHHHHHHHHHhcCCCcEEEEEeCCCCCCHHHHHHHHHHH
Confidence                 013788999999999878899999999999999999999999999999999988753221         11110 


Q ss_pred             -CCCCCCccCCCHHHHHHHHHhCCCEEEE
Q psy3185         269 -NMLNEDSIEPSYEVVKQVIQGLGFVYEV  296 (298)
Q Consensus       269 -~~~~~~~~~ls~eEl~~~~~~~GF~i~~  296 (298)
                       .........++.+++.++++++||++++
T Consensus       136 ~~~~~~~~~~~~~~~~~~~l~~aGf~~~~  164 (231)
T d1vl5a_         136 KERDYSHHRAWKKSDWLKMLEEAGFELEE  164 (231)
T ss_dssp             HHHCTTCCCCCBHHHHHHHHHHHTCEEEE
T ss_pred             hhcccCcccCCCHHHHHHHHHHCCCEEEE
Confidence             0011233457899999999999999875
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure