Psyllid ID: psy3567


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MQVLTEDFGWDPSSPSKLTLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
cccccccccccccccccccccccHHHHccccccEEEEccccccccHHHHHccccccEEEccccccccccHHHHHHHHcccEEEccccccccccHHHHcccccccccccccccccccHHHHcccccccccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccccEEEccccccccccHHHHccc
cccccHHHcccccccccccccccHHHHHHccHHHHHHHccccccccHHHHHcccccEEEccccccccccHHHHHHHHHHcEEcccccccccccHHHHHHccccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccccEEEccccccccccccHHHccEEEEEccccccccccHHHHHHccccEEEcccccEEcccccHHHHHHccccEEEccccccccccHHHHHHHHcccEEEccccEEEc
mqvltedfgwdpsspskltlllpgkknrgliEGTIFVLKMGNSATKRHFETAKKTGVinlshqgfkefpDEMNELKAVLRTLDIsqnkiskfpldLASYQLLKSLtfdqnkieslpkdigtLEKLENVsgncnlikelplsfsklhnlkhlslsqnqlnkfptvlfnlqhldvldlsfnriesipdgiGKMKVIEMNLNknqichispdiseCVRLKILRLEENClainaiptciltssnvctlnvegnLFEMKAFqqldgynnymdselqrsglli
mqvltedfgwdpsspskltlllpgkknrgLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
MQVLTEDFGWDpsspskltlllpgkkNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPlsfsklhnlkhlslsQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
******************TLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNY************
******************TLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
MQVLTEDFGWDPSSPSKLTLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
*QVLTEDFGWDPSSPSKLTLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVLTEDFGWDPSSPSKLTLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMDSELQRSGLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
Q8N9N7239 Leucine-rich repeat-conta yes N/A 0.823 0.953 0.532 2e-61
Q5FVI3239 Leucine-rich repeat-conta yes N/A 0.823 0.953 0.528 3e-61
Q9D1G5239 Leucine-rich repeat-conta yes N/A 0.823 0.953 0.524 7e-61
Q6DHL5238 Leucine-rich repeat-conta yes N/A 0.823 0.957 0.508 3e-60
Q6INV3238 Leucine-rich repeat-conta N/A N/A 0.823 0.957 0.5 2e-58
Q96II8 777 Leucine-rich repeat and c no N/A 0.743 0.265 0.303 3e-18
Q9Y4C4 1052 Malignant fibrous histioc no N/A 0.823 0.216 0.290 1e-17
Q14160 1630 Protein scribble homolog no N/A 0.711 0.120 0.285 3e-17
Q7SXW3 601 Leucine-rich repeat-conta no N/A 0.682 0.314 0.331 5e-17
Q80U72 1612 Protein scribble homolog no N/A 0.714 0.122 0.28 1e-16
>sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 Back     alignment and function desciption
 Score =  236 bits (601), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 164/229 (71%), Gaps = 1/229 (0%)

Query: 40  MGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFP-LDLAS 98
           MGNSA + H ETA+KTGV  L  +G  EFP ++ +L + LRT+D+S NKI   P L +  
Sbjct: 1   MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGK 60

Query: 99  YQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQL 158
           + LLKSL+ + NK+  LP +I  L+KLE +S N N ++ELP +F +L  LK LSLS NQL
Sbjct: 61  FTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL 120

Query: 159 NKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKI 218
              P  L +L+HLDV+DLS N+I SIPD +G+++VIE+NLN+NQI  IS  IS C RLKI
Sbjct: 121 GALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKI 180

Query: 219 LRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMD 267
           LRLEENCL ++ +P  IL+ S +C L VEGNLFE+K  ++L+GY+ YM+
Sbjct: 181 LRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYME 229





Homo sapiens (taxid: 9606)
>sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
348579451281 PREDICTED: LOW QUALITY PROTEIN: leucine- 0.938 0.925 0.498 2e-61
440898999239 Leucine-rich repeat-containing protein 5 0.823 0.953 0.524 1e-60
441615576263 PREDICTED: leucine-rich repeat-containin 0.826 0.870 0.530 2e-60
426233056239 PREDICTED: leucine-rich repeat-containin 0.823 0.953 0.524 2e-60
397467924263 PREDICTED: leucine-rich repeat-containin 0.826 0.870 0.530 2e-60
383864500238 PREDICTED: leucine-rich repeat-containin 0.823 0.957 0.504 2e-60
156549874238 PREDICTED: leucine-rich repeat-containin 0.823 0.957 0.521 2e-60
390480998296 PREDICTED: leucine-rich repeat-containin 0.826 0.773 0.530 3e-60
403274482239 PREDICTED: leucine-rich repeat-containin 0.823 0.953 0.532 4e-60
31874816239 hypothetical protein [Homo sapiens] 0.823 0.953 0.532 7e-60
>gi|348579451|ref|XP_003475493.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat-containing protein 57-like [Cavia porcellus] Back     alignment and taxonomy information
 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/269 (49%), Positives = 180/269 (66%), Gaps = 9/269 (3%)

Query: 3   VLTEDFGWDPSSPSKLTLLLPGK---KNRGLIEGTIFVLKMGNSATKRHFETAKKTGVIN 59
           V  E  G  P  P+++  LL G      R L  GT    KMGNSA + H ETA+KTGV  
Sbjct: 8   VRAEALGAHPR-PARVXDLLLGNLLFSERDLKRGT----KMGNSALRAHVETAQKTGVFQ 62

Query: 60  LSHQGFKEFPDEMNELKAVLRTLDISQNKISKFP-LDLASYQLLKSLTFDQNKIESLPKD 118
           L  +G  EFP E+ +L + LRT+D+S NKI   P L +  + LLKSL+ + NK+  +P +
Sbjct: 63  LKDRGLTEFPAELQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNSNKLTVVPDE 122

Query: 119 IGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSF 178
           +  L+KLE +S N N +++LP +F +L  LK LSLS NQL   P  L +L+HLDVLDLS 
Sbjct: 123 LCNLKKLEMLSLNNNHLRDLPATFGQLSALKTLSLSGNQLRALPPQLCSLRHLDVLDLSK 182

Query: 179 NRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTS 238
           N+I SIPD IG+++VIE+NLN+NQI  IS  IS C RLK+LRLEENCL ++ +P  IL+ 
Sbjct: 183 NQIRSIPDLIGELQVIELNLNQNQISQISVKISSCPRLKVLRLEENCLELSMLPQSILSD 242

Query: 239 SNVCTLNVEGNLFEMKAFQQLDGYNNYMD 267
           S +C L VEGNLFE+K  ++L+GY+ YM+
Sbjct: 243 SQICLLAVEGNLFEIKKLRELEGYDKYME 271




Source: Cavia porcellus

Species: Cavia porcellus

Genus: Cavia

Family: Caviidae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|440898999|gb|ELR50382.1| Leucine-rich repeat-containing protein 57 [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|441615576|ref|XP_004088311.1| PREDICTED: leucine-rich repeat-containing protein 57 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|426233056|ref|XP_004010533.1| PREDICTED: leucine-rich repeat-containing protein 57 isoform 1 [Ovis aries] gi|426233058|ref|XP_004010534.1| PREDICTED: leucine-rich repeat-containing protein 57 isoform 2 [Ovis aries] Back     alignment and taxonomy information
>gi|397467924|ref|XP_003805650.1| PREDICTED: leucine-rich repeat-containing protein 57 isoform 1 [Pan paniscus] gi|410049068|ref|XP_003952688.1| PREDICTED: leucine-rich repeat-containing protein 57 [Pan troglodytes] Back     alignment and taxonomy information
>gi|383864500|ref|XP_003707716.1| PREDICTED: leucine-rich repeat-containing protein 57-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156549874|ref|XP_001601190.1| PREDICTED: leucine-rich repeat-containing protein 57-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|390480998|ref|XP_002763996.2| PREDICTED: leucine-rich repeat-containing protein 57, partial [Callithrix jacchus] Back     alignment and taxonomy information
>gi|403274482|ref|XP_003929005.1| PREDICTED: leucine-rich repeat-containing protein 57 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|31874816|emb|CAD98097.1| hypothetical protein [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
MGI|MGI:1913856239 Lrrc57 "leucine rich repeat co 0.823 0.953 0.489 2.6e-54
ZFIN|ZDB-GENE-040718-372238 lrrc57 "leucine rich repeat co 0.823 0.957 0.478 3.8e-53
TAIR|locus:2142773262 AT5G07910 "AT5G07910" [Arabido 0.801 0.847 0.277 3.4e-22
UNIPROTKB|Q96II8 777 LRCH3 "Leucine-rich repeat and 0.714 0.254 0.286 2.1e-18
ZFIN|ZDB-GENE-071004-44 525 zgc:171915 "zgc:171915" [Danio 0.732 0.386 0.265 3.3e-18
MGI|MGI:1917394 778 Lrch3 "leucine-rich repeats an 0.714 0.254 0.266 8.5e-17
MGI|MGI:2443390 709 Lrch1 "leucine-rich repeats an 0.761 0.297 0.276 3.2e-16
UNIPROTKB|E2R260 582 SHOC2 "Uncharacterized protein 0.689 0.328 0.295 4.7e-16
UNIPROTKB|A6QLV3 582 SHOC2 "Leucine-rich repeat pro 0.689 0.328 0.295 6e-16
UNIPROTKB|Q9UQ13 582 SHOC2 "Leucine-rich repeat pro 0.689 0.328 0.295 6e-16
MGI|MGI:1913856 Lrrc57 "leucine rich repeat containing 57" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 561 (202.5 bits), Expect = 2.6e-54, P = 2.6e-54
 Identities = 112/229 (48%), Positives = 153/229 (66%)

Query:    40 MGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFP-LDLAS 98
             MGNSA + H ETA+KTGV  L  +G  EFP E+ +L + LRT+D+S NKI   P L +  
Sbjct:     1 MGNSALRAHVETAQKTGVFQLKDRGLTEFPSELQKLTSNLRTIDLSNNKIDSLPPLIIGK 60

Query:    99 YQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELPXXXXXXXXXXXXXXXQNQL 158
             + LLKSL+ + NK+  LP ++  L+KLE +S N N ++ELP                NQL
Sbjct:    61 FTLLKSLSLNNNKLTVLPDELCNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL 120

Query:   159 NKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKI 218
                P  L  L+HLDV+DLS N+I SIPD +G+++ IE+NLN+NQI  +S  IS C RLK+
Sbjct:   121 GALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQISQLSVKISCCPRLKV 180

Query:   219 LRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMKAFQQLDGYNNYMD 267
             LRLEENCL ++ +P  IL+ S +C L VEGNLFE+K F++L+GY+ YM+
Sbjct:   181 LRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKFRELEGYDKYME 229




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-040718-372 lrrc57 "leucine rich repeat containing 57" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2142773 AT5G07910 "AT5G07910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q96II8 LRCH3 "Leucine-rich repeat and calponin homology domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-44 zgc:171915 "zgc:171915" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1917394 Lrch3 "leucine-rich repeats and calponin homology (CH) domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2443390 Lrch1 "leucine-rich repeats and calponin homology (CH) domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8N9N7LRC57_HUMANNo assigned EC number0.53270.82310.9539yesN/A
Q6DHL5LRC57_DANRENo assigned EC number0.50870.82310.9579yesN/A
Q9D1G5LRC57_MOUSENo assigned EC number0.52400.82310.9539yesN/A
Q5FVI3LRC57_RATNo assigned EC number0.52830.82310.9539yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-15
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.003
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.004
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 73.8 bits (181), Expect = 5e-15
 Identities = 52/153 (33%), Positives = 83/153 (54%), Gaps = 1/153 (0%)

Query: 57  VINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLP 116
            ++L +    + P  +  LK+ L+ LD+S NKI   P  L +   LK+L    N +  LP
Sbjct: 120 SLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLP 179

Query: 117 KDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDL 176
           K +  L  L N+  + N I +LP     L  L+ L LS N + +  + L NL++L  L+L
Sbjct: 180 KLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLEL 239

Query: 177 SFNRIESIPDGIGKMKVIE-MNLNKNQICHISP 208
           S N++E +P+ IG +  +E ++L+ NQI  IS 
Sbjct: 240 SNNKLEDLPESIGNLSNLETLDLSNNQISSISS 272


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG0444|consensus 1255 99.89
KOG4194|consensus 873 99.88
KOG4194|consensus 873 99.87
KOG0444|consensus 1255 99.87
KOG0472|consensus565 99.86
KOG0472|consensus 565 99.83
KOG0617|consensus264 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG0617|consensus264 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
KOG0618|consensus 1081 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.68
KOG0532|consensus 722 99.65
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.64
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG4237|consensus 498 99.62
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
KOG0618|consensus 1081 99.6
KOG0532|consensus 722 99.58
KOG4237|consensus 498 99.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.45
KOG1259|consensus490 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.26
KOG1909|consensus382 99.26
KOG3207|consensus 505 99.23
KOG1259|consensus490 99.23
KOG1909|consensus382 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
KOG3207|consensus 505 99.12
KOG4658|consensus 889 99.08
KOG0531|consensus 414 98.92
KOG1859|consensus 1096 98.91
KOG2982|consensus 418 98.82
KOG0531|consensus414 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG4658|consensus 889 98.68
PLN03150623 hypothetical protein; Provisional 98.67
KOG1859|consensus 1096 98.66
PLN03150623 hypothetical protein; Provisional 98.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.58
KOG4579|consensus177 98.53
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.5
KOG1644|consensus233 98.45
KOG4579|consensus177 98.41
PRK15386 426 type III secretion protein GogB; Provisional 98.39
KOG2120|consensus419 98.29
KOG1644|consensus233 98.26
KOG2982|consensus 418 98.23
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.22
KOG2120|consensus419 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.14
KOG3665|consensus 699 98.08
PRK15386 426 type III secretion protein GogB; Provisional 98.03
KOG3665|consensus 699 97.83
KOG2123|consensus 388 97.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.06
KOG2123|consensus 388 96.93
KOG2739|consensus260 96.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.53
KOG2739|consensus260 96.52
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.79
KOG4308|consensus 478 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.3
KOG4308|consensus 478 95.0
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.76
KOG0473|consensus326 94.32
smart0037026 LRR Leucine-rich repeats, outliers. 94.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.03
KOG0473|consensus326 93.35
KOG4341|consensus483 92.91
smart0037026 LRR Leucine-rich repeats, outliers. 91.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.57
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.68
KOG3864|consensus221 85.82
KOG3864|consensus221 80.38
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.91  E-value=8.5e-24  Score=205.98  Aligned_cols=205  Identities=26%  Similarity=0.412  Sum_probs=110.6

Q ss_pred             HhhhccCccCEEEeecCCCC-cCChhHHHhhccccEEEccCCCCC-cCCccccccCCCcEEeccCCcCc-ccCccccCcc
Q psy3567          47 RHFETAKKTGVINLSHQGFK-EFPDEMNELKAVLRTLDISQNKIS-KFPLDLASYQLLKSLTFDQNKIE-SLPKDIGTLE  123 (277)
Q Consensus        47 ~~l~~~~~L~~L~l~~~~i~-~~~~~~~~~~~~L~~L~l~~~~i~-~~~~~~~~l~~L~~L~l~~~~i~-~~~~~~~~l~  123 (277)
                      ..++.+++|++|++++|.+. .+|..+..+ ++|++|++++|.+. .+|..+.++++|++|++++|.+. .+|..++.++
T Consensus       158 ~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~  236 (968)
T PLN00113        158 NDIGSFSSLKVLDLGGNVLVGKIPNSLTNL-TSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLT  236 (968)
T ss_pred             hHHhcCCCCCEEECccCcccccCChhhhhC-cCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCC
Confidence            34455555555555555544 444444444 55555555555544 33444555555555555555554 3444555555


Q ss_pred             cCceeeccccccc-ccchhhhcCCCCCEEEccCCCCc-cCccccCCCCCCCEEEccCCCCc-ccCchhccce-eeEEEcc
Q psy3567         124 KLENVSGNCNLIK-ELPLSFSKLHNLKHLSLSQNQLN-KFPTVLFNLQHLDVLDLSFNRIE-SIPDGIGKMK-VIEMNLN  199 (277)
Q Consensus       124 ~L~~L~l~~n~~~-~l~~~~~~l~~L~~L~l~~n~l~-~~~~~l~~~~~L~~L~l~~n~l~-~l~~~~~~~~-l~~L~l~  199 (277)
                      +|++|++++|.+. .+|..+..+++|++|++++|.+. .+|..+..+++|++|++++|.++ .+|..+..++ ++.|+++
T Consensus       237 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~  316 (968)
T PLN00113        237 SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLF  316 (968)
T ss_pred             CCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECC
Confidence            5555555555544 34445555555555555555554 34445555555556666555554 3444444442 5556666


Q ss_pred             CCccC-cCCcCccCCCCCCEEEcCCCccccCccCccccCCCCccEEEcCCCeeee
Q psy3567         200 KNQIC-HISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEM  253 (277)
Q Consensus       200 ~n~l~-~l~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~~~~  253 (277)
                      +|.++ .+|..+..+++|+.|++++|.+. +.+|..+..+++|+.+++++|.+++
T Consensus       317 ~n~~~~~~~~~~~~l~~L~~L~L~~n~l~-~~~p~~l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        317 SNNFTGKIPVALTSLPRLQVLQLWSNKFS-GEIPKNLGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             CCccCCcCChhHhcCCCCCEEECcCCCCc-CcCChHHhCCCCCcEEECCCCeeEe
Confidence            66555 34444555666666666666665 4555556666666666666666554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-05
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-05
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 6e-05
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-05
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 9e-05
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 49/165 (29%), Positives = 75/165 (45%), Gaps = 32/165 (19%) Query: 67 EFPDEMNELK-----AVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGT 121 F +++ +LK L LDIS NK+S + LA L+SL N+I + +G Sbjct: 161 SFGNQVTDLKPLANLTTLERLDISSNKVSDISV-LAKLTNLESLIATNNQISDI-TPLGI 218 Query: 122 LEKLENVSGNCNLIKELPXXXXXXXXXXXXXXXQNQLNKFPTVLFNLQHLDVLDLSFNRI 181 L L+ +S N N +K++ L +L +L LDL+ N+I Sbjct: 219 LTNLDELSLNGNQLKDIG------------------------TLASLTNLTDLDLANNQI 254 Query: 182 ESIPDGIGKMKVIEMNLNKNQICHISPDISECVRLKILRLEENCL 226 ++ G K+ E+ L NQI +ISP ++ L L L EN L Sbjct: 255 SNLAPLSGLTKLTELKLGANQISNISP-LAGLTALTNLELNENQL 298
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-13
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-12
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.21
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.72
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.18
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.16
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.98
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.2
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.19
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.16
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.96  E-value=8.5e-28  Score=205.71  Aligned_cols=221  Identities=23%  Similarity=0.313  Sum_probs=168.4

Q ss_pred             CCceeEecCCCCcCCCCCCceeeeccCCcchhHhhhccCccCEEEeecCCCCcCChhHHHhhccccEEEccCCCCCcCCc
Q psy3567          15 PSKLTLLLPGKKNRGLIEGTIFVLKMGNSATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPL   94 (277)
Q Consensus        15 ~~l~~l~l~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~i~~~~~   94 (277)
                      +++++|++++|.++ .+|+.              +.++++|++|++++|.++.+|..+..+ ++|++|++++|++..+|.
T Consensus        81 ~~l~~L~L~~n~l~-~lp~~--------------l~~l~~L~~L~L~~n~l~~lp~~~~~l-~~L~~L~Ls~n~l~~lp~  144 (328)
T 4fcg_A           81 PGRVALELRSVPLP-QFPDQ--------------AFRLSHLQHMTIDAAGLMELPDTMQQF-AGLETLTLARNPLRALPA  144 (328)
T ss_dssp             TTCCEEEEESSCCS-SCCSC--------------GGGGTTCSEEEEESSCCCCCCSCGGGG-TTCSEEEEESCCCCCCCG
T ss_pred             cceeEEEccCCCch-hcChh--------------hhhCCCCCEEECCCCCccchhHHHhcc-CCCCEEECCCCccccCcH
Confidence            46777777777776 44443              355778888888888888888777666 788888888888888887


Q ss_pred             cccccCCCcEEeccCCcCc-ccCcccc---------CcccCceeecccccccccchhhhcCCCCCEEEccCCCCccCccc
Q psy3567          95 DLASYQLLKSLTFDQNKIE-SLPKDIG---------TLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTV  164 (277)
Q Consensus        95 ~~~~l~~L~~L~l~~~~i~-~~~~~~~---------~l~~L~~L~l~~n~~~~l~~~~~~l~~L~~L~l~~n~l~~~~~~  164 (277)
                      .+.++++|++|++++|.+. .+|..+.         .+++|++|++++|.+..+|..+..+++|++|++++|.+..+|..
T Consensus       145 ~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~  224 (328)
T 4fcg_A          145 SIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPA  224 (328)
T ss_dssp             GGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGG
T ss_pred             HHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchh
Confidence            8888888888888886443 5555544         37888888888888888887788888888888888888888777


Q ss_pred             cCCCCCCCEEEccCCCCc-ccCchhccce-eeEEEccCCccC-cCCcCccCCCCCCEEEcCCCccccCccCccccCCCCc
Q psy3567         165 LFNLQHLDVLDLSFNRIE-SIPDGIGKMK-VIEMNLNKNQIC-HISPDISECVRLKILRLEENCLAINAIPTCILTSSNV  241 (277)
Q Consensus       165 l~~~~~L~~L~l~~n~l~-~l~~~~~~~~-l~~L~l~~n~l~-~l~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L  241 (277)
                      ++.+++|++|++++|.+. .+|..++.++ +++|++++|++. .+|..+..+++|++|++++|.+. +.+|..+.+++++
T Consensus       225 l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~-~~iP~~l~~L~~L  303 (328)
T 4fcg_A          225 IHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNL-SRLPSLIAQLPAN  303 (328)
T ss_dssp             GGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTC-CCCCGGGGGSCTT
T ss_pred             hccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCch-hhccHHHhhccCc
Confidence            777888888888887665 5676666654 888888887654 67777888888888888888877 6888888888888


Q ss_pred             cEEEcCCCeee
Q psy3567         242 CTLNVEGNLFE  252 (277)
Q Consensus       242 ~~l~l~~n~~~  252 (277)
                      +.+++..+.+.
T Consensus       304 ~~l~l~~~~~~  314 (328)
T 4fcg_A          304 CIILVPPHLQA  314 (328)
T ss_dssp             CEEECCGGGSC
T ss_pred             eEEeCCHHHHH
Confidence            88888776543



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 52.8 bits (126), Expect = 1e-09
 Identities = 23/123 (18%), Positives = 52/123 (42%), Gaps = 4/123 (3%)

Query: 80  RTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKELP 139
           R L ++   ++     L    L+  L    N++ +LP  +  L  LE +  + N ++ + 
Sbjct: 1   RVLHLAHKDLTVLC-HLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVD 59

Query: 140 LSFSKLHNLKHLSLSQNQLNKFPTV--LFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMN 197
              + L  L+ L L  N+L +   +  L +   L +L+L  N +        ++  +  +
Sbjct: 60  -GVANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPS 118

Query: 198 LNK 200
           ++ 
Sbjct: 119 VSS 121


>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.02
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.57
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=4.9e-24  Score=175.11  Aligned_cols=198  Identities=25%  Similarity=0.355  Sum_probs=167.8

Q ss_pred             ccCccCEEEeecCCCCcCChhHHHhhccccEEEccCCCCCcCCc-cccccCCCcEEeccCCcCcccCccccCcccCceee
Q psy3567          51 TAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPL-DLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVS  129 (277)
Q Consensus        51 ~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~i~~~~~-~~~~l~~L~~L~l~~~~i~~~~~~~~~l~~L~~L~  129 (277)
                      +...+.++++++++++++|+.+.   +++++|++++|+++.+|. .|.++++|++|++++|+++.++. ++.+++|++|+
T Consensus         8 ~~~~~~~v~C~~~~L~~iP~~lp---~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~   83 (266)
T d1p9ag_           8 KVASHLEVNCDKRNLTALPPDLP---KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-DGTLPVLGTLD   83 (266)
T ss_dssp             CSTTCCEEECTTSCCSSCCSCCC---TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-CSCCTTCCEEE
T ss_pred             ccCCCeEEEccCCCCCeeCcCcC---cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-ccccccccccc
Confidence            44566778999999999987653   679999999999998775 58899999999999999987763 56789999999


Q ss_pred             cccccccccchhhhcCCCCCEEEccCCCCccCcc-ccCCCCCCCEEEccCCCCcccCchhc-cc-eeeEEEccCCccCcC
Q psy3567         130 GNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPT-VLFNLQHLDVLDLSFNRIESIPDGIG-KM-KVIEMNLNKNQICHI  206 (277)
Q Consensus       130 l~~n~~~~l~~~~~~l~~L~~L~l~~n~l~~~~~-~l~~~~~L~~L~l~~n~l~~l~~~~~-~~-~l~~L~l~~n~l~~l  206 (277)
                      +++|.+...+..+..+++|+.|++++|.+..++. .+..+.+++++++++|.++.++.... .+ .++.+++++|+++.+
T Consensus        84 Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~  163 (266)
T d1p9ag_          84 LSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTEL  163 (266)
T ss_dssp             CCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCC
T ss_pred             cccccccccccccccccccccccccccccceeeccccccccccccccccccccceeccccccccccchhccccccccccc
Confidence            9999998888888899999999999999887754 44568899999999999998876653 33 488999999999988


Q ss_pred             CcC-ccCCCCCCEEEcCCCccccCccCccccCCCCccEEEcCCCeeeec
Q psy3567         207 SPD-ISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEMK  254 (277)
Q Consensus       207 ~~~-l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~  254 (277)
                      +.. +..+++|++|+|++|.++  .+|..+..+++|+.|+|++|++...
T Consensus       164 ~~~~~~~l~~L~~L~Ls~N~L~--~lp~~~~~~~~L~~L~L~~Np~~Cd  210 (266)
T d1p9ag_         164 PAGLLNGLENLDTLLLQENSLY--TIPKGFFGSHLLPFAFLHGNPWLCN  210 (266)
T ss_dssp             CTTTTTTCTTCCEEECCSSCCC--CCCTTTTTTCCCSEEECCSCCBCCS
T ss_pred             CccccccccccceeecccCCCc--ccChhHCCCCCCCEEEecCCCCCCC
Confidence            865 788999999999999997  7888888899999999999999864



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure