Psyllid ID: psy3581

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLSSVPGGTRTSFKS
cEEHHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccHHHHHHHHccEEEEEEccccccccccEEcccHHHHHHHccccccccccc
ccHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccHHHHHHHHcccEEEEEEEcccccccEcccccHHHHHHHHcccccccccc
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSeswwngslpcpiEELVTALdgciltdllplstsgeitvSGIVSTVLLssvpggtrtsfks
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVllssvpggtrtsfks
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLSSVPGGTRTSFKS
*YFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLS************
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLSS***********
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLSSV**********
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLSSVP*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFIRILMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLSSVPGGTRTSFKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
O75899 941 Gamma-aminobutyric acid t yes N/A 0.787 0.122 0.396 2e-17
O88871 940 Gamma-aminobutyric acid t yes N/A 0.787 0.122 0.380 1e-16
Q80T41 940 Gamma-aminobutyric acid t yes N/A 0.787 0.122 0.380 1e-16
Q9Z0U4 991 Gamma-aminobutyric acid t no N/A 0.801 0.118 0.316 8e-16
Q9WV18 960 Gamma-aminobutyric acid t no N/A 0.801 0.121 0.316 9e-16
Q9UBS5 961 Gamma-aminobutyric acid t no N/A 0.801 0.121 0.308 2e-15
>sp|O75899|GABR2_HUMAN Gamma-aminobutyric acid type B receptor subunit 2 OS=Homo sapiens GN=GABBR2 PE=1 SV=1 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 66/121 (54%), Gaps = 6/121 (4%)

Query: 12  HNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIG 71
            N L   +    I++  + SFS++  T++ KLK  DVRIILG F++  A  +FC AY   
Sbjct: 212 RNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEEN 271

Query: 72  MIGRKYQWLIIGMYSESWWN------GSLPCPIEELVTALDGCILTDLLPLSTSGEITVS 125
           M G KYQW+I G Y  SWW        S  C  + L+ A++G I  D  PLS+    T+S
Sbjct: 272 MYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTIS 331

Query: 126 G 126
           G
Sbjct: 332 G 332
Receptor for GABA. The activity of this receptor is mediated by G-proteins that inhibit adenylyl cyclase activity, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipids hydrolysis. Plays a critical role in the fine-tuning of inhibitory synaptic transmission. Pre-synaptic GABA-B-R inhibit neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA-B-R decrease neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials. Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception.
Homo sapiens (taxid: 9606)
>sp|O88871|GABR2_RAT Gamma-aminobutyric acid type B receptor subunit 2 OS=Rattus norvegicus GN=Gabbr2 PE=1 SV=2 Back     alignment and function description
>sp|Q80T41|GABR2_MOUSE Gamma-aminobutyric acid type B receptor subunit 2 OS=Mus musculus GN=Gabbr2 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z0U4|GABR1_RAT Gamma-aminobutyric acid type B receptor subunit 1 OS=Rattus norvegicus GN=Gabbr1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WV18|GABR1_MOUSE Gamma-aminobutyric acid type B receptor subunit 1 OS=Mus musculus GN=Gabbr1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UBS5|GABR1_HUMAN Gamma-aminobutyric acid type B receptor subunit 1 OS=Homo sapiens GN=GABBR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
242008075 1395 class C metabotropic glutamate-like G-pr 0.794 0.083 0.633 7e-38
328721858 991 PREDICTED: gamma-aminobutyric acid type 0.815 0.120 0.575 7e-36
270008481 1077 hypothetical protein TcasGA2_TC014995 [T 0.815 0.110 0.581 4e-35
189238494 1121 PREDICTED: similar to GA19799-PA [Tribol 0.815 0.106 0.581 4e-35
345491324 1283 PREDICTED: gamma-aminobutyric acid type 0.808 0.091 0.596 2e-34
357621275 1485 hypothetical protein KGM_22272 [Danaus p 0.815 0.080 0.596 3e-34
383856316 1343 PREDICTED: gamma-aminobutyric acid type 0.808 0.087 0.579 3e-34
340717845 1348 PREDICTED: gamma-aminobutyric acid type 0.815 0.088 0.575 8e-34
322790653 249 hypothetical protein SINV_09913 [Solenop 0.904 0.530 0.540 2e-33
350421580 1348 PREDICTED: gamma-aminobutyric acid type 0.815 0.088 0.566 7e-33
>gi|242008075|ref|XP_002424838.1| class C metabotropic glutamate-like G-protein coupled receptor GPRgbb2, putative [Pediculus humanus corporis] gi|212508388|gb|EEB12100.1| class C metabotropic glutamate-like G-protein coupled receptor GPRgbb2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 4/120 (3%)

Query: 11  AHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRI 70
           AHN+L+A++   G  V+ + SF++E+S+AL+KLKE DVRIILGNFNE WA+ IFCEAY+ 
Sbjct: 191 AHNRLVADLDILGFQVVETQSFANEVSSALSKLKEKDVRIILGNFNESWAREIFCEAYKF 250

Query: 71  GMIGRKYQWLIIGMYSESWW----NGSLPCPIEELVTALDGCILTDLLPLSTSGEITVSG 126
           GM GRKYQWLI+G YS  WW      S  C +EEL  AL+GCILTDLLPLST+GEIT+SG
Sbjct: 251 GMYGRKYQWLIMGTYSNDWWLTSSYKSENCSMEELSEALEGCILTDLLPLSTNGEITISG 310

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328721858|ref|XP_001948944.2| PREDICTED: gamma-aminobutyric acid type B receptor subunit 2-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270008481|gb|EFA04929.1| hypothetical protein TcasGA2_TC014995 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189238494|ref|XP_969784.2| PREDICTED: similar to GA19799-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345491324|ref|XP_003426573.1| PREDICTED: gamma-aminobutyric acid type B receptor subunit 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357621275|gb|EHJ73162.1| hypothetical protein KGM_22272 [Danaus plexippus] Back     alignment and taxonomy information
>gi|383856316|ref|XP_003703655.1| PREDICTED: gamma-aminobutyric acid type B receptor subunit 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340717845|ref|XP_003397385.1| PREDICTED: gamma-aminobutyric acid type B receptor subunit 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322790653|gb|EFZ15437.1| hypothetical protein SINV_09913 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350421580|ref|XP_003492891.1| PREDICTED: gamma-aminobutyric acid type B receptor subunit 2-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
FB|FBgn0027575 1221 GABA-B-R2 "metabotropic GABA-B 0.808 0.096 0.525 1.2e-29
ZFIN|ZDB-GENE-060503-620 935 gabbr2 "gamma-aminobutyric aci 0.780 0.121 0.405 3.3e-17
UNIPROTKB|F1SSF1 467 F1SSF1 "Uncharacterized protei 0.780 0.244 0.4 1.4e-16
UNIPROTKB|F1NMD2 782 GABBR2 "Uncharacterized protei 0.780 0.145 0.410 2.9e-16
UNIPROTKB|F1MIZ5 835 GABBR2 "Uncharacterized protei 0.780 0.136 0.4 4.1e-16
UNIPROTKB|O75899 941 GABBR2 "Gamma-aminobutyric aci 0.780 0.121 0.4 5e-16
UNIPROTKB|E2R738 942 GABBR2 "Uncharacterized protei 0.780 0.121 0.4 5e-16
MGI|MGI:2386030 940 Gabbr2 "gamma-aminobutyric aci 0.780 0.121 0.383 2.8e-15
RGD|619864 940 Gabbr2 "gamma-aminobutyric aci 0.780 0.121 0.383 2.8e-15
UNIPROTKB|F1RYH7 577 LOC100738146 "Uncharacterized 0.746 0.188 0.321 5.6e-15
FB|FBgn0027575 GABA-B-R2 "metabotropic GABA-B receptor subtype 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 1.2e-29, P = 1.2e-29
 Identities = 63/120 (52%), Positives = 89/120 (74%)

Query:    12 HNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIG 71
             HN ++A++    ++V+ + SF ++++ +L KL+E DVRIILGNFNE +A+  FCEAY++ 
Sbjct:   187 HNHMVADLDAMEVEVVETQSFVNDVAESLKKLREKDVRIILGNFNEHFARKAFCEAYKLD 246

Query:    72 MIGRKYQWLIIGMYSESWWNGSLP--CPIEELVTALDGCILTDLLPLSTSGEITVSGIVS 129
             M GR YQWLI+  YS  WWN +    C +EE+ TAL+G IL DLLPLSTSG+ITV+GI +
Sbjct:   247 MYGRAYQWLIMATYSTDWWNVTQDSECSVEEIATALEGAILVDLLPLSTSGDITVAGITA 306
GO:0004965 "G-protein coupled GABA receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0031631 "negative regulation of synaptic vesicle fusion to presynaptic membrane" evidence=IDA
GO:0042048 "olfactory behavior" evidence=IDA
GO:0046676 "negative regulation of insulin secretion" evidence=IMP
ZFIN|ZDB-GENE-060503-620 gabbr2 "gamma-aminobutyric acid (GABA) B receptor, 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSF1 F1SSF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMD2 GABBR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIZ5 GABBR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75899 GABBR2 "Gamma-aminobutyric acid type B receptor subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R738 GABBR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2386030 Gabbr2 "gamma-aminobutyric acid (GABA) B receptor, 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619864 Gabbr2 "gamma-aminobutyric acid (GABA) B receptor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYH7 LOC100738146 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
cd06366350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 4e-22
cd06350348 cd06350, PBP1_GPCR_family_C_like, Ligand-binding d 3e-07
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 4e-05
pfam01094343 pfam01094, ANF_receptor, Receptor family ligand bi 4e-04
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information 
 Score = 89.6 bits (223), Expect = 4e-22
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 6/109 (5%)

Query: 18  EMLDSGIDVMVSHSFS-----DEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGM 72
            + ++GI++    +F      D+I+ AL KLKE D R+I+ +F+   A+ +FCEAY++GM
Sbjct: 158 ALQEAGIEISYRAAFPPSANDDDITDALKKLKEKDSRVIVVHFSPDLARRVFCEAYKLGM 217

Query: 73  IGRKYQWLIIGMYSESWWNGSLPCPIEELVTALDGCILTDLLPLSTSGE 121
           +G+ Y W++    S +WW+ S  C  EE++ A+ G I       ++S  
Sbjct: 218 MGKGYVWILTDWLSSNWWS-SSDCTDEEMLEAMQGVIGVRSYVPNSSMT 265

Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350
>gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
KOG1055|consensus 865 99.97
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 99.29
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 99.25
cd06391 400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 99.23
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 99.2
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 99.16
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 99.14
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 99.12
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 99.11
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 99.05
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 99.02
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 99.02
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 99.0
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 98.98
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 98.93
PF01094348 ANF_receptor: Receptor family ligand binding regio 98.87
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 98.86
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 98.74
cd06374 472 PBP1_mGluR_groupI Ligand binding domain of the gro 98.72
cd06390 364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 98.68
cd06362 452 PBP1_mGluR Ligand binding domain of the metabotrop 98.66
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 98.64
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 98.62
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 98.58
cd06365 469 PBP1_Pheromone_receptor Ligand-binding domain of t 98.56
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 98.53
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 98.43
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 98.4
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 98.39
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 98.37
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 98.36
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 98.35
cd06375 458 PBP1_mGluR_groupII Ligand binding domain of the gr 98.3
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 98.29
cd06376 463 PBP1_mGluR_groupIII Ligand-binding domain of the g 98.21
cd06364 510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 98.18
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 98.02
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 98.01
cd06338345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 97.65
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 97.49
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 97.42
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 97.41
cd06340347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 97.37
KOG4440|consensus 993 97.23
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 97.23
cd06327334 PBP1_SBP_like_1 Periplasmic solute-binding domain 97.11
KOG1053|consensus 1258 97.01
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 96.67
cd06334351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 96.65
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 96.64
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 96.47
PRK15404369 leucine ABC transporter subunit substrate-binding 96.43
cd06343362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 96.22
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 96.14
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 96.0
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 95.97
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 95.97
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 95.68
KOG1052|consensus 656 95.53
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 95.52
cd06357360 PBP1_AmiC Periplasmic binding domain of amidase (A 95.39
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 95.26
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 95.23
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 95.15
cd06358333 PBP1_NHase Type I periplasmic-binding protein of t 95.03
cd06335347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 94.52
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 94.44
KOG1056|consensus 878 94.3
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 94.23
cd06349340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 94.17
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 92.1
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 92.09
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 91.48
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 90.88
TIGR03669374 urea_ABC_arch urea ABC transporter, substrate-bind 89.86
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 88.6
cd06359333 PBP1_Nba_like Type I periplasmic binding component 88.17
cd06328333 PBP1_SBP_like_2 Periplasmic solute-binding domain 87.38
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 87.11
>KOG1055|consensus Back     alignment and domain information 
Probab=99.97  E-value=3.1e-31  Score=239.81  Aligned_cols=128  Identities=37%  Similarity=0.721  Sum_probs=124.6

Q ss_pred             hHHHhHHHHHHHHHhCCCeEEEeeecchhHHHHHHhhhcCCeEEEEEEccHHHHHHHHHHHHHcCCCCCCeEEEEeccCC
Q psy3581           7 LMYRAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYS   86 (146)
Q Consensus         7 ~fs~~~~~L~~~l~~~ni~v~~~~sf~~d~~~~l~~LK~~d~RIIi~~~~~~~a~~vfC~AYklgm~g~~YVWIl~gwy~   86 (146)
                      +|+..+++|+..+.+.+|++++.++|..||...+++|++.|+|||++.+++..|+++||+|||.+|||.+||||++|||.
T Consensus       193 ~f~~~~~dl~~~~~~~~ieiv~~qsf~~dp~~~vk~l~~~D~RiI~g~f~~~~Arkv~C~~Y~~~myg~ky~w~~~g~y~  272 (865)
T KOG1055|consen  193 VFSSTLNDLEARLKEAGIEIVFRQSFSSDPADSVKNLKRQDARIIVGLFYETEARKVFCEAYKERLYGRKYVWFLIGWYA  272 (865)
T ss_pred             hhcchHHHHHHhhhccccEEEEeeccccCHHHHHhhccccchhheeccchHhhhhHHHHhhchhhcccceeEEEEEEeec
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccCC---CCCCCHHHHHHhhcceeEeeecccCCCCCcceeccchhhhhh
Q psy3581          87 ESWWNG---SLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLS  134 (146)
Q Consensus        87 ~~Ww~~---~~~Ct~~qi~~a~~g~i~~~~~~~~~~~~~tiSG~T~~~~~~  134 (146)
                      ++||+.   +.+||.+||.+|++|+++++..|++.++.+||||+|+.+|+.
T Consensus       273 d~w~ev~~~~~~ctveem~~A~eg~~s~e~~pl~~~~~~tisg~T~~~~l~  323 (865)
T KOG1055|consen  273 DNWWEITHPSENCTVEEMTEAAEGHITTEFVMLSPANITTISGMTAQEFLE  323 (865)
T ss_pred             cchhhccCchhhhhHHHHHHHHhhheeeeeeccccccceeeccchhHHHHH
Confidence            999976   258999999999999999999999999999999999999987

>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>KOG1056|consensus Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
4f11_A 433 Crystal Structure Of The Extracellular Domain Of Hu 2e-18
>pdb|4F11|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Gaba(B) Receptor Gbr2 Length = 433 Back     alignment and structure 
Iteration: 1

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 66/121 (54%), Gaps = 6/121 (4%)
Query: 12  HNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIG 71
            N L   +    I++  + SFS++  T++ KLK  DVRIILG F++  A  +FC AY   
Sbjct: 171 RNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEEN 230
Query: 72  MIGRKYQWLIIGMYSESWWN------GSLPCPIEELVTALDGCILTDLLPLSTSGEITVS 125
           M G KYQW+I G Y  SWW        S  C  + L+ A++G I  D  PLS+    T+S
Sbjct: 231 MYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTIS 290
Query: 126 G 126
           G
Sbjct: 291 G 291

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 1e-23
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 7e-09
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 4e-08
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 9e-08
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 2e-07
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 2e-07
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 1e-06
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 8e-06
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 1e-05
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 3e-04
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
 Score = 94.2 bits (234), Expect = 1e-23
 Identities = 47/124 (37%), Positives = 65/124 (52%), Gaps = 6/124 (4%)

Query: 10  RAHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYR 69
              N L   +    I++  + SFS++  T++ KLK  DVRIILG F++  A  +FC AY 
Sbjct: 169 EVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYE 228

Query: 70  IGMIGRKYQWLIIGMYSESWWNGSLP------CPIEELVTALDGCILTDLLPLSTSGEIT 123
             M G KYQW+I G Y  SWW           C  + L+ A++G I  D  PLS+    T
Sbjct: 229 ENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKT 288

Query: 124 VSGI 127
           +SG 
Sbjct: 289 ISGK 292
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 99.64
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 99.12
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 98.93
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 98.93
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 98.86
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 98.76
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 98.73
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 98.64
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 98.59
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 98.57
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 98.52
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 98.5
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 98.03
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 97.94
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 97.9
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 97.61
4evq_A375 Putative ABC transporter subunit, substrate-bindi 97.38
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 97.37
3h5l_A 419 Putative branched-chain amino acid ABC transporter 97.35
1usg_A346 Leucine-specific binding protein; leucine-binding 97.34
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 97.3
3n0w_A379 ABC branched chain amino acid family transporter, 97.29
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 97.21
3td9_A366 Branched chain amino acid ABC transporter, peripl 97.04
3lkb_A 392 Probable branched-chain amino acid ABC transporter 96.97
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 96.97
3lop_A364 Substrate binding periplasmic protein; protein str 96.94
3hut_A358 Putative branched-chain amino acid ABC transporter 96.94
3ipc_A356 ABC transporter, substrate binding protein (amino; 96.65
4gnr_A353 ABC transporter substrate-binding protein-branche 96.63
1pea_A385 Amidase operon; gene regulator, receptor, binding 96.56
3i45_A387 Twin-arginine translocation pathway signal protei; 96.22
3snr_A362 Extracellular ligand-binding receptor; structural 95.66
3sg0_A386 Extracellular ligand-binding receptor; structural 95.49
3n0x_A374 Possible substrate binding protein of ABC transpo 90.92
3ckm_A327 YRAM (HI1655), LPOA; periplasmic-binding protein, 89.39
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
Probab=99.64  E-value=1.6e-15  Score=125.88  Aligned_cols=124  Identities=39%  Similarity=0.670  Sum_probs=111.8

Q ss_pred             hHHHHHHHHHhCCCeEEEeeecchhHHHHHHhhhcCCeEEEEEEccHHHHHHHHHHHHHcCCCCCCeEEEEeccCCCccc
Q psy3581          11 AHNKLLAEMLDSGIDVMVSHSFSDEISTALAKLKETDVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLIIGMYSESWW   90 (146)
Q Consensus        11 ~~~~L~~~l~~~ni~v~~~~sf~~d~~~~l~~LK~~d~RIIi~~~~~~~a~~vfC~AYklgm~g~~YVWIl~gwy~~~Ww   90 (146)
                      .++.+.+.+++.|++|+..+.+..|+..+|.+||++++|+|++..+...+..++|+|+++||.+++|+||.++++.+.||
T Consensus       170 ~~~~~~~~~~~~g~~v~~~~~~~~d~~~~l~~i~~~~~~vii~~~~~~~~~~~~~~a~~~g~~~~~~~~i~~~~~~~~~~  249 (433)
T 4f11_A          170 VRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWW  249 (433)
T ss_dssp             HHHHHHHHSSSSSCEEEEEEEESSCCHHHHHHHHHTTCCEEEEECCHHHHHHHHHHHHHTTCCSTTCEEEEESCSCTTTT
T ss_pred             HHHHHHHHHHHcCceEEEEeccCcCHHHHHHHHhhCCCeEEEEeCcHHHHHHHHHHHHHcCCCCCCeEEEEcCcchHhHh
Confidence            45678888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             C------CCCCCCHHHHHHhhcceeEeeecccCCCCCcceeccchhhhhh
Q psy3581          91 N------GSLPCPIEELVTALDGCILTDLLPLSTSGEITVSGIVSTVLLS  134 (146)
Q Consensus        91 ~------~~~~Ct~~qi~~a~~g~i~~~~~~~~~~~~~tiSG~T~~~~~~  134 (146)
                      .      ...+|+.+++.++++|++++.+++...+..+++++.++++|.+
T Consensus       250 ~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~f~~  299 (433)
T 4f11_A          250 EQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYER  299 (433)
T ss_dssp             TCC------CCSCHHHHHHHHTTCEEEEECSSCCCCCCCTTSCCHHHHHH
T ss_pred             cccccCCCCCCCCHHHHHHHHhCEEEEEEeecCCCCCcccCCCCHHHHHH
Confidence            5      3478999999999999999998776656667888899888876
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1ewka_ 477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 98.93
d1dp4a_ 425 Hormone binding domain of the atrial natriuretic p 98.27
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 98.1
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 97.37
d1qo0a_373 Amide receptor/negative regulator of the amidase o 94.62
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 88.67
d3ckma1317 YraM C-terminal domain {Haemophilus influenzae [Ta 82.2
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=98.93  E-value=1.5e-09  Score=89.85  Aligned_cols=81  Identities=14%  Similarity=0.148  Sum_probs=68.5

Q ss_pred             HhHHHHHHHHHhCCCeEEEeeecch-----hHHHHHHhhhcC--CeEEEEEEccHHHHHHHHHHHHHcCCCCCCeEEEEe
Q psy3581          10 RAHNKLLAEMLDSGIDVMVSHSFSD-----EISTALAKLKET--DVRIILGNFNEFWAKMIFCEAYRIGMIGRKYQWLII   82 (146)
Q Consensus        10 ~~~~~L~~~l~~~ni~v~~~~sf~~-----d~~~~l~~LK~~--d~RIIi~~~~~~~a~~vfC~AYklgm~g~~YVWIl~   82 (146)
                      ..++.|.++++++|+.|...+.|..     +....++.||++  ++||||+..++..++.+||+|+++||+|+.|+|+..
T Consensus       204 ~~~~~l~~~~~~~~i~v~~~~~i~~~~~~~~~~~~l~~l~~~~~~~rVIv~~~~~~~~~~ll~~a~~~g~~g~~~~i~~~  283 (477)
T d1ewka_         204 SGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSD  283 (477)
T ss_dssp             HHHHHHHHHHHHHTCEEEEEEEECTTCCHHHHHHHHHHHHTTTTTCCEEEEECCHHHHHHHHHHHHHHTCCSCCEEEECT
T ss_pred             HHHHHHHHHHHHcCcEEEEEeeccCCCchhhHHHHHHHHhhhccCceEEEEecCHHHHHHHHHHHHHcCccCCceEEEec
Confidence            4567899999999999999888853     567789999887  899999999999999999999999999987766666


Q ss_pred             ccCCCccc
Q psy3581          83 GMYSESWW   90 (146)
Q Consensus        83 gwy~~~Ww   90 (146)
                      +|....++
T Consensus       284 ~~~~~~~~  291 (477)
T d1ewka_         284 GWADRDEV  291 (477)
T ss_dssp             TTTTCHHH
T ss_pred             ccccchhh
Confidence            66655443
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure