Psyllid ID: psy3228

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MFLIEITTYPPPDGFAPLGFEPEGGSDSSPSPSGGGEALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVVVCSGSTTGSSSGSHAGAVSQASQSTSQPDPPQPRQSSASDNQYPHSYGNQGIQHTSSAASDASSHSTRNQTSSNMHQNMHQNMHSSGHQSNMHHSSGPNMHDSSGHQSMHQSNMHQSGHQSNMHQNMDLMSKSCPTSSSLALMAPQSGHPDNHPRASSSPIPSDIVSDALSSLTEDLASSLPTLHEDRYKGRAIVFASVSVVCLSLPTLHEDSEDFDYRNKPLPPGPKLTKDSLLATARKRTMLRSKPEAFAG
ccEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHHHHccccHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccc
cEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHcc
mflieittypppdgfaplgfepeggsdsspspsgggealstsppnyLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRyfkdsrlglSEECLSSVLEDIRAAsrtspnlssrMFAESQLEVERIINVVVCsgsttgsssgshagavsqasqstsqpdppqprqssasdnqyphsygnqgiqhtssaasdasshstrnqtssnmhQNMHqnmhssghqsnmhhssgpnmhdssghqsmhqsnmhqsghqsnmhqnmdlmskscptssslalmapqsghpdnhprassspipsdiVSDALSSLTEDLasslptlhedrykgrAIVFASVSVVCLslptlhedsedfdyrnkplppgpkltkdSLLATARKRTmlrskpeafag
MFLIEIttypppdgFAPLGFEPEGGSDSSPSPSGGGEALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLkkqtnqdqiNLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAAsrtspnlssrMFAESQLEVERIINVVVCSGSTTGSSSGSHAGAVSQASQSTSQPDPPQPRQSSASDNQYPHSYGNQGIQHTSSAASDASSHSTRNQTSSNMHQNMHQNMHSSGHQSNMHHSSGPNMHDSSGHQSMHQSNMHQSGHQSNMHQNMDLMSKSCPTSSSLALMAPQSGHPDNHPRASSSPIPSDIVSDALSSLTEDLASSLPTLHEDRYKGRAIVFASVSVVCLSLPtlhedsedfdyrnkplppgpkltkdslLATARkrtmlrskpeafag
MFLIEITTYPPPDGFAPLGFepeggsdsspspsgggeALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINvvvcsgsttgsssgshagavsqasqstsqpdppqprqssasdNQYPHSYGNQGIQHTssaasdasshsTRNQTSSNMHQNMHQNMHSSGHQSNMHHSSGPNMHDSSGHQSMHQSNMHQSGHQSNMHQNMDLMSKSCPTSSSLALMAPQSGHPDNHPRassspipsdivsdaLSSLTEDLASSLPTLHEDRYKGRAIVFASVSVVCLSLPTLHEDSEDFDYRNKPLPPGPKLTKDSLLATARKRTMLRSKPEAFAG
*********************************************YLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDI******************QLEVERIINVVVCS************************************************************************************************************************************************************************************LHEDRYKGRAIVFASVSVVCLSLPTLH*******************************************
*FL*********************************************WAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLK**********IVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVVVCSGSTTGSSSGSH***************************************************************************************************************************************************************************EDRYKGRAIVFASVSVVCLSLPTLHE***************PKLTKDSLLATARKRT***********
MFLIEITTYPPPDGFAPLGFEP*******************SPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVVVCSGS************************************QYPHSYGNQ************************MHQNMHQ****************************************NMHQNMDLMSKSCPTSSSLALM*****************IPSDIVSDALSSLTEDLASSLPTLHEDRYKGRAIVFASVSVVCLSLPTLHEDSEDFDYRNKPLPPGPKLTKDSLLATARKRTMLRSKPEAFAG
*******T*********LGF**********************PPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVVVCSGSTTGSSSGSHAGA*************************YPHSYGNQ*******************************N**SSGH********************************************************PQSGHP*******SSPIPSDIVSDALSSLTEDLASSLPTLHEDRYKGRAIVFASVSVVCLSLPTLHEDSEDFDYRNKPLPPGPKLTKDSLLATARKRTMLR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLIEITTYPPPDGFAPLGFEPEGGSDSSPSPSGGGEALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVVVCSGSTTGSSSGSHAGAVSQASQSTSQPDPPQPRQSSASDNQYPHSYGNQGIQHTSSAASDASSHSTRNQTSSNMHQNMHQNMHSSGHQSNMHHSSGPNMHDSSGHQSMHQSNMHQSGHQSNMHQNMDLMSKSCPTSSSLALMAPQSGHPDNHPRASSSPIPSDIVSDALSSLTEDLASSLPTLHEDRYKGRAIVFASVSVVCLSLPTLHEDSEDFDYRNKPLPPGPKLTKDSLLATARKRTMLRSKPEAFAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query410 2.2.26 [Sep-21-2011]
Q9YGY0 842 Axin-1 OS=Xenopus laevis N/A N/A 0.290 0.141 0.354 5e-17
P57094 835 Axin-1 OS=Danio rerio GN= yes N/A 0.297 0.146 0.335 7e-17
O42400 841 Axin-1 OS=Gallus gallus G yes N/A 0.290 0.141 0.340 4e-16
Q9V407 745 Axin OS=Drosophila melano yes N/A 0.282 0.155 0.373 7e-16
O70239 827 Axin-1 OS=Rattus norvegic yes N/A 0.282 0.140 0.347 7e-16
O35625 863 Axin-1 OS=Mus musculus GN yes N/A 0.282 0.134 0.347 7e-16
O15169 862 Axin-1 OS=Homo sapiens GN yes N/A 0.290 0.138 0.333 7e-15
Q9Y2T1 843 Axin-2 OS=Homo sapiens GN no N/A 0.256 0.124 0.324 4e-12
O70240 838 Axin-2 OS=Rattus norvegic no N/A 0.256 0.125 0.324 4e-12
O88566 840 Axin-2 OS=Mus musculus GN no N/A 0.256 0.125 0.324 4e-12
>sp|Q9YGY0|AXIN1_XENLA Axin-1 OS=Xenopus laevis GN=axin1 PE=1 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 82/144 (56%), Gaps = 25/144 (17%)

Query: 18  LGFEPEGGSDSSPSPSGGGEALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSD 77
           LG+EPEG    S SP+          P YL+WA+S ++LL+D +G+HLFR +L  EN +D
Sbjct: 68  LGYEPEG----SASPT----------PPYLKWAESLHSLLDDQDGIHLFRTFLQQENCAD 113

Query: 78  LLEFWFACEGLKK-QTNQDQIN---LIVKCIYRRYFKDSRLGLSEE---CLSSVLEDIRA 130
           LL+FWFAC G +K + N  ++     + K IY++Y  DS   +S +      S ++D   
Sbjct: 114 LLDFWFACSGFRKLEPNDSKVEKRLKLAKAIYKKYVLDSNGIVSRQIKPATKSFIKDCVL 173

Query: 131 ASRTSPNLSSRMFAESQLEVERII 154
             +  P     MF ++Q+E++ ++
Sbjct: 174 RQQIDPA----MFDQAQMEIQSMM 193
Controls dorsoventral patterning via two opposing effects; down-regulates beta-catenin to inhibit the Wnt signaling pathway and ventralize embryos, but also dorsalizes embryos by activating a Wnt-independent JNK signaling pathway.
Xenopus laevis (taxid: 8355)
>sp|P57094|AXIN1_DANRE Axin-1 OS=Danio rerio GN=axin1 PE=1 SV=2 Back     alignment and function description
>sp|O42400|AXIN1_CHICK Axin-1 OS=Gallus gallus GN=AXIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q9V407|AXN_DROME Axin OS=Drosophila melanogaster GN=Axn PE=1 SV=1 Back     alignment and function description
>sp|O70239|AXIN1_RAT Axin-1 OS=Rattus norvegicus GN=Axin1 PE=1 SV=3 Back     alignment and function description
>sp|O35625|AXIN1_MOUSE Axin-1 OS=Mus musculus GN=Axin1 PE=1 SV=3 Back     alignment and function description
>sp|O15169|AXIN1_HUMAN Axin-1 OS=Homo sapiens GN=AXIN1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y2T1|AXIN2_HUMAN Axin-2 OS=Homo sapiens GN=AXIN2 PE=1 SV=1 Back     alignment and function description
>sp|O70240|AXIN2_RAT Axin-2 OS=Rattus norvegicus GN=Axin2 PE=1 SV=1 Back     alignment and function description
>sp|O88566|AXIN2_MOUSE Axin-2 OS=Mus musculus GN=Axin2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
307192994 817 Axin-related protein [Harpegnathos salta 0.319 0.160 0.426 5e-26
380029587 818 PREDICTED: axin-1-like [Apis florea] 0.319 0.160 0.420 2e-24
328784528 818 PREDICTED: axin-1 [Apis mellifera] 0.319 0.160 0.420 2e-24
350399435 817 PREDICTED: axin-like [Bombus impatiens] 0.319 0.160 0.420 5e-24
340721123 817 PREDICTED: axin-like [Bombus terrestris] 0.319 0.160 0.420 5e-24
383853898 823 PREDICTED: axin-1-like [Megachile rotund 0.319 0.159 0.420 2e-23
322780460270 hypothetical protein SINV_15199 [Solenop 0.319 0.485 0.412 2e-23
307187415 812 Axin-1 [Camponotus floridanus] 0.319 0.161 0.391 6e-20
443721500373 hypothetical protein CAPTEDRAFT_223633 [ 0.312 0.343 0.382 8e-19
47218920 862 unnamed protein product [Tetraodon nigro 0.295 0.140 0.381 4e-18
>gi|307192994|gb|EFN75982.1| Axin-related protein [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  125 bits (313), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 12/143 (8%)

Query: 13  DGFAPLGFEPEGGSDSSPSPSGGGEALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLAS 72
           D  APLGFEPEG         G     S SPP Y+ WA++ ++LL DP GL LF++YL  
Sbjct: 57  DASAPLGFEPEGCC-------GTTTMESDSPPAYVRWARNLHSLLEDPVGLELFKRYLDQ 109

Query: 73  ENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAAS 132
           E   D L FWFACEGLK+Q + ++I+ +VK IYRR+F  S+L + E+ +      ++   
Sbjct: 110 EGHVDPLNFWFACEGLKEQKDMEKISQLVKLIYRRFFLKSQLTIPEDVMKEADRRVKEG- 168

Query: 133 RTSPNLSSRMFAESQLEVERIIN 155
                   ++F   QLEVER+IN
Sbjct: 169 ----RADQKVFDIVQLEVERLIN 187

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380029587|ref|XP_003698450.1| PREDICTED: axin-1-like [Apis florea] Back     alignment and taxonomy information
>gi|328784528|ref|XP_001120373.2| PREDICTED: axin-1 [Apis mellifera] Back     alignment and taxonomy information
>gi|350399435|ref|XP_003485521.1| PREDICTED: axin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721123|ref|XP_003398975.1| PREDICTED: axin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383853898|ref|XP_003702459.1| PREDICTED: axin-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322780460|gb|EFZ09948.1| hypothetical protein SINV_15199 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307187415|gb|EFN72526.1| Axin-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|443721500|gb|ELU10791.1| hypothetical protein CAPTEDRAFT_223633 [Capitella teleta] Back     alignment and taxonomy information
>gi|47218920|emb|CAF98118.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
FB|FBgn0026597 745 Axn "Axin" [Drosophila melanog 0.253 0.139 0.394 3.1e-15
UNIPROTKB|E1B714 830 AXIN1 "Uncharacterized protein 0.270 0.133 0.350 1e-14
UNIPROTKB|J3QRK4271 AXIN2 "Axin-2" [Homo sapiens ( 0.270 0.409 0.330 1.7e-14
UNIPROTKB|I3LIX7 836 AXIN1 "Uncharacterized protein 0.263 0.129 0.383 1.8e-14
UNIPROTKB|F1PCM3 867 AXIN1 "Uncharacterized protein 0.270 0.128 0.350 2e-14
UNIPROTKB|F1NVN1386 LOC100858164 "Uncharacterized 0.270 0.287 0.349 2.2e-14
MGI|MGI:1096327 863 Axin1 "axin 1" [Mus musculus ( 0.270 0.128 0.350 5.5e-14
ZFIN|ZDB-GENE-000403-1 835 axin1 "axin 1" [Danio rerio (t 0.278 0.136 0.344 1.3e-13
UNIPROTKB|Q9YGY0 842 axin1 "Axin-1" [Xenopus laevis 0.270 0.131 0.365 1.8e-13
UNIPROTKB|F1NTP5 841 LOC100858164 "Uncharacterized 0.270 0.131 0.349 4.2e-13
FB|FBgn0026597 Axn "Axin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 200 (75.5 bits), Expect = 3.1e-15, Sum P(2) = 3.1e-15
 Identities = 45/114 (39%), Positives = 71/114 (62%)

Query:    42 SPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQS--DLLEFWFACEGLKKQTNQDQINL 99
             S P+YL WA++ N+LL D +G+ LF+KY+  E  +  D L F+FACEGLK+QT+ ++I  
Sbjct:    44 SSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQ 103

Query:   100 IVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPN--LSSRMFAESQLEVE 151
             I+  IYR + + S+L +S++  + +      A +T+P   LS  +F   Q  VE
Sbjct:   104 IIGAIYR-FLRKSQLSISDDLRAQI-----KAIKTNPEIPLSPHIFDPMQRHVE 151
GO:0016055 "Wnt receptor signaling pathway" evidence=IGI;ISS
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0007447 "imaginal disc pattern formation" evidence=IMP
GO:0030178 "negative regulation of Wnt receptor signaling pathway" evidence=IGI;IDA;NAS;IMP
GO:0005737 "cytoplasm" evidence=IDA;NAS
GO:0008013 "beta-catenin binding" evidence=NAS;IPI
GO:0007455 "eye-antennal disc morphogenesis" evidence=IMP
GO:0035019 "somatic stem cell maintenance" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0038032 "termination of G-protein coupled receptor signaling pathway" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0019901 "protein kinase binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IBA;IDA
GO:0007507 "heart development" evidence=IMP
GO:0005096 "GTPase activator activity" evidence=IBA
UNIPROTKB|E1B714 AXIN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3QRK4 AXIN2 "Axin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LIX7 AXIN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCM3 AXIN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVN1 LOC100858164 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1096327 Axin1 "axin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000403-1 axin1 "axin 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YGY0 axin1 "Axin-1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTP5 LOC100858164 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
cd08707117 cd08707, RGS_Axin, Regulator of G protein signalin 7e-22
pfam00615117 pfam00615, RGS, Regulator of G protein signaling d 9e-20
smart00315118 smart00315, RGS, Regulator of G protein signalling 7e-15
cd08718118 cd08718, RGS_RZ-like, Regulator of G protein signa 4e-12
cd08705121 cd08705, RGS_R7-like, Regulator of G protein signa 2e-11
cd08744118 cd08744, RGS_RGS17, Regulator of G protein signali 4e-11
cd08746167 cd08746, RGS_RGS20, Regulator of G protein signali 8e-11
cd08745118 cd08745, RGS_RGS19, Regulator of G protein signali 1e-10
cd07440113 cd07440, RGS, Regulator of G protein signaling (RG 7e-10
cd08712114 cd08712, RGS_RGS18, Regulator of G protein signali 7e-08
cd08714114 cd08714, RGS_RGS4, Regulator of G protein signalin 8e-08
COG5422 1175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 2e-07
cd08740126 cd08740, RGS_RGS11, Regulator of G protein signali 2e-06
cd08723111 cd08723, RGS_RGS21, Regulator of G protein signali 2e-06
cd08711125 cd08711, RGS_RGS8, Regulator of G protein signalin 3e-06
cd08741113 cd08741, RGS_RGS10, Regulator of G protein signali 5e-06
cd08706113 cd08706, RGS_R12-like, Regulator of G protein sign 7e-06
cd08715114 cd08715, RGS_RGS1, Regulator of G protein signalin 8e-06
cd08709114 cd08709, RGS_RGS2, Regulator of G protein signalin 1e-05
cd08737125 cd08737, RGS_RGS6, Regulator of G protein signalin 1e-05
cd08739121 cd08739, RGS_RGS9, Regulator of G protein signalin 1e-05
cd08743129 cd08743, RGS_RGS14, Regulator of G protein signali 2e-05
cd08717114 cd08717, RGS_RGS5, Regulator of G protein signalin 2e-05
cd08713114 cd08713, RGS_RGS3, Regulator of G protein signalin 3e-05
cd08738121 cd08738, RGS_RGS7, Regulator of G protein signalin 0.001
cd08710114 cd08710, RGS_RGS16, Regulator of G protein signali 0.003
>gnl|CDD|188662 cd08707, RGS_Axin, Regulator of G protein signaling (RGS) domain found in the Axin protein Back     alignment and domain information 
 Score = 89.8 bits (223), Expect = 7e-22
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 17/109 (15%)

Query: 54  NNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINL-IVKCIYRRYFKDS 112
           ++LL+D +G+ LFR YL  E  +DLL+FWFAC G +K ++ ++    + K IYRRY KD+
Sbjct: 2   HSLLDDQDGIELFRTYLEQEGCADLLDFWFACNGFRKMSDSEEKRSKLAKAIYRRYIKDN 61

Query: 113 RLGLSEECLSSVLEDIRAASRT-------SPNLSSRMFAESQLEVERII 154
                      V   ++ A+++          L   MF ++Q E++  +
Sbjct: 62  ---------GIVSRQLKPATKSFIKECIKKQQLDPAMFDQAQTEIQTTM 101

The RGS (Regulator of G-protein Signaling) domain is an essential part of the Axin protein. Axin is a member of the RA/RGS subfamily of the RGS protein family, a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. RGS proteins regulate many aspects of embryonic development such as glial differentiation, embryonic axis formation, and skeletal and muscle development. The RGS domain of Axin is specifically interacts with the heterotrimeric G-alpha12 protein, but not with closely related G-alpha13, and provides a unique tool to regulate G-alpha12-mediated signaling processes. The RGS domain of Axin also interacts with the tumor suppressor protein APC (Adenomatous Polyposis Coli) in order to control the cytoplasmic level of the proto-oncogene, beta-catenin. Length = 117
>gnl|CDD|216023 pfam00615, RGS, Regulator of G protein signaling domain Back     alignment and domain information
>gnl|CDD|214613 smart00315, RGS, Regulator of G protein signalling domain Back     alignment and domain information
>gnl|CDD|188673 cd08718, RGS_RZ-like, Regulator of G protein signaling (RGS) domain found in the RZ protein Back     alignment and domain information
>gnl|CDD|188660 cd08705, RGS_R7-like, Regulator of G protein signaling (RGS) domain found in the R7 subfamily of proteins Back     alignment and domain information
>gnl|CDD|188698 cd08744, RGS_RGS17, Regulator of G protein signaling (RGS) domain found in the RGS17 protein Back     alignment and domain information
>gnl|CDD|188700 cd08746, RGS_RGS20, Regulator of G protein signaling (RGS) domain found in the RGS20 protein Back     alignment and domain information
>gnl|CDD|188699 cd08745, RGS_RGS19, Regulator of G protein signaling (RGS) domain found in the RGS19 protein Back     alignment and domain information
>gnl|CDD|188659 cd07440, RGS, Regulator of G protein signaling (RGS) domain superfamily Back     alignment and domain information
>gnl|CDD|188667 cd08712, RGS_RGS18, Regulator of G protein signaling (RGS) domain found in the RGS18 protein Back     alignment and domain information
>gnl|CDD|188669 cd08714, RGS_RGS4, Regulator of G protein signaling (RGS) domain found in the RGS4 protein Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|188694 cd08740, RGS_RGS11, Regulator of G protein signaling (RGS) domain found in the RGS11 protein Back     alignment and domain information
>gnl|CDD|188678 cd08723, RGS_RGS21, Regulator of G protein signaling (RGS) domain found in the RGS21 protein Back     alignment and domain information
>gnl|CDD|188666 cd08711, RGS_RGS8, Regulator of G protein signaling (RGS) domain found in the RGS8 protein Back     alignment and domain information
>gnl|CDD|188695 cd08741, RGS_RGS10, Regulator of G protein signaling (RGS) domain found in the RGS10 protein Back     alignment and domain information
>gnl|CDD|188661 cd08706, RGS_R12-like, Regulator of G protein signaling (RGS) domain found in the R12 subfamily of proteins Back     alignment and domain information
>gnl|CDD|188670 cd08715, RGS_RGS1, Regulator of G protein signaling (RGS) domain found in the RGS1 protein Back     alignment and domain information
>gnl|CDD|188664 cd08709, RGS_RGS2, Regulator of G protein signaling (RGS) domain found in the RGS2 protein Back     alignment and domain information
>gnl|CDD|188691 cd08737, RGS_RGS6, Regulator of G protein signaling (RGS) domain found in the RGS6 protein Back     alignment and domain information
>gnl|CDD|188693 cd08739, RGS_RGS9, Regulator of G protein signaling (RGS) domain found in the RGS9 protein Back     alignment and domain information
>gnl|CDD|188697 cd08743, RGS_RGS14, Regulator of G protein signaling (RGS) domain found in the RGS14 protein Back     alignment and domain information
>gnl|CDD|188672 cd08717, RGS_RGS5, Regulator of G protein signaling (RGS) domain found in the RGS5 protein Back     alignment and domain information
>gnl|CDD|188668 cd08713, RGS_RGS3, Regulator of G protein signaling (RGS) domain found in the RGS3 protein Back     alignment and domain information
>gnl|CDD|188692 cd08738, RGS_RGS7, Regulator of G protein signaling (RGS) domain found in the RGS7 protein Back     alignment and domain information
>gnl|CDD|188665 cd08710, RGS_RGS16, Regulator of G protein signaling (RGS) domain found in the RGS16 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 410
KOG3589|consensus221 99.86
smart00315118 RGS Regulator of G protein signalling domain. RGS 99.86
PF00615118 RGS: Regulator of G protein signaling domain; Inte 99.81
KOG3590|consensus602 99.06
KOG3590|consensus602 98.55
PF09128188 RGS-like: Regulator of G protein signalling-like d 97.88
KOG0986|consensus 591 96.69
>KOG3589|consensus Back     alignment and domain information 
Probab=99.86  E-value=1.2e-21  Score=181.05  Aligned_cols=113  Identities=27%  Similarity=0.456  Sum_probs=102.5

Q ss_pred             CCChhhHHHHHHhHHHHhCChHHHHHHHHHHHhcCChhhHHHHHHHHhhhcCCCH--HHHHHHHHHHHHhhhcCC---CC
Q psy3228          40 STSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQ--DQINLIVKCIYRRYFKDS---RL  114 (410)
Q Consensus        40 s~SpP~~lrWA~SLesLL~DP~GrqLFReFLeqEfSeENLdFWLAcEgFKk~~D~--ek~lKlAK~IYdKYIsss---EV  114 (410)
                      .+...++.+|+.+|+.||.|+.|+..|..||++|+++|||+||+|||+||+....  .++...|+.||.+||.+.   +|
T Consensus        68 ~~~~e~~~~w~~sf~~L~~~~~G~~~F~~fLk~e~Seeni~FW~ace~~k~~~~~~~~~~~~~a~~i~~~f~~~~ap~~v  147 (221)
T KOG3589|consen   68 LPSREEVESWAKSFEKLLADEAGRAVFAEFLKSEFSEENLEFWLACEEFKKRRSEKSTKMSEKAKEIYEEFSAPAAPKEV  147 (221)
T ss_pred             CCCHHHHHHHHHhHHHHhhChhhHHHHHHHHHHHhhHhHHHHHHHHHHHHhCcCchhhhhhHHHHHHHHHHhccCCCCCC
Confidence            4556789999999999999999999999999999999999999999999999765  689999999999999885   89


Q ss_pred             CCCHHHHHHHHHHHHHhhccCCCCChhHHHHHHHHHHHHHhhc
Q psy3228         115 GLSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVV  157 (410)
Q Consensus       115 NIPeqVRkeIkeRIKE~i~nk~~pdpdmFDeAQ~EIynLMEdD  157 (410)
                      ||+..+|..|.+.|.+.     ...+++||.||.+||.||++|
T Consensus       148 n~d~~tre~~~~~l~~p-----~~~~~~f~~Aq~~i~~lm~~d  185 (221)
T KOG3589|consen  148 NLDSKTRELTNRNLSEP-----SGQRTCFDEAQKHVYTLMEKD  185 (221)
T ss_pred             CCchHHHHHHHHHhcCC-----CCCCCcHHHHHHHHHHhcccC
Confidence            99999988887777653     124999999999999999999

>smart00315 RGS Regulator of G protein signalling domain Back     alignment and domain information
>PF00615 RGS: Regulator of G protein signaling domain; InterPro: IPR000342 RGS (Regulator of G Protein Signalling) proteins are multi-functional, GTPase-accelerating proteins that promote GTP hydrolysis by the alpha subunit of heterotrimeric G proteins, thereby inactivating the G protein and rapidly switching off G protein-coupled receptor signalling pathways [] Back     alignment and domain information
>KOG3590|consensus Back     alignment and domain information
>KOG3590|consensus Back     alignment and domain information
>PF09128 RGS-like: Regulator of G protein signalling-like domain; InterPro: IPR015212 This entry represents a domain consisting of twelve helices that fold into a compact structure that contains the overall structural scaffold observed in other regulator of G protein signalling (RGS) proteins and three additional helical elements that pack closely to it Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
1dk8_A147 Crystal Structure Of The Rgs-Homologous Domain Of A 3e-13
1emu_A132 Structure Of The Axin Rgs-Homologous Domain In Comp 4e-13
2jm5_A151 Solution Structure Of The Rgs Domain From Human Rgs 7e-10
1zv4_X158 Structure Of The Regulator Of G-Protein Signaling 1 2e-09
2dlv_A140 Solution Structure Of The Rgs Domain Of Human Regul 2e-09
2dlr_A149 Solution Structure Of The Rgs Domain Of Human Regul 3e-08
2ihb_B153 Crystal Structure Of The Heterodimeric Complex Of H 3e-08
1cmz_A152 Solution Structure Of Gaip (Galpha Interacting Prot 4e-08
2i59_A138 Solution Structure Of Rgs10 Length = 138 4e-08
2crp_A150 Solution Structure Of The Rgs Domain Of Regulator O 4e-06
2oj4_A127 Crystal Structure Of Rgs3 Rgs Domain Length = 127 8e-06
2v4z_B142 The Crystal Structure Of The Human G-Protein Subuni 1e-05
4ekc_B137 Structure Of Human Regulator Of G Protein Signaling 2e-05
2af0_A146 Structure Of The Regulator Of G-Protein Signaling D 3e-05
1ezt_A166 High-Resolution Solution Structure Of Free Rgs4 By 4e-05
2ode_B141 Crystal Structure Of The Heterodimeric Complex Of H 4e-05
1agr_E205 Complex Of Alf4-Activated Gi-Alpha-1 With Rgs4 Leng 4e-05
2ihd_A155 Crystal Structure Of Human Regulator Of G-Protein S 4e-05
3c7l_A137 Molecular Architecture Of Galphao And The Structura 1e-04
2jnu_A154 Solution Structure Of The Rgs Domain Of Human Rgs14 2e-04
3c7k_B129 Molecular Architecture Of Galphao And The Structura 2e-04
2es0_A148 Structure Of The Regulator Of G-Protein Signaling D 3e-04
2bt2_A161 Structure Of The Regulator Of G-Protein Signaling 1 4e-04
2bv1_A145 Regulator Of G-Protein Signalling 1 (Human) Length 5e-04
2ik8_B140 Crystal Structure Of The Heterodimeric Complex Of H 5e-04
>pdb|1DK8|A Chain A, Crystal Structure Of The Rgs-Homologous Domain Of Axin Length = 147 Back     alignment and structure 
Iteration: 1

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 52/77 (67%), Gaps = 5/77 (6%)
Query: 40  STSP-PNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKK----QTNQ 94
           S SP P YL+WA+S ++LL+D +G+ LFR +L  E  +DLL+FWFAC G +K     +N+
Sbjct: 2   SASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNE 61
Query: 95  DQINLIVKCIYRRYFKD 111
           ++   + + IYR+Y  D
Sbjct: 62  EKRLKLARAIYRKYILD 78
>pdb|1EMU|A Chain A, Structure Of The Axin Rgs-Homologous Domain In Complex With A Samp Repeat From Apc Length = 132 Back     alignment and structure
>pdb|2JM5|A Chain A, Solution Structure Of The Rgs Domain From Human Rgs18 Length = 151 Back     alignment and structure
>pdb|1ZV4|X Chain X, Structure Of The Regulator Of G-Protein Signaling 17 (Rgsz2) Length = 158 Back     alignment and structure
>pdb|2DLV|A Chain A, Solution Structure Of The Rgs Domain Of Human Regulator Of G-Protein Signaling 18 Length = 140 Back     alignment and structure
>pdb|2DLR|A Chain A, Solution Structure Of The Rgs Domain Of Human Regulator Of G-Protein Signaling 10 Length = 149 Back     alignment and structure
>pdb|2IHB|B Chain B, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 153 Back     alignment and structure
>pdb|1CMZ|A Chain A, Solution Structure Of Gaip (Galpha Interacting Protein): A Regulator Of G Protein Signaling Length = 152 Back     alignment and structure
>pdb|2I59|A Chain A, Solution Structure Of Rgs10 Length = 138 Back     alignment and structure
>pdb|2CRP|A Chain A, Solution Structure Of The Rgs Domain Of Regulator Of G- Protein Signalling 5 (Rgs 5) Length = 150 Back     alignment and structure
>pdb|2OJ4|A Chain A, Crystal Structure Of Rgs3 Rgs Domain Length = 127 Back     alignment and structure
>pdb|2V4Z|B Chain B, The Crystal Structure Of The Human G-Protein Subunit Alpha ( Gnai3) In Complex With An Engineered Regulator Of G- Protein Signaling Type 2 Domain (Rgs2) Length = 142 Back     alignment and structure
>pdb|4EKC|B Chain B, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 137 Back     alignment and structure
>pdb|2AF0|A Chain A, Structure Of The Regulator Of G-Protein Signaling Domain Of Rgs2 Length = 146 Back     alignment and structure
>pdb|1EZT|A Chain A, High-Resolution Solution Structure Of Free Rgs4 By Nmr Length = 166 Back     alignment and structure
>pdb|2ODE|B Chain B, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 141 Back     alignment and structure
>pdb|1AGR|E Chain E, Complex Of Alf4-Activated Gi-Alpha-1 With Rgs4 Length = 205 Back     alignment and structure
>pdb|2IHD|A Chain A, Crystal Structure Of Human Regulator Of G-Protein Signaling 8, Rgs8 Length = 155 Back     alignment and structure
>pdb|3C7L|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 137 Back     alignment and structure
>pdb|2JNU|A Chain A, Solution Structure Of The Rgs Domain Of Human Rgs14 Length = 154 Back     alignment and structure
>pdb|3C7K|B Chain B, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 129 Back     alignment and structure
>pdb|2ES0|A Chain A, Structure Of The Regulator Of G-Protein Signaling Domain Of Rgs6 Length = 148 Back     alignment and structure
>pdb|2BT2|A Chain A, Structure Of The Regulator Of G-Protein Signaling 16 Length = 161 Back     alignment and structure
>pdb|2BV1|A Chain A, Regulator Of G-Protein Signalling 1 (Human) Length = 145 Back     alignment and structure
>pdb|2IK8|B Chain B, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 140 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
2crp_A150 RGS5, regulator of G-protein signaling 5; RGS doma 4e-20
1dk8_A147 Axin; alpha-helix, PI-helix, signaling protein; HE 3e-18
2dlv_A140 RGS18, regulator of G-protein signaling 18; RGS do 4e-18
2af0_A146 Regulator of G-protein signaling 2; helix, structu 4e-18
2jm5_A151 RGS18, regulator of G-protein signaling 18; signal 4e-18
2dlr_A149 RGS10, regulator of G-protein signaling 10; RGS do 5e-18
2ihd_A155 RGS8, regulator of G-protein signaling 8; signalin 5e-18
3c7l_A137 Regulator of G-protein signaling 16; RGS, RGS16, G 5e-18
1cmz_A152 Protein (GAIP (G-alpha interacting) protein); RGS, 9e-18
2oj4_A127 RGS3, regulator of G-protein signaling 3, RGP3; RG 3e-17
2ihb_B153 Regulator of G-protein signalling 10, guanine nucl 5e-17
2bv1_A145 Regulator of G-protein signalling 1; RGS1, RGS, st 2e-16
1zv4_X158 RGS17, regulator of G-protein signaling 17; human 2e-15
1fqi_A147 RGS9, regulator of G-protein signaling 9; phototra 5e-15
1agr_E205 RGS4; GI-alpha-1, hydrolase, signal transduction, 1e-14
2jnu_A154 RGS14, regulator of G-protein signaling 14; regula 3e-14
2ebz_A155 RGS12, regulator of G-protein signaling 12; RGS do 4e-14
2a72_A146 Regulator of G-protein signalling 7; human RGS7, r 4e-14
2pbi_A424 Regulator of G-protein signaling 9; helix WRAP, RG 1e-13
>2crp_A RGS5, regulator of G-protein signaling 5; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 150 Back     alignment and structure
 Score = 85.4 bits (211), Expect = 4e-20
 Identities = 36/130 (27%), Positives = 55/130 (42%), Gaps = 4/130 (3%)

Query: 25  GSDSSPSPSGGGEALSTSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFA 84
           GS  S  P    +   TS    L+W  S + LL +  GL  F+ +L SE   + LEFW A
Sbjct: 1   GSSGSSGPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIA 60

Query: 85  CEGLKKQTNQDQINLIVKCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNLSSRMFA 144
           CE  KK  +  ++    K IY  + +       E  +    +DI   +   P  S   F 
Sbjct: 61  CEDYKKIKSPAKMAEKAKQIYEEFIQTEA--PKEVNIDHFTKDITMKNLVEP--SLSSFD 116

Query: 145 ESQLEVERII 154
            +Q  +  ++
Sbjct: 117 MAQKRIHALM 126
>1dk8_A Axin; alpha-helix, PI-helix, signaling protein; HET: SO4; 1.57A {Homo sapiens} SCOP: a.91.1.1 PDB: 1emu_A Length = 147 Back     alignment and structure
>2dlv_A RGS18, regulator of G-protein signaling 18; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2af0_A Regulator of G-protein signaling 2; helix, structural genomics, structural genomics consortium, SGC, signaling protein; 2.30A {Homo sapiens} PDB: 2v4z_B* Length = 146 Back     alignment and structure
>2jm5_A RGS18, regulator of G-protein signaling 18; signaling protein, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} SCOP: a.91.1.1 PDB: 2owi_A Length = 151 Back     alignment and structure
>2dlr_A RGS10, regulator of G-protein signaling 10; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ihd_A RGS8, regulator of G-protein signaling 8; signaling protein, structural genomics, structura genomics consortium, SGC, signaling protein; 1.70A {Homo sapiens} PDB: 2ode_B* 2bt2_A Length = 155 Back     alignment and structure
>3c7l_A Regulator of G-protein signaling 16; RGS, RGS16, GAP, GTPase activating protein, heterotrimeric G-protein, lipoprotein, palmitate, phosphoprotein; 1.89A {Mus musculus} PDB: 3c7k_B* 2ik8_B* Length = 137 Back     alignment and structure
>1cmz_A Protein (GAIP (G-alpha interacting) protein); RGS, regulator of G protein, signaling protein regulation; NMR {Homo sapiens} SCOP: a.91.1.1 Length = 152 Back     alignment and structure
>2oj4_A RGS3, regulator of G-protein signaling 3, RGP3; RGS domain, signaling protein inhibitor; 2.30A {Homo sapiens} Length = 127 Back     alignment and structure
>2ihb_B Regulator of G-protein signalling 10, guanine nucleotide-binding protein G(K) subunit A; RGS, heterotrimeric G protein, signall complex; HET: GDP; 2.71A {Homo sapiens} PDB: 2i59_A Length = 153 Back     alignment and structure
>2bv1_A Regulator of G-protein signalling 1; RGS1, RGS, structural genomics, struct genomics consortium, B-cell activation, phosphorylation; 2.0A {Homo sapiens} PDB: 2gtp_C* Length = 145 Back     alignment and structure
>1zv4_X RGS17, regulator of G-protein signaling 17; human RGSZ2, human RGS17(Z2), regulator of G-protein signali opioid receptor interacting protein; 2.40A {Homo sapiens} Length = 158 Back     alignment and structure
>1fqi_A RGS9, regulator of G-protein signaling 9; phototransduction, ROD, GAP, signaling protein; 1.94A {Bos taurus} SCOP: a.91.1.1 PDB: 1fqj_B* 1fqk_B* Length = 147 Back     alignment and structure
>1agr_E RGS4; GI-alpha-1, hydrolase, signal transduction, complex (signal transduction/regulator), GTP-binding, GTPase activating protein; HET: GDP CIT; 2.80A {Rattus norvegicus} SCOP: a.91.1.1 PDB: 1ezt_A 1ezy_A Length = 205 Back     alignment and structure
>2jnu_A RGS14, regulator of G-protein signaling 14; regulator of G-protein signalling domain, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Length = 154 Back     alignment and structure
>2ebz_A RGS12, regulator of G-protein signaling 12; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2a72_A Regulator of G-protein signalling 7; human RGS7, regulator of G-protein signaling 7, GTPase-activ proteins (GAP), structural genomics; 2.00A {Homo sapiens} PDB: 2d9j_A 2es0_A Length = 146 Back     alignment and structure
>2pbi_A Regulator of G-protein signaling 9; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 424 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
1dk8_A147 Axin; alpha-helix, PI-helix, signaling protein; HE 99.95
2dlr_A149 RGS10, regulator of G-protein signaling 10; RGS do 99.94
2dlv_A140 RGS18, regulator of G-protein signaling 18; RGS do 99.94
1cmz_A152 Protein (GAIP (G-alpha interacting) protein); RGS, 99.94
3c7l_A137 Regulator of G-protein signaling 16; RGS, RGS16, G 99.93
2oj4_A127 RGS3, regulator of G-protein signaling 3, RGP3; RG 99.93
1zv4_X158 RGS17, regulator of G-protein signaling 17; human 99.93
2crp_A150 RGS5, regulator of G-protein signaling 5; RGS doma 99.93
2jm5_A151 RGS18, regulator of G-protein signaling 18; signal 99.93
2af0_A146 Regulator of G-protein signaling 2; helix, structu 99.93
2ihd_A155 RGS8, regulator of G-protein signaling 8; signalin 99.92
2a72_A146 Regulator of G-protein signalling 7; human RGS7, r 99.92
2bv1_A145 Regulator of G-protein signalling 1; RGS1, RGS, st 99.92
1fqi_A147 RGS9, regulator of G-protein signaling 9; phototra 99.92
2ebz_A155 RGS12, regulator of G-protein signaling 12; RGS do 99.91
2jnu_A154 RGS14, regulator of G-protein signaling 14; regula 99.91
2ihb_B153 Regulator of G-protein signalling 10, guanine nucl 99.91
1agr_E205 RGS4; GI-alpha-1, hydrolase, signal transduction, 99.9
2pbi_A424 Regulator of G-protein signaling 9; helix WRAP, RG 99.87
3cx8_B203 RHO guanine nucleotide exchange factor 11; signal 98.2
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 97.64
1iap_A211 Guanine nucleotide exchange factor P115rhogef; RGS 97.52
3ab3_B246 RHO guanine nucleotide exchange factor 1; signal t 97.52
4gou_A 518 EHRGS-rhogef; RGS domain, DH domain, PH domain, RH 97.45
3utm_C83 Axin-1; tankyrase, TNKS, ankryin repeat clusters, 97.03
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 96.9
>1dk8_A Axin; alpha-helix, PI-helix, signaling protein; HET: SO4; 1.57A {Homo sapiens} SCOP: a.91.1.1 PDB: 1emu_A Back     alignment and structure
Probab=99.95  E-value=2e-27  Score=201.84  Aligned_cols=109  Identities=33%  Similarity=0.678  Sum_probs=101.1

Q ss_pred             hhHHHHHHhHHHHhCChHHHHHHHHHHHhcCChhhHHHHHHHHhhhcC----CCHHHHHHHHHHHHHhhh-cCC---CCC
Q psy3228          44 PNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQ----TNQDQINLIVKCIYRRYF-KDS---RLG  115 (410)
Q Consensus        44 P~~lrWA~SLesLL~DP~GrqLFReFLeqEfSeENLdFWLAcEgFKk~----~D~ek~lKlAK~IYdKYI-sss---EVN  115 (410)
                      +++.+|+.+|+.||.||.|+.+|++||++|+|.|||.||++|++||+.    .+.+++.+.|+.||++|| .++   +||
T Consensus         7 ~~~~~w~~sl~~iL~~p~g~~~F~~FL~~e~~~enl~Fw~~ve~~k~~~~~~~~~~~~~~~a~~Iy~~yi~~~~s~~~vn   86 (147)
T 1dk8_A            7 PPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQ   86 (147)
T ss_dssp             CHHHHHHHCHHHHTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHCCCCTTSHHHHHHHHHHHHHHHTSCTTSHHHHH
T ss_pred             hhHHHHHhCHHHHHCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHHhhhcccCCHHHHHHHHHHHHHHHhCCccCCCCCC
Confidence            789999999999999999999999999999999999999999999998    456789999999999999 765   799


Q ss_pred             CCHHHHHHHHHHHHHhhccCCCCChhHHHHHHHHHHHHHhhc
Q psy3228         116 LSEECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVV  157 (410)
Q Consensus       116 IPeqVRkeIkeRIKE~i~nk~~pdpdmFDeAQ~EIynLMEdD  157 (410)
                      |+..+|..|.+.+...     .+++++||+||.+|+.+|+.|
T Consensus        87 i~~~~r~~i~~~l~~~-----~~~~~~Fd~aq~~V~~~m~~d  123 (147)
T 1dk8_A           87 TKPATKSFIKGCIMKQ-----LIDPAMFDQAQTEIQATMEEN  123 (147)
T ss_dssp             SCHHHHHHHHHHHHHT-----CCCTTTTHHHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHhcC-----CCCHHHHHHHHHHHHHHHhhc
Confidence            9999999998888753     578899999999999999988
>2dlr_A RGS10, regulator of G-protein signaling 10; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlv_A RGS18, regulator of G-protein signaling 18; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1cmz_A Protein (GAIP (G-alpha interacting) protein); RGS, regulator of G protein, signaling protein regulation; NMR {Homo sapiens} SCOP: a.91.1.1 Back     alignment and structure
>3c7l_A Regulator of G-protein signaling 16; RGS, RGS16, GAP, GTPase activating protein, heterotrimeric G-protein, lipoprotein, palmitate, phosphoprotein; 1.89A {Mus musculus} PDB: 3c7k_B* 2ik8_B* Back     alignment and structure
>2oj4_A RGS3, regulator of G-protein signaling 3, RGP3; RGS domain, signaling protein inhibitor; 2.30A {Homo sapiens} Back     alignment and structure
>1zv4_X RGS17, regulator of G-protein signaling 17; human RGSZ2, human RGS17(Z2), regulator of G-protein signali opioid receptor interacting protein; 2.40A {Homo sapiens} Back     alignment and structure
>2crp_A RGS5, regulator of G-protein signaling 5; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jm5_A RGS18, regulator of G-protein signaling 18; signaling protein, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} SCOP: a.91.1.1 PDB: 2owi_A Back     alignment and structure
>2af0_A Regulator of G-protein signaling 2; helix, structural genomics, structural genomics consortium, SGC, signaling protein; 2.30A {Homo sapiens} PDB: 2v4z_B* Back     alignment and structure
>2ihd_A RGS8, regulator of G-protein signaling 8; signaling protein, structural genomics, structura genomics consortium, SGC, signaling protein; 1.70A {Homo sapiens} PDB: 2ode_B* 2bt2_A Back     alignment and structure
>2a72_A Regulator of G-protein signalling 7; human RGS7, regulator of G-protein signaling 7, GTPase-activ proteins (GAP), structural genomics; 2.00A {Homo sapiens} PDB: 2d9j_A 2es0_A Back     alignment and structure
>2bv1_A Regulator of G-protein signalling 1; RGS1, RGS, structural genomics, struct genomics consortium, B-cell activation, phosphorylation; 2.0A {Homo sapiens} PDB: 2gtp_C* Back     alignment and structure
>1fqi_A RGS9, regulator of G-protein signaling 9; phototransduction, ROD, GAP, signaling protein; 1.94A {Bos taurus} SCOP: a.91.1.1 PDB: 1fqj_B* 1fqk_B* Back     alignment and structure
>2ebz_A RGS12, regulator of G-protein signaling 12; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jnu_A RGS14, regulator of G-protein signaling 14; regulator of G-protein signalling domain, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ihb_B Regulator of G-protein signalling 10, guanine nucleotide-binding protein G(K) subunit A; RGS, heterotrimeric G protein, signall complex; HET: GDP; 2.71A {Homo sapiens} PDB: 2i59_A Back     alignment and structure
>1agr_E RGS4; GI-alpha-1, hydrolase, signal transduction, complex (signal transduction/regulator), GTP-binding, GTPase activating protein; HET: GDP CIT; 2.80A {Rattus norvegicus} SCOP: a.91.1.1 PDB: 1ezt_A 1ezy_A Back     alignment and structure
>2pbi_A Regulator of G-protein signaling 9; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3cx8_B RHO guanine nucleotide exchange factor 11; signal transduction, protein complex, GTP-binding, lipoprotein, membrane, nucleotide-binding; HET: GSP; 2.00A {Rattus norvegicus} PDB: 3cx6_B* 3cx7_B* 1htj_F Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>1iap_A Guanine nucleotide exchange factor P115rhogef; RGS, RGRGS, signaling protein; 1.90A {Homo sapiens} SCOP: a.91.1.1 Back     alignment and structure
>3ab3_B RHO guanine nucleotide exchange factor 1; signal transduction, protein complex, GTP-binding, membrane, transducer, lipoprotein, nucleotide-binding; HET: GDP; 2.40A {Homo sapiens} PDB: 1shz_C* Back     alignment and structure
>4gou_A EHRGS-rhogef; RGS domain, DH domain, PH domain, RHO guanine nucleotide EXC factor, signaling protein, GTPase accelerating protein; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3utm_C Axin-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 410
d2jm5a1132 a.91.1.1 (A:3-134) Regulator of G-protein signalin 1e-21
d1cmza_128 a.91.1.1 (A:) Galpha interacting protein, GaIP {Hu 1e-19
d1dk8a_147 a.91.1.1 (A:) Axin RGS-homologous domain {Human (H 7e-19
d1agre_128 a.91.1.1 (E:) Regulator of G-protein signaling 4, 8e-19
d1fqia_138 a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [ 4e-17
d1omwa1157 a.91.1.1 (A:29-185) G-protein coupled receptor kin 2e-16
d2ik8b1116 a.91.1.1 (B:65-180) Regulator of G-protein signali 2e-15
d1htjf_182 a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (H 1e-08
>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure

class: All alpha proteins
fold: Regulator of G-protein signaling, RGS
superfamily: Regulator of G-protein signaling, RGS
family: Regulator of G-protein signaling, RGS
domain: Regulator of G-protein signaling 18, RGS18
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 88.1 bits (218), Expect = 1e-21
 Identities = 31/116 (26%), Positives = 55/116 (47%), Gaps = 10/116 (8%)

Query: 42  SPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIV 101
           SP   ++W +SF+ LL+  +GL  F ++L +E   + +EFW ACE  KK     QI+L  
Sbjct: 2   SPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKA 61

Query: 102 KCIYRRYFKDSRLGLSEECLSSVLEDIRAASRTSPNL---SSRMFAESQLEVERII 154
           K IY ++       +  +    V  D       + ++   +   F  +Q  V +++
Sbjct: 62  KAIYEKF-------IQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLM 110
>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1dk8a_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1agre_ a.91.1.1 (E:) Regulator of G-protein signaling 4, RGS4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d1fqia_ a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]} Length = 138 Back     information, alignment and structure
>d1omwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 157 Back     information, alignment and structure
>d2ik8b1 a.91.1.1 (B:65-180) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
d1cmza_128 Galpha interacting protein, GaIP {Human (Homo sapi 99.93
d1dk8a_147 Axin RGS-homologous domain {Human (Homo sapiens) [ 99.93
d2jm5a1132 Regulator of G-protein signaling 18, RGS18 {Human 99.92
d1agre_128 Regulator of G-protein signaling 4, RGS4 {Rat (Rat 99.92
d1fqia_138 RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2ik8b1116 Regulator of G-protein signaling 16, RGS16 {Human 99.9
d1omwa1157 G-protein coupled receptor kinase 2, N-terminal do 99.86
d1htjf_182 Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [ 99.82
d1iapa_190 p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]} 97.65
>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Regulator of G-protein signaling, RGS
superfamily: Regulator of G-protein signaling, RGS
family: Regulator of G-protein signaling, RGS
domain: Galpha interacting protein, GaIP
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=1.3e-26  Score=191.63  Aligned_cols=110  Identities=27%  Similarity=0.571  Sum_probs=100.8

Q ss_pred             CChhhHHHHHHhHHHHhCChHHHHHHHHHHHhcCChhhHHHHHHHHhhhcCCCHHHHHHHHHHHHHhhhcCC---CCCCC
Q psy3228          41 TSPPNYLEWAKSFNNLLNDPEGLHLFRKYLASENQSDLLEFWFACEGLKKQTNQDQINLIVKCIYRRYFKDS---RLGLS  117 (410)
Q Consensus        41 ~SpP~~lrWA~SLesLL~DP~GrqLFReFLeqEfSeENLdFWLAcEgFKk~~D~ek~lKlAK~IYdKYIsss---EVNIP  117 (410)
                      |+|+++.+|+.+|++||.||.|+.+|++||++++|+|||.||++|++||+..+.+.+.+.|+.||++||..+   ++||+
T Consensus         1 p~~~~~~~w~~sl~~iL~d~~~~~~F~~fL~~~~~~e~l~Fw~~ve~fk~~~~~~~~~~~a~~Iy~~yi~~~s~~~~~i~   80 (128)
T d1cmza_           1 PSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLD   80 (128)
T ss_dssp             CCHHHHHHHTTCSHHHHSSHHHHHHHHHHHHHHTCCHHHHHHHHHHHGGGTCCSHHHHHHHHHHHHHTTTCSSSCCCSCC
T ss_pred             CCHHHHHHHHhCHHHHHcChHHHHHHHHHHHHhcCHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHhccCCCccCCcC
Confidence            467889999999999999999999999999999999999999999999998888889999999999999885   79999


Q ss_pred             HHHHHHHHHHHHHhhccCCCCChhHHHHHHHHHHHHHhhc
Q psy3228         118 EECLSSVLEDIRAASRTSPNLSSRMFAESQLEVERIINVV  157 (410)
Q Consensus       118 eqVRkeIkeRIKE~i~nk~~pdpdmFDeAQ~EIynLMEdD  157 (410)
                      ..+|..|..++.       .+++++|+.||.+|+.+|+.+
T Consensus        81 ~~~r~~i~~~~~-------~~~~~~F~~aq~~V~~~l~~~  113 (128)
T d1cmza_          81 SRVREGINKKMQ-------EPSAHTFDDAQLQIYTLMHRD  113 (128)
T ss_dssp             SHHHHHHHHHSS-------SCCTTSTHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhc-------CCCHHHHHHHHHHHHHHHHhC
Confidence            999888766543       457899999999999999887
>d1dk8a_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1agre_ a.91.1.1 (E:) Regulator of G-protein signaling 4, RGS4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fqia_ a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ik8b1 a.91.1.1 (B:65-180) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure