Psyllid ID: psy3208


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPLPIPDSSCSQVSHAGPGLGANGLGAAPGLGSNGLGSGLGSNGLGSGLGSGPGEYYNDTEEQEDTEHTSSENLHKSDSF
ccccccEEEEEEEccccHHccccccccccEEEEEccEEcccccHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccc
cccHcEEEEEEEEccccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHccccEEEEEEEEcHccccccHHHHccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHcccccccccccc
MNPNETVIVIRSLvpggvaqldarlipgdrllsvnetdlnnASLDQAVQALkgaprgivkigvakplpipdsscsqvshagpglganglgaapglgsnglgsglgsnglgsglgsgpgeyyndteeqedtehtssenlhksdsf
MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPLPIPDSSCSQVSHAGPGLGANGLGAAPGLGSNGLGSGLGSNGLGSGLGSGPGEYYNDTEeqedtehtssenlhksdsf
MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPLPIPDSSCSQVSHAgpglganglgaapglgsnglgsglgsnglgsglgsgpgEYYNDTEEQEDTEHTSSENLHKSDSF
*****TVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKP******************************************************************************
***NETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVA********************************************L***********************************
MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPLPIPDSSCSQVSHAGPGLGANGLGAAPGLGSNGLGSGLGSNGLGSGLGSGPGEYYN**********************
*NPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPLPIPDS*************************************GSGL*SGPGEYYNDTEEQED***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPLPIPDSSCSQVSHAGPGLGANGLGAAPGLGSNGLGSGLGSNGLGSGLGSGPGEYYNDTEEQEDTEHTSSENLHKSDSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q9NB04871 Patj homolog OS=Drosophil yes N/A 0.548 0.090 0.725 2e-26
O75970 2070 Multiple PDZ domain prote yes N/A 0.472 0.032 0.652 5e-21
O55164 2054 Multiple PDZ domain prote yes N/A 0.472 0.033 0.652 6e-21
Q8VBX6 2055 Multiple PDZ domain prote yes N/A 0.472 0.033 0.652 6e-21
Q63ZW7 1834 InaD-like protein OS=Mus no N/A 0.458 0.035 0.552 8e-15
Q8NI35 1801 InaD-like protein OS=Homo no N/A 0.458 0.036 0.552 1e-13
Q92796 817 Disks large homolog 3 OS= no N/A 0.437 0.077 0.437 4e-06
Q62936 849 Disks large homolog 3 OS= no N/A 0.437 0.074 0.437 4e-06
P70175 849 Disks large homolog 3 OS= no N/A 0.437 0.074 0.437 4e-06
Q15700 870 Disks large homolog 2 OS= no N/A 0.638 0.105 0.381 1e-05
>sp|Q9NB04|PATJ_DROME Patj homolog OS=Drosophila melanogaster GN=Patj PE=1 SV=2 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 69/80 (86%)

Query: 1   MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVK 60
           ++PN+T+IVIRSLVPGGVAQLD RLIPGDRLL VN  +L NASLDQAVQALKGA +G+V+
Sbjct: 749 LDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVR 808

Query: 61  IGVAKPLPIPDSSCSQVSHA 80
           IGVAKPLP+ D+S    S+A
Sbjct: 809 IGVAKPLPMTDNSLKACSNA 828




Involved in cell polarity establishment. Probably participates in the assembly, positioning and maintenance of adherens junctions via its interaction with the SAC complex.
Drosophila melanogaster (taxid: 7227)
>sp|O75970|MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens GN=MPDZ PE=1 SV=2 Back     alignment and function description
>sp|O55164|MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus GN=Mpdz PE=1 SV=1 Back     alignment and function description
>sp|Q8VBX6|MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus GN=Mpdz PE=1 SV=2 Back     alignment and function description
>sp|Q63ZW7|INADL_MOUSE InaD-like protein OS=Mus musculus GN=Inadl PE=1 SV=2 Back     alignment and function description
>sp|Q8NI35|INADL_HUMAN InaD-like protein OS=Homo sapiens GN=INADL PE=1 SV=3 Back     alignment and function description
>sp|Q92796|DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens GN=DLG3 PE=1 SV=2 Back     alignment and function description
>sp|Q62936|DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|P70175|DLG3_MOUSE Disks large homolog 3 OS=Mus musculus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|Q15700|DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens GN=DLG2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
242008812 1008 conserved hypothetical protein [Pediculu 0.548 0.078 0.825 4e-28
340718529 2578 PREDICTED: hypothetical protein LOC10064 0.520 0.029 0.792 4e-27
270014414 792 hypothetical protein TcasGA2_TC001640 [T 0.493 0.089 0.847 6e-27
189233650 785 PREDICTED: similar to GA11344-PA, partia 0.493 0.090 0.847 6e-27
345492914 1232 PREDICTED: multiple PDZ domain protein-l 0.506 0.059 0.769 7e-27
383858804 1110 PREDICTED: patj homolog [Megachile rotun 0.534 0.069 0.807 2e-26
307213315 908 Patj-like protein [Harpegnathos saltator 0.493 0.078 0.833 2e-26
328781201 1046 PREDICTED: patj homolog [Apis mellifera] 0.486 0.066 0.833 3e-26
403182586 791 AAEL017560-PA [Aedes aegypti] 0.520 0.094 0.786 3e-26
380028130 1109 PREDICTED: patj homolog [Apis florea] 0.534 0.069 0.807 3e-26
>gi|242008812|ref|XP_002425192.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508908|gb|EEB12454.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/80 (82%), Positives = 73/80 (91%), Gaps = 1/80 (1%)

Query: 1   MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVK 60
           M+PNETVIVIRSLVPGGVAQLD +LIPGDRL+ VN+T+L NASLDQAVQALKGAP+GIV+
Sbjct: 879 MDPNETVIVIRSLVPGGVAQLDGQLIPGDRLVFVNDTNLENASLDQAVQALKGAPKGIVR 938

Query: 61  IGVAKPLPIPDS-SCSQVSH 79
           IGVAKPLPIPDS S  QVS 
Sbjct: 939 IGVAKPLPIPDSVSNCQVSE 958




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340718529|ref|XP_003397718.1| PREDICTED: hypothetical protein LOC100647267 [Bombus terrestris] Back     alignment and taxonomy information
>gi|270014414|gb|EFA10862.1| hypothetical protein TcasGA2_TC001640 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189233650|ref|XP_001813830.1| PREDICTED: similar to GA11344-PA, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345492914|ref|XP_003426953.1| PREDICTED: multiple PDZ domain protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383858804|ref|XP_003704889.1| PREDICTED: patj homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|307213315|gb|EFN88767.1| Patj-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328781201|ref|XP_003249938.1| PREDICTED: patj homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|403182586|gb|EJY57494.1| AAEL017560-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|380028130|ref|XP_003697762.1| PREDICTED: patj homolog [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
FB|FBgn0067864871 Patj "Patj" [Drosophila melano 0.555 0.091 0.725 1.5e-24
UNIPROTKB|F1N9G0 1999 F1N9G0 "Uncharacterized protei 0.513 0.037 0.653 7.2e-20
UNIPROTKB|F1MMT3 2056 F1MMT3 "Uncharacterized protei 0.479 0.033 0.681 2e-19
UNIPROTKB|O75970 2070 MPDZ "Multiple PDZ domain prot 0.479 0.033 0.652 5.4e-19
UNIPROTKB|F1SMP5 1588 MPDZ "Uncharacterized protein" 0.472 0.042 0.695 8.1e-19
RGD|3105 2054 Mpdz "multiple PDZ domain prot 0.479 0.033 0.652 1.1e-18
MGI|MGI:1343489 2055 Mpdz "multiple PDZ domain prot 0.479 0.033 0.652 1.1e-18
UNIPROTKB|D4A2W4 2068 Mpdz "Multiple PDZ domain prot 0.479 0.033 0.652 1.1e-18
WB|WBGene00003404 2491 mpz-1 [Caenorhabditis elegans 0.520 0.030 0.558 8e-16
UNIPROTKB|G5ECZ8 2491 mpz-1 "Protein MPZ-1, isoform 0.520 0.030 0.558 8e-16
FB|FBgn0067864 Patj "Patj" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 291 (107.5 bits), Expect = 1.5e-24, P = 1.5e-24
 Identities = 58/80 (72%), Positives = 69/80 (86%)

Query:     1 MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVK 60
             ++PN+T+IVIRSLVPGGVAQLD RLIPGDRLL VN  +L NASLDQAVQALKGA +G+V+
Sbjct:   749 LDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVR 808

Query:    61 IGVAKPLPIPDSSCSQVSHA 80
             IGVAKPLP+ D+S    S+A
Sbjct:   809 IGVAKPLPMTDNSLKACSNA 828


GO:0005737 "cytoplasm" evidence=NAS;TAS
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS
GO:0016333 "morphogenesis of follicular epithelium" evidence=IMP
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IPI
GO:0005635 "nuclear envelope" evidence=NAS
GO:0016324 "apical plasma membrane" evidence=NAS;IDA
GO:0045186 "zonula adherens assembly" evidence=NAS
GO:0045196 "establishment or maintenance of neuroblast polarity" evidence=IMP
GO:0045179 "apical cortex" evidence=NAS
GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0016332 "establishment or maintenance of polarity of embryonic epithelium" evidence=TAS
GO:0035003 "subapical complex" evidence=IDA;TAS
GO:0007043 "cell-cell junction assembly" evidence=NAS
GO:0005918 "septate junction" evidence=TAS
GO:0002009 "morphogenesis of an epithelium" evidence=TAS
GO:0045176 "apical protein localization" evidence=TAS
GO:0016327 "apicolateral plasma membrane" evidence=IDA
GO:0005080 "protein kinase C binding" evidence=IPI
GO:0001736 "establishment of planar polarity" evidence=IMP
GO:0034332 "adherens junction organization" evidence=IMP
GO:0008594 "photoreceptor cell morphogenesis" evidence=IMP
GO:0045494 "photoreceptor cell maintenance" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0035088 "establishment or maintenance of apical/basal cell polarity" evidence=IMP
GO:0035209 "pupal development" evidence=IMP
GO:0034334 "adherens junction maintenance" evidence=IGI
GO:0035509 "negative regulation of myosin-light-chain-phosphatase activity" evidence=IGI
GO:0032033 "myosin II light chain binding" evidence=IDA
GO:0005912 "adherens junction" evidence=IDA
UNIPROTKB|F1N9G0 F1N9G0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMT3 F1MMT3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75970 MPDZ "Multiple PDZ domain protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMP5 MPDZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|3105 Mpdz "multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1343489 Mpdz "multiple PDZ domain protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2W4 Mpdz "Multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00003404 mpz-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G5ECZ8 mpz-1 "Protein MPZ-1, isoform d" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VBX6MPDZ_MOUSENo assigned EC number0.65210.47220.0330yesN/A
Q9NB04PATJ_DROMENo assigned EC number0.7250.54860.0907yesN/A
O55164MPDZ_RATNo assigned EC number0.65210.47220.0331yesN/A
O75970MPDZ_HUMANNo assigned EC number0.65210.47220.0328yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 8e-11
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-08
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 1e-08
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-07
TIGR00225 334 TIGR00225, prc, C-terminal peptidase (prc) 5e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 1e-04
PRK11186 667 PRK11186, PRK11186, carboxy-terminal protease; Pro 6e-04
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 54.5 bits (132), Expect = 8e-11
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 8  IVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIV 59
          I +  + PGG A+    L  GDR+L VN   +   + ++AV+ LK +   + 
Sbjct: 28 IFVSRVEPGGPAER-GGLRVGDRILEVNGVSVEGLTHEEAVELLKNSGDEVT 78


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|236873 PRK11186, PRK11186, carboxy-terminal protease; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.24
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.0
KOG3550|consensus207 98.99
KOG3571|consensus 626 98.87
KOG3553|consensus124 98.87
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.85
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.82
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.8
KOG3549|consensus 505 98.78
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.77
KOG3209|consensus 984 98.7
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.65
KOG1892|consensus 1629 98.56
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.53
KOG3209|consensus984 98.47
KOG3551|consensus 506 98.47
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.46
KOG3580|consensus 1027 98.44
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.42
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.34
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.34
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.33
KOG3606|consensus358 98.31
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.25
KOG3552|consensus 1298 98.22
PRK10779449 zinc metallopeptidase RseP; Provisional 98.11
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.09
PRK11186 667 carboxy-terminal protease; Provisional 98.05
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.05
PRK10139455 serine endoprotease; Provisional 98.01
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.01
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.0
PRK10139455 serine endoprotease; Provisional 98.0
PRK10898353 serine endoprotease; Provisional 98.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.97
KOG3580|consensus 1027 97.96
PRK10942473 serine endoprotease; Provisional 97.94
KOG3651|consensus 429 97.93
KOG3605|consensus829 97.83
PRK10942473 serine endoprotease; Provisional 97.81
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.63
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.62
KOG0609|consensus 542 97.53
KOG3129|consensus231 97.36
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.31
KOG3542|consensus 1283 97.25
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.18
KOG3938|consensus334 97.14
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.0
COG3480342 SdrC Predicted secreted protein containing a PDZ d 96.83
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.76
PRK09681276 putative type II secretion protein GspC; Provision 96.54
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.39
KOG1320|consensus473 96.2
KOG1421|consensus 955 96.04
COG3975558 Predicted protease with the C-terminal PDZ domain 95.79
KOG3605|consensus829 95.78
KOG0606|consensus 1205 95.18
KOG3532|consensus 1051 94.89
KOG1738|consensus 638 94.29
COG3031275 PulC Type II secretory pathway, component PulC [In 93.97
PF1281278 PDZ_1: PDZ-like domain 92.06
KOG4407|consensus 1973 88.67
COG0750 375 Predicted membrane-associated Zn-dependent proteas 87.79
KOG3834|consensus 462 84.29
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
Probab=99.24  E-value=5e-11  Score=78.47  Aligned_cols=57  Identities=35%  Similarity=0.498  Sum_probs=53.9

Q ss_pred             CcEEEEEEcCCChhhhcCCcCCCCEEEeeCCEeCCCCCHHHHHHHHHcCCCCeEEEEEE
Q psy3208           6 TVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVA   64 (144)
Q Consensus         6 ~gi~Is~V~~gg~A~~~GrL~~GD~Il~VNg~~l~~~t~~e~v~ll~~~~~~~V~L~V~   64 (144)
                      .++||..|.++++|+++| |+.||+|++|||+++.++++.+++.+++.+. ..++|+|.
T Consensus        25 ~~~~V~~v~~~~~a~~~g-l~~GD~Il~INg~~v~~~~~~~~~~~l~~~~-~~v~L~V~   81 (81)
T PF00595_consen   25 KGVFVSSVVPGSPAERAG-LKVGDRILEINGQSVRGMSHDEVVQLLKSAS-NPVTLTVQ   81 (81)
T ss_dssp             EEEEEEEECTTSHHHHHT-SSTTEEEEEETTEESTTSBHHHHHHHHHHST-SEEEEEEE
T ss_pred             CCEEEEEEeCCChHHhcc-cchhhhhheeCCEeCCCCCHHHHHHHHHCCC-CcEEEEEC
Confidence            589999999999999999 9999999999999999999999999999997 58998874



PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....

>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
2d92_A108 Solution Structure Of The Fifth Pdz Domain Of Inad- 8e-13
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 1e-06
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 4e-06
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 1e-05
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 1e-05
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 1e-05
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 2e-05
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 2e-05
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-05
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 2e-05
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 5e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 6e-05
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 6e-05
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 7e-05
4amh_A106 Influence Of Circular Permutation On The Folding Pa 8e-05
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 8e-05
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 8e-05
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 9e-05
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 9e-05
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 9e-05
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 1e-04
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 1e-04
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 1e-04
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 1e-04
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 1e-04
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 1e-04
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 1e-04
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 1e-04
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 1e-04
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 2e-04
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 2e-04
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 2e-04
3cbx_A105 The Dvl2 Pdz Domain In Complex With The C1 Inhibito 2e-04
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 2e-04
3cby_A108 The Dvl2 Pdz Domain In Complex With The N1 Inhibito 2e-04
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 2e-04
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 2e-04
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 2e-04
3cbz_A108 The Dvl2 Pdz Domain In Complex With The N2 Inhibito 2e-04
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 2e-04
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 2e-04
2rey_A100 Crystal Structure Of The Pdz Domain Of Human Dishev 2e-04
3cc0_A108 The Dvl2 Pdz Domain In Complex With The N3 Inhibito 3e-04
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 3e-04
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 3e-04
1kef_A93 Pdz1 Of Sap90 Length = 93 3e-04
1l6o_A95 Xenopus Dishevelled Pdz Domain Length = 95 4e-04
3fy5_A91 Dishevelled Pdz Domain Homodimer Length = 91 4e-04
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 5e-04
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 5e-04
2f0a_A98 Crystal Structure Of Monomeric Uncomplexed Form Of 6e-04
>pdb|2D92|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Inad-Like Protein Length = 108 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 34/64 (53%), Positives = 46/64 (71%) Query: 1 MNPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVK 60 ++P +VIVIRSLV GVA+ L+PGDRL+SVNE L+N SL +AV+ LK P G+V Sbjct: 39 LDPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVH 98 Query: 61 IGVA 64 +G+ Sbjct: 99 LGIC 102
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|3CBX|A Chain A, The Dvl2 Pdz Domain In Complex With The C1 Inhibitory Peptide Length = 105 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|3CBY|A Chain A, The Dvl2 Pdz Domain In Complex With The N1 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|3CBZ|A Chain A, The Dvl2 Pdz Domain In Complex With The N2 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2REY|A Chain A, Crystal Structure Of The Pdz Domain Of Human Dishevelled 2 (Homologous To Drosophila Dsh) Length = 100 Back     alignment and structure
>pdb|3CC0|A Chain A, The Dvl2 Pdz Domain In Complex With The N3 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1L6O|A Chain A, Xenopus Dishevelled Pdz Domain Length = 95 Back     alignment and structure
>pdb|3FY5|A Chain A, Dishevelled Pdz Domain Homodimer Length = 91 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|2F0A|A Chain A, Crystal Structure Of Monomeric Uncomplexed Form Of Xenopus Dishevelled Pdz Domain Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-19
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 8e-19
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-18
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-18
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 7e-18
2byg_A117 Channel associated protein of synapse-110; DLG2, P 9e-18
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 3e-17
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 5e-17
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-16
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 8e-16
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 8e-16
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 9e-16
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-15
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 4e-15
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 4e-15
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 5e-15
2djt_A104 Unnamed protein product; PDZ domain, structural ge 6e-15
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 7e-15
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 1e-14
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-14
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-14
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-14
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-09
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-14
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 6e-14
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-13
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-13
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-13
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-13
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-13
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-13
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-13
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 3e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 8e-13
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-13
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 5e-13
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-13
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 6e-13
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-13
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 7e-13
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-12
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 1e-12
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-12
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 6e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-09
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-07
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-12
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-12
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-12
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-12
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-12
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-12
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-12
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 3e-12
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-12
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 3e-12
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 4e-12
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 4e-12
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-12
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 4e-12
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 4e-12
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 5e-12
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 5e-12
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 5e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 5e-12
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 6e-12
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 6e-12
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 6e-12
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-07
2fne_A117 Multiple PDZ domain protein; structural protein, s 7e-12
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 8e-12
2o2t_A117 Multiple PDZ domain protein; structural protein, s 9e-12
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-11
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-11
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-11
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-11
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-11
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-11
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-11
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 3e-11
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 3e-11
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-11
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 4e-11
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 4e-11
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-11
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-11
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-11
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 5e-11
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-10
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-10
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-10
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 3e-10
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-10
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-10
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 5e-10
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 5e-10
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 5e-10
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-09
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-09
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-09
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-09
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 2e-09
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-09
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 3e-09
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-09
2eaq_A90 LIM domain only protein 7; conserved hypothetical 4e-09
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 6e-09
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 9e-09
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-08
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-08
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-08
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-08
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-08
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-08
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-08
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-08
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 4e-08
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-08
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 6e-08
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 7e-08
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-07
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-07
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-07
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 2e-07
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-07
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-07
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-07
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 4e-07
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 6e-07
2eei_A106 PDZ domain-containing protein 1; regulatory factor 7e-07
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 7e-07
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 8e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 9e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 1e-06
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 1e-06
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-06
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-06
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 3e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 4e-06
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-06
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 4e-06
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-06
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 6e-06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 8e-06
2ego_A96 General receptor for phosphoinositides 1- associat 8e-06
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-05
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 1e-05
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-05
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 2e-05
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-05
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 9e-05
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
 Score = 77.4 bits (191), Expect = 1e-19
 Identities = 34/65 (52%), Positives = 45/65 (69%)

Query: 2   NPNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKI 61
           +P  +VIVIRSLV  GVA+    L+PGDRL+SVNE  L+N SL +AV+ LK  P G+V +
Sbjct: 40  DPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHL 99

Query: 62  GVAKP 66
           G+   
Sbjct: 100 GICSG 104


>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.41
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.38
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.37
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.32
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.32
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.3
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.3
2awx_A105 Synapse associated protein 97; membrane protein, s 99.3
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.29
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.29
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.28
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.27
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.27
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.27
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.26
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.26
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.25
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.25
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.25
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.25
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.25
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.25
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.24
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.24
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.24
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.23
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.23
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.23
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.23
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.23
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.23
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.23
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.22
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.22
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.22
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.22
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.22
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.22
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.21
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.21
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.21
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.2
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.2
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.2
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.2
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.2
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.2
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.19
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.19
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.18
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.18
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.18
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.18
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.18
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.18
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.17
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.17
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.17
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.17
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.17
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.17
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.17
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.17
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.17
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.17
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.17
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.17
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.16
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.16
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.16
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.16
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.16
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.16
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.16
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.16
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.15
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.15
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.15
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.15
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.15
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.15
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.15
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.15
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.15
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.15
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.15
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.15
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.14
2ego_A96 General receptor for phosphoinositides 1- associat 99.14
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.14
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.14
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.14
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.14
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.14
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.13
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.12
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.12
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.12
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.12
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.12
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.11
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.11
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.11
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.11
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.1
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.1
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.1
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.1
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.1
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.1
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.09
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.09
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.09
2d90_A102 PDZ domain containing protein 1; structural genomi 99.09
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.09
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.09
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.08
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.07
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.07
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.07
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.06
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.06
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.06
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.05
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.04
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.04
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.03
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.03
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.02
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.02
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.01
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.01
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.01
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.0
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.0
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.99
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.99
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.99
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.99
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.99
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.98
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.97
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.97
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.97
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.97
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.97
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.96
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.95
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.95
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.94
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.92
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.91
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.89
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.89
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.87
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.86
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.85
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.84
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.82
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.82
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.81
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.8
2kl1_A94 YLBL protein; structure genomics, structural genom 98.8
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.79
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.21
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.71
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.7
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.69
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.65
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.64
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.63
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.61
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.58
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.58
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.56
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.49
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.47
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.46
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.45
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.41
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.38
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.37
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.31
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.29
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.28
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.27
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.2
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.19
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.16
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.13
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.12
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.07
3k50_A 403 Putative S41 protease; structural genomics, joint 98.03
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.02
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.88
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.71
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.47
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.19
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 96.97
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
Probab=99.41  E-value=1.2e-12  Score=88.85  Aligned_cols=64  Identities=17%  Similarity=0.252  Sum_probs=58.7

Q ss_pred             CCcEEEEEEcCCChhhhcCCcCCCCEEEeeCCEeCCCCCHHHHHHHHHcCCC-CeEEEEEEcCCC
Q psy3208           5 ETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPR-GIVKIGVAKPLP   68 (144)
Q Consensus         5 ~~gi~Is~V~~gg~A~~~GrL~~GD~Il~VNg~~l~~~t~~e~v~ll~~~~~-~~V~L~V~r~~~   68 (144)
                      ...+||++|.++++|++.|+|++||+|++|||+++.+++|.+++++|++.+. .+++|++.++..
T Consensus        27 ~g~~~I~rI~~gg~a~r~g~L~vGD~I~~VNG~~v~g~~h~evv~lLk~~~~g~~~~L~lv~p~~   91 (95)
T 3gge_A           27 VGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKK   91 (95)
T ss_dssp             SSCCEEEEECTTSHHHHCTTCCTTCEEEEETTEECTTCCHHHHHHHHHHSCTTCEEEEEEEEECS
T ss_pred             CCcEEEEEEcCCChHHhcCCCCCCCEEEEECCEEccCCCHHHHHHHHHhCCCCCEEEEEEECccc
Confidence            4568999999999999999999999999999999999999999999999864 379999988764



>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 5e-12
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-11
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-11
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 3e-11
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-11
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 9e-11
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-10
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-10
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-10
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 3e-10
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-10
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 4e-10
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 5e-10
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 8e-10
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 8e-10
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 9e-10
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-09
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-09
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-09
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-09
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-09
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-09
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-09
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-09
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 4e-09
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 5e-09
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 5e-09
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 7e-09
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 8e-09
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 9e-09
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 9e-09
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-08
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-08
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-08
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-08
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-08
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 3e-08
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-08
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-08
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 6e-08
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 7e-08
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-08
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-08
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-07
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-07
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-07
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-07
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 3e-07
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-07
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-07
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-07
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-06
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-06
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 4e-06
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-06
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 1e-05
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-05
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-04
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 8e-04
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 0.001
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 0.001
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Tight junction protein ZO-2, Tjp2
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 56.4 bits (136), Expect = 5e-12
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 3   PNETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIG 62
             ET IVI  ++PGG A  D  L   DR++ VN T + +     AVQ L+ +   I  I 
Sbjct: 36  NGETSIVISDVLPGGPA--DGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSG-KIAAIV 92

Query: 63  VAKPLPIPDS 72
           V +P  +  +
Sbjct: 93  VKRPRKVQVA 102


>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.59
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.58
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.56
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.55
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.54
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.53
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.53
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.53
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.52
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.49
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.49
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.48
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.47
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.45
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.45
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.44
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.44
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.43
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.43
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.43
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.43
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.43
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.42
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.42
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.42
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.41
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.4
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.4
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.39
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.39
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.39
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.39
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.38
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.38
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.37
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.37
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.36
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.36
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.35
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.35
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.34
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.33
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.32
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.3
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.3
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.28
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.26
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.26
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.25
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.24
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.95
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.94
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.91
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.85
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.79
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.68
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.66
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.65
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.51
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synapse-associated protein 102
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59  E-value=4.3e-15  Score=98.46  Aligned_cols=63  Identities=43%  Similarity=0.640  Sum_probs=59.3

Q ss_pred             CCCcEEEEEEcCCChhhhcCCcCCCCEEEeeCCEeCCCCCHHHHHHHHHcCCCCeEEEEEEcCC
Q psy3208           4 NETVIVIRSLVPGGVAQLDARLIPGDRLLSVNETDLNNASLDQAVQALKGAPRGIVKIGVAKPL   67 (144)
Q Consensus         4 ~~~gi~Is~V~~gg~A~~~GrL~~GD~Il~VNg~~l~~~t~~e~v~ll~~~~~~~V~L~V~r~~   67 (144)
                      ...|+||..|.++++|+++|+|++||+|++|||+++.+++|++++++|++++ ..|.|+|.|+.
T Consensus        29 ~~~gi~I~~v~~gg~A~~~G~L~~GD~Il~VNg~~v~~~~~~e~~~~lk~~~-~~v~L~v~Rpg   91 (92)
T d2fe5a1          29 GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTS-DMVYLKVAKPG   91 (92)
T ss_dssp             TBCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCBHHHHHHHHHTCC-SEEEEEEECCC
T ss_pred             CCCCEEEEEECCCCChhhcCCCCCCCEEEEeCCeecCCCCHHHHHHHHHcCC-CEEEEEEECCC
Confidence            4578999999999999999999999999999999999999999999999986 78999999975



>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure