Psyllid ID: psy3701


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MLAHPLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPGNY
cccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccc
mlahplslqellggegvsfFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLigrsdparrflgkatsldklflpawlmyghsfavenEHDQAMAAYFNAFNlfkgchlpaLYVGlecgltnnaRLASKFFDLALsiahedpfvihEMGVIAYQNHNYTVAENCFMEALSKVKQLGgeiiadkwepllnnlghkaEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIeesppfpgny
MLAHPLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQlieesppfpgny
MLAHPLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPGNY
********QELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLI**********
****PLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEES*PFPGNY
MLAHPLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPGNY
**AHPLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFP*NY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAHPLSLQELLGGEGVSFFCWFSQLQSEMKSALLLLKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLLNNxxxxxxxxxxxxxxxxxxxxxLVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPGNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query342 2.2.26 [Sep-21-2011]
Q13042620 Cell division cycle prote yes N/A 0.736 0.406 0.539 4e-86
Q8R349620 Cell division cycle prote yes N/A 0.736 0.406 0.542 4e-86
B3DNN5543 Anaphase-promoting comple yes N/A 0.690 0.434 0.374 6e-46
Q1ZXE6865 Anaphase-promoting comple yes N/A 0.713 0.282 0.345 2e-40
P41889671 Anaphase-promoting comple yes N/A 0.698 0.356 0.302 2e-34
P09798840 Anaphase-promoting comple yes N/A 0.695 0.283 0.322 5e-32
Q4V8A2824 Cell division cycle prote no N/A 0.599 0.248 0.231 5e-05
A2A6Q5825 Cell division cycle prote no N/A 0.599 0.248 0.231 6e-05
A7Z061825 Cell division cycle prote no N/A 0.599 0.248 0.231 6e-05
P30260824 Cell division cycle prote no N/A 0.599 0.248 0.231 6e-05
>sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens GN=CDC16 PE=1 SV=2 Back     alignment and function desciption
 Score =  318 bits (815), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 151/280 (53%), Positives = 200/280 (71%), Gaps = 28/280 (10%)

Query: 62  DLFKLAHELVDLYPDSAIAWYAVGCYYYLIG-RSDPARRFLGKATSLDKLFLPAWLMYGH 120
           +LF L+H+LVDLYP + ++W+AVGCYY ++G +++ ARR+L KAT+L+K + PAW+ YGH
Sbjct: 283 ELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGH 342

Query: 121 SFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDP 180
           SFAVE+EHDQAMAAYF A  L KGCHLP LY+GLE GLTNN++LA +FF  ALSIA EDP
Sbjct: 343 SFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDP 402

Query: 181 FVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQL 240
           FV+HE+GV+A+QN  +  AE  F++AL K+K +G E+  DKWEPLLN             
Sbjct: 403 FVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLN------------- 449

Query: 241 GGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDL 300
                         NLGHV RKLKKY EAL++H+QALV+ P  AST+  IGYI +L G+ 
Sbjct: 450 --------------NLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNF 495

Query: 301 DSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPG 340
           ++AV+YFH  + L+RDD+F+ TML + IE  I +S  + G
Sbjct: 496 ENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIG 535




Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Homo sapiens (taxid: 9606)
>sp|Q8R349|CDC16_MOUSE Cell division cycle protein 16 homolog OS=Mus musculus GN=Cdc16 PE=2 SV=1 Back     alignment and function description
>sp|B3DNN5|CDC16_ARATH Anaphase-promoting complex subunit 6 OS=Arabidopsis thaliana GN=APC6 PE=2 SV=1 Back     alignment and function description
>sp|Q1ZXE6|CDC16_DICDI Anaphase-promoting complex subunit 6 OS=Dictyostelium discoideum GN=anapc6 PE=3 SV=1 Back     alignment and function description
>sp|P41889|CUT9_SCHPO Anaphase-promoting complex subunit cut9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut9 PE=1 SV=2 Back     alignment and function description
>sp|P09798|CDC16_YEAST Anaphase-promoting complex subunit CDC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC16 PE=1 SV=1 Back     alignment and function description
>sp|Q4V8A2|CDC27_RAT Cell division cycle protein 27 homolog OS=Rattus norvegicus GN=Cdc27 PE=2 SV=1 Back     alignment and function description
>sp|A2A6Q5|CDC27_MOUSE Cell division cycle protein 27 homolog OS=Mus musculus GN=Cdc27 PE=1 SV=1 Back     alignment and function description
>sp|A7Z061|CDC27_BOVIN Cell division cycle protein 27 homolog OS=Bos taurus GN=CDC27 PE=2 SV=1 Back     alignment and function description
>sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens GN=CDC27 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
383856906 640 PREDICTED: cell division cycle protein 1 0.730 0.390 0.597 3e-92
340713132 651 PREDICTED: cell division cycle protein 1 0.733 0.385 0.591 2e-91
350417067 639 PREDICTED: cell division cycle protein 1 0.733 0.392 0.591 3e-91
380015507 640 PREDICTED: cell division cycle protein 1 0.728 0.389 0.595 7e-91
328777568 640 PREDICTED: cell division cycle protein 1 0.728 0.389 0.592 2e-90
189241787 630 PREDICTED: similar to CDC16 cell divisio 0.733 0.398 0.582 4e-89
47220146 453 unnamed protein product [Tetraodon nigro 0.839 0.633 0.488 7e-89
307212645 568 Cell division cycle protein 16-like prot 0.736 0.443 0.578 9e-89
443723207 608 hypothetical protein CAPTEDRAFT_173883 [ 0.736 0.414 0.564 1e-88
156551107 633 PREDICTED: cell division cycle protein 1 0.730 0.394 0.571 8e-88
>gi|383856906|ref|XP_003703947.1| PREDICTED: cell division cycle protein 16 homolog [Megachile rotundata] Back     alignment and taxonomy information
 Score =  344 bits (883), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 166/278 (59%), Positives = 200/278 (71%), Gaps = 28/278 (10%)

Query: 63  LFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSF 122
           LF LAH+LVDLYPD A+AW+AVGCYYY IG+SDPARR+L KAT+LD+LF PAWL YGHSF
Sbjct: 295 LFYLAHKLVDLYPDMALAWFAVGCYYYSIGKSDPARRYLAKATALDRLFGPAWLAYGHSF 354

Query: 123 AVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFV 182
           AVENEHDQAMAAYF A  L KGCHLP LY+GLECGLTNN +LA KFF  A  IA  DPFV
Sbjct: 355 AVENEHDQAMAAYFKASQLMKGCHLPLLYIGLECGLTNNLKLADKFFQQAQGIASNDPFV 414

Query: 183 IHEMGVIAYQNHNYTVAENCFMEALSKVK-QLGGEIIADKWEPLLNNLGHKAEDKVKQLG 241
           IHEMGVI++ N +Y  AE  F EA+ +++  L   I+  KWE LLNNLGH          
Sbjct: 415 IHEMGVISFYNLDYKTAERQFKEAMKRIQGGLKDVILPSKWEALLNNLGHTC-------- 466

Query: 242 GEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLD 301
                              RK+KKYEEALE+H+QALV+ P+  ST+  +G+I AL G+  
Sbjct: 467 -------------------RKMKKYEEALEYHQQALVLNPLNPSTYSAVGFIHALMGNTQ 507

Query: 302 SAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFP 339
            AV+ FH+ + L+RDD+F TTML+YV+EQLIEESPP+P
Sbjct: 508 EAVDAFHRALGLRRDDTFTTTMLTYVMEQLIEESPPYP 545




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340713132|ref|XP_003395102.1| PREDICTED: cell division cycle protein 16 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417067|ref|XP_003491240.1| PREDICTED: cell division cycle protein 16 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|380015507|ref|XP_003691742.1| PREDICTED: cell division cycle protein 16 homolog [Apis florea] Back     alignment and taxonomy information
>gi|328777568|ref|XP_623316.2| PREDICTED: cell division cycle protein 16 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|189241787|ref|XP_969759.2| PREDICTED: similar to CDC16 cell division cycle 16 homolog (S. cerevisiae) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|47220146|emb|CAG07287.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|307212645|gb|EFN88348.1| Cell division cycle protein 16-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|443723207|gb|ELU11738.1| hypothetical protein CAPTEDRAFT_173883 [Capitella teleta] Back     alignment and taxonomy information
>gi|156551107|ref|XP_001603275.1| PREDICTED: cell division cycle protein 16 homolog [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
MGI|MGI:1917207620 Cdc16 "CDC16 cell division cyc 0.792 0.437 0.459 1.1e-70
RGD|1305076620 Cdc16 "cell division cycle 16" 0.792 0.437 0.459 1.1e-70
UNIPROTKB|Q13042620 CDC16 "Cell division cycle pro 0.792 0.437 0.456 1.8e-70
UNIPROTKB|Q7Z651526 CDC16 "CDC16 cell division cyc 0.792 0.515 0.456 1.8e-70
UNIPROTKB|E2R5H6620 CDC16 "Uncharacterized protein 0.792 0.437 0.456 1.8e-70
UNIPROTKB|F1P4A5623 CDC16 "Uncharacterized protein 0.710 0.390 0.472 2.3e-70
UNIPROTKB|E1BPM5620 CDC16 "Uncharacterized protein 0.792 0.437 0.456 2.3e-70
UNIPROTKB|I3L944620 CDC16 "Uncharacterized protein 0.792 0.437 0.456 2.3e-70
ZFIN|ZDB-GENE-051113-132616 cdc16 "cell division cycle 16 0.710 0.394 0.464 1.6e-67
FB|FBgn0025781719 Cdc16 "Cell division cycle 16 0.619 0.294 0.506 4.2e-61
MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 632 (227.5 bits), Expect = 1.1e-70, Sum P(2) = 1.1e-70
 Identities = 132/287 (45%), Positives = 190/287 (66%)

Query:    62 DLFKLAHELVDLYPDSAIAWYAVGCYYYLIG-RSDPARRFLGKATSLDKLFLPAWLMYGH 120
             +LF L+H+LVDLYP + ++W+AVGCYY ++G +++ ARR+L KAT+L+K + PAW+ YGH
Sbjct:   283 ELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGH 342

Query:   121 SFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDP 180
             SFAVE+EHDQAMAAYF A  L KGCHLP LY+GLE GLTNN++LA +FF  ALSIA EDP
Sbjct:   343 SFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDP 402

Query:   181 FVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQL 240
             FVIHE+GV+A+QN  +  AE  F++AL K+K +G E+  DKWEPLLNNLGH    K+K+ 
Sbjct:   403 FVIHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCR-KLKKY 461

Query:   241 GGEIIADKWEPLL--NN------LGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGY 292
                +   +   +L   N      +G+++  +  +E A+++   AL +      +   +G+
Sbjct:   462 AEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGH 521

Query:   293 -IQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPF 338
              I+   GD ++ +    K   LK  D    TM +  ++ +I  SPP+
Sbjct:   522 CIEMYIGDSEAYIGADIKDK-LKCYDFDVHTMKT--LKNII--SPPW 563


GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0005680 "anaphase-promoting complex" evidence=ISO
GO:0005813 "centrosome" evidence=ISO
GO:0005876 "spindle microtubule" evidence=ISO
GO:0007049 "cell cycle" evidence=IEA
GO:0007067 "mitosis" evidence=IEA
GO:0051301 "cell division" evidence=IEA
GO:0070979 "protein K11-linked ubiquitination" evidence=ISO
RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z651 CDC16 "CDC16 cell division cycle 16 homolog (S. cerevisiae), isoform CRA_h" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4A5 CDC16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L944 CDC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-132 cdc16 "cell division cycle 16 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0025781 Cdc16 "Cell division cycle 16 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8R349CDC16_MOUSENo assigned EC number0.54280.73680.4064yesN/A
Q13042CDC16_HUMANNo assigned EC number0.53920.73680.4064yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 8e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
 Score = 45.1 bits (107), Expect = 2e-06
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 252 LLNNLGHVNRKLKKYEEALEFHKQALVVA-------PMKASTFCCIGYIQALTGDLDSAV 304
            LNNL  V R+L  Y+EALE  ++AL +A       P  A     +  +    GD D A+
Sbjct: 7   ALNNLALVLRRLGDYDEALELLEKALELARELGEDHPETARALNNLARLYLALGDYDEAL 66

Query: 305 NYFHKTMALKRD 316
            Y  K +AL+  
Sbjct: 67  EYLEKALALREA 78


Length = 78

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
KOG4626|consensus 966 100.0
KOG4626|consensus 966 100.0
KOG1126|consensus638 100.0
KOG1173|consensus611 100.0
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.98
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
KOG1126|consensus638 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.97
KOG1155|consensus559 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11788389 tetratricopeptide repeat protein; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG0547|consensus606 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
KOG1155|consensus559 99.95
KOG0547|consensus606 99.95
PRK12370553 invasion protein regulator; Provisional 99.94
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.94
PRK11189296 lipoprotein NlpI; Provisional 99.94
KOG1129|consensus478 99.93
KOG0624|consensus 504 99.93
KOG1125|consensus579 99.93
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.93
KOG2002|consensus 1018 99.93
PRK12370553 invasion protein regulator; Provisional 99.93
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.92
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.92
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.91
KOG2076|consensus 895 99.91
KOG2002|consensus 1018 99.91
PRK11189296 lipoprotein NlpI; Provisional 99.91
KOG1173|consensus611 99.91
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.91
KOG2003|consensus 840 99.91
PLN02789320 farnesyltranstransferase 99.9
KOG0548|consensus539 99.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.9
PLN02789320 farnesyltranstransferase 99.89
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.88
PRK14574 822 hmsH outer membrane protein; Provisional 99.88
KOG1174|consensus564 99.88
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.88
KOG1129|consensus478 99.88
KOG0550|consensus 486 99.87
KOG1840|consensus508 99.87
KOG0495|consensus913 99.87
KOG1125|consensus579 99.86
KOG2076|consensus 895 99.86
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.86
KOG0548|consensus539 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.85
KOG0495|consensus913 99.85
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.85
KOG0624|consensus 504 99.84
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.84
KOG4162|consensus799 99.84
KOG1840|consensus508 99.83
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.83
KOG2003|consensus 840 99.83
KOG1156|consensus 700 99.82
KOG1174|consensus564 99.81
PRK15359144 type III secretion system chaperone protein SscB; 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.79
PRK15359144 type III secretion system chaperone protein SscB; 99.79
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.79
KOG4162|consensus799 99.78
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.78
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.77
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.77
PLN03218 1060 maturation of RBCL 1; Provisional 99.77
PRK10370198 formate-dependent nitrite reductase complex subuni 99.76
PLN03218 1060 maturation of RBCL 1; Provisional 99.76
KOG0550|consensus 486 99.75
KOG1127|consensus 1238 99.75
KOG1156|consensus 700 99.74
KOG1130|consensus 639 99.74
KOG3060|consensus289 99.72
KOG1127|consensus 1238 99.72
PRK10370198 formate-dependent nitrite reductase complex subuni 99.72
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.72
KOG1128|consensus 777 99.72
KOG3060|consensus289 99.72
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.71
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.71
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.71
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.71
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.7
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.7
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.69
PLN03077 857 Protein ECB2; Provisional 99.69
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.68
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.67
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.67
KOG0553|consensus304 99.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.66
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.65
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.63
KOG2376|consensus 652 99.63
KOG1130|consensus 639 99.62
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.61
KOG0553|consensus304 99.6
PLN03077 857 Protein ECB2; Provisional 99.6
KOG3785|consensus 557 99.59
KOG1128|consensus 777 99.56
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.56
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.52
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.51
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.51
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.48
KOG2376|consensus 652 99.47
KOG3785|consensus 557 99.47
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.44
KOG4340|consensus 459 99.43
KOG1915|consensus 677 99.42
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.42
PRK04841 903 transcriptional regulator MalT; Provisional 99.41
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.41
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.41
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.4
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.4
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.39
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.38
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.38
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.37
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.36
KOG1915|consensus 677 99.36
PRK11906458 transcriptional regulator; Provisional 99.36
KOG4340|consensus 459 99.34
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.33
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.33
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.33
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.33
PRK15331165 chaperone protein SicA; Provisional 99.32
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.32
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.32
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.32
PRK15331165 chaperone protein SicA; Provisional 99.32
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.31
KOG4648|consensus 536 99.31
KOG1070|consensus1710 99.31
KOG2047|consensus 835 99.3
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.3
PRK11906458 transcriptional regulator; Provisional 99.3
KOG3081|consensus299 99.29
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.29
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.28
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.27
KOG0543|consensus397 99.27
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.23
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.23
PRK04841 903 transcriptional regulator MalT; Provisional 99.22
KOG1941|consensus 518 99.22
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.21
KOG1941|consensus 518 99.21
KOG0543|consensus397 99.2
PRK10803263 tol-pal system protein YbgF; Provisional 99.19
PRK10803263 tol-pal system protein YbgF; Provisional 99.17
KOG2053|consensus 932 99.17
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.16
PF12688120 TPR_5: Tetratrico peptide repeat 99.16
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.12
KOG4234|consensus271 99.11
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.1
KOG3081|consensus299 99.1
COG3898 531 Uncharacterized membrane-bound protein [Function u 99.07
PF1337173 TPR_9: Tetratricopeptide repeat 99.07
PF12688120 TPR_5: Tetratrico peptide repeat 99.06
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.06
COG4700251 Uncharacterized protein conserved in bacteria cont 99.0
COG4700251 Uncharacterized protein conserved in bacteria cont 98.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.97
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.97
PF13512142 TPR_18: Tetratricopeptide repeat 98.96
KOG2047|consensus 835 98.96
KOG3617|consensus 1416 98.94
KOG4648|consensus 536 98.93
PF1337173 TPR_9: Tetratricopeptide repeat 98.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.93
PF13512142 TPR_18: Tetratricopeptide repeat 98.92
KOG1070|consensus1710 98.88
KOG2471|consensus 696 98.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.87
KOG4234|consensus271 98.87
KOG2796|consensus366 98.86
KOG1586|consensus288 98.84
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.81
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.81
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.81
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.79
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.77
KOG4555|consensus175 98.72
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.7
KOG4555|consensus175 98.69
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.67
KOG2610|consensus 491 98.66
KOG1585|consensus308 98.65
KOG4507|consensus 886 98.64
KOG2471|consensus 696 98.63
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.62
KOG2610|consensus 491 98.61
KOG2796|consensus366 98.6
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.58
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.57
PF1342844 TPR_14: Tetratricopeptide repeat 98.57
KOG3617|consensus 1416 98.56
PF1342844 TPR_14: Tetratricopeptide repeat 98.52
KOG1914|consensus 656 98.5
KOG2053|consensus 932 98.5
KOG4642|consensus284 98.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.5
KOG4642|consensus284 98.5
KOG1586|consensus288 98.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.43
KOG0545|consensus329 98.42
KOG0530|consensus318 98.42
KOG1585|consensus308 98.41
KOG0985|consensus 1666 98.4
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.39
PF1343134 TPR_17: Tetratricopeptide repeat 98.35
KOG3616|consensus 1636 98.32
PF1343134 TPR_17: Tetratricopeptide repeat 98.31
KOG2300|consensus629 98.3
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.29
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.28
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.25
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 98.24
KOG0551|consensus390 98.24
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 98.23
KOG0376|consensus 476 98.23
KOG0376|consensus 476 98.22
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.2
KOG0551|consensus 390 98.19
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.18
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.16
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.13
KOG0545|consensus329 98.13
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.04
KOG4507|consensus 886 98.03
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.03
KOG1914|consensus 656 97.96
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.93
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.9
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.89
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.88
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.85
KOG1550|consensus552 97.85
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.84
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.84
KOG0530|consensus318 97.84
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.84
KOG1308|consensus377 97.76
KOG0985|consensus 1666 97.75
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.74
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.74
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.72
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.7
KOG1308|consensus377 97.66
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.64
KOG1258|consensus 577 97.62
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.59
KOG1258|consensus577 97.58
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.58
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.56
KOG1464|consensus 440 97.56
KOG3616|consensus 1636 97.5
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.49
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.48
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.48
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.47
KOG1550|consensus552 97.45
PRK10941269 hypothetical protein; Provisional 97.44
KOG0890|consensus 2382 97.37
KOG3364|consensus149 97.36
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.34
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.33
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.33
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.31
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.29
KOG2300|consensus629 97.27
KOG2041|consensus 1189 97.26
KOG3824|consensus 472 97.21
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.2
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.18
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.15
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.15
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.11
KOG3824|consensus472 97.09
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.07
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 97.02
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.0
KOG2396|consensus 568 96.96
KOG3783|consensus546 96.93
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.92
KOG2041|consensus 1189 96.91
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.91
PRK10941269 hypothetical protein; Provisional 96.9
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.89
KOG2396|consensus 568 96.88
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.83
KOG0890|consensus 2382 96.83
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.82
KOG4814|consensus 872 96.81
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.78
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.76
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.73
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.72
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.56
KOG1839|consensus1236 96.54
KOG3364|consensus149 96.51
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.49
KOG2422|consensus 665 96.47
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.47
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.37
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.33
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.33
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.29
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.27
KOG3783|consensus546 96.26
KOG1839|consensus1236 96.25
COG5191435 Uncharacterized conserved protein, contains HAT (H 96.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.22
KOG1538|consensus 1081 96.19
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.06
KOG2422|consensus665 96.01
KOG1310|consensus 758 96.0
KOG1310|consensus758 95.94
KOG4814|consensus 872 95.92
KOG1464|consensus 440 95.91
COG5191435 Uncharacterized conserved protein, contains HAT (H 95.84
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.84
COG2912269 Uncharacterized conserved protein [Function unknow 95.67
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.61
KOG3807|consensus 556 95.53
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.36
KOG0529|consensus 421 95.32
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.31
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.24
KOG0529|consensus421 95.04
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.94
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.87
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.7
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.64
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 94.58
COG3629280 DnrI DNA-binding transcriptional activator of the 94.51
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 94.5
COG2912269 Uncharacterized conserved protein [Function unknow 94.49
KOG2581|consensus 493 94.48
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.47
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.28
COG3629280 DnrI DNA-binding transcriptional activator of the 94.23
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.03
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.99
KOG2114|consensus 933 93.9
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.88
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 93.63
COG4455 273 ImpE Protein of avirulence locus involved in tempe 93.6
KOG3807|consensus 556 93.45
COG5159 421 RPN6 26S proteasome regulatory complex component [ 93.43
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.36
PRK11619 644 lytic murein transglycosylase; Provisional 92.98
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.93
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 92.92
COG4941415 Predicted RNA polymerase sigma factor containing a 92.88
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.72
KOG0546|consensus372 92.49
KOG1538|consensus 1081 92.04
COG3947361 Response regulator containing CheY-like receiver a 91.99
COG3947361 Response regulator containing CheY-like receiver a 91.99
KOG1463|consensus411 91.7
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.4
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 91.23
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 91.22
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 91.18
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 91.03
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 90.87
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 90.75
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.39
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.25
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.24
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.01
smart00299140 CLH Clathrin heavy chain repeat homology. 89.85
PF1285434 PPR_1: PPR repeat 89.77
PF1304150 PPR_2: PPR repeat family 89.66
PF1285434 PPR_1: PPR repeat 89.6
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.58
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 89.33
COG5159 421 RPN6 26S proteasome regulatory complex component [ 89.2
PF1304150 PPR_2: PPR repeat family 88.82
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 88.72
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 88.49
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 88.36
KOG2063|consensus 877 88.23
KOG0546|consensus372 87.38
COG4941415 Predicted RNA polymerase sigma factor containing a 86.78
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 86.77
KOG2581|consensus493 86.37
KOG1463|consensus 411 86.17
KOG4014|consensus248 85.99
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 85.29
COG5187412 RPN7 26S proteasome regulatory complex component, 85.13
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 85.07
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 84.19
KOG4279|consensus 1226 83.88
KOG4151|consensus 748 83.85
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 82.76
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 82.55
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 82.36
KOG0276|consensus794 81.45
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.33
KOG4279|consensus 1226 80.83
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 80.24
>KOG4626|consensus Back     alignment and domain information
Probab=100.00  E-value=8.6e-37  Score=253.00  Aligned_cols=290  Identities=18%  Similarity=0.158  Sum_probs=259.7

Q ss_pred             HHHHhHHHHhhccHHHHHHHHHHHHH----------------------HHHHHHHHHHHhcCCCcHHHHHHHHHHHHHhC
Q psy3701          35 LLLKGRVYEALENRALAADCYKGALL----------------------ADLFKLAHELVDLYPDSAIAWYAVGCYYYLIG   92 (342)
Q Consensus        35 ~~~~g~~~~~~~~~~~A~~~~~~~~~----------------------~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~~   92 (342)
                      ...+|...-..|+.++|..+|.+++.                      ..++..|+++++.+|+.+++|+++|.+|...+
T Consensus       187 ~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~  266 (966)
T KOG4626|consen  187 RSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEAR  266 (966)
T ss_pred             hcchhHHHHhhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHh
Confidence            33578888888888888888888772                      56778888889999999999999999999999


Q ss_pred             ChHHHHHHHHHHhhcCCCcHHHHHHhhhHHHhhccHHHHHHHHHHHhccCCCCchHHHHHHHHHhhhCCHHHHHHHHHHH
Q psy3701          93 RSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLA  172 (342)
Q Consensus        93 ~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~  172 (342)
                      .+++|+.+|.+|+.+.|++..++.++|.+|..+|..+-|+..|++++++.|..+.++.++|..+...|+..+|..+|.++
T Consensus       267 ~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnka  346 (966)
T KOG4626|consen  267 IFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKA  346 (966)
T ss_pred             cchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhCCCChHHHHHHHHHHHHhcChhHHHHHHHHHHHhhhhcCccccccchhhHHHHhhh------hHHHHHHHhch-hcc
Q psy3701         173 LSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGH------KAEDKVKQLGG-EII  245 (342)
Q Consensus       173 ~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~-~~~  245 (342)
                      +.+.|..+++.+++|.++.++|.+++|...|.++++..|...         ...++++.      .+.+++..+.. ..+
T Consensus       347 L~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~a---------aa~nNLa~i~kqqgnl~~Ai~~YkealrI  417 (966)
T KOG4626|consen  347 LRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFA---------AAHNNLASIYKQQGNLDDAIMCYKEALRI  417 (966)
T ss_pred             HHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhh---------hhhhhHHHHHHhcccHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999874         33344443      23355555554 678


Q ss_pred             CCCChHHHHHHHHHHHHhhhHHHHHHHHHHHHhhCCCchHHHHHHHHHHHHhCChHHHHHHHHHHHhcccCchhHHhHHH
Q psy3701         246 ADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLS  325 (342)
Q Consensus       246 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~  325 (342)
                      .|..++++.++|+.|..+|+.+.|+..|.+++..+|...+++.++|.+|...|+..+|+..|+.++.+.||.++++.++.
T Consensus       418 ~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNll  497 (966)
T KOG4626|consen  418 KPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLL  497 (966)
T ss_pred             CchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             HHHHHhhh
Q psy3701         326 YVIEQLIE  333 (342)
Q Consensus       326 ~~~~~~~~  333 (342)
                      .+++-..+
T Consensus       498 h~lq~vcd  505 (966)
T KOG4626|consen  498 HCLQIVCD  505 (966)
T ss_pred             HHHHHHhc
Confidence            88765543



>KOG4626|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>KOG4014|consensus Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3hym_B330 Insights Into Anaphase Promoting Complex Tpr Subdom 2e-84
2xpi_A597 Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 1e-35
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-05
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 5e-05
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 6e-05
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 7e-05
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 8e-05
>pdb|3HYM|B Chain B, Insights Into Anaphase Promoting Complex Tpr Subdomain Assembly From A Cdc26-Apc6 Structure Length = 330 Back     alignment and structure

Iteration: 1

Score = 309 bits (791), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 149/280 (53%), Positives = 196/280 (70%), Gaps = 28/280 (10%) Query: 62 DLFKLAHELVDLYPDSAIAWYAVGCYYYLIG-RSDPARRFLGKATSLDKLFLPAWLMYGH 120 +LF L+H+LVDLYP + ++W+AVGCYY +G +++ ARR+L KAT+L+K + PAW+ YGH Sbjct: 74 ELFYLSHKLVDLYPSNPVSWFAVGCYYLXVGHKNEHARRYLSKATTLEKTYGPAWIAYGH 133 Query: 121 SFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDP 180 SFAVE+EHDQA AAYF A L KGCHLP LY+GLE GLTNN++LA +FF ALSIA EDP Sbjct: 134 SFAVESEHDQAXAAYFTAAQLXKGCHLPXLYIGLEYGLTNNSKLAERFFSQALSIAPEDP 193 Query: 181 FVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQL 240 FV HE+GV+A+QN + AE F++AL K+K +G E+ DKWEPLLN Sbjct: 194 FVXHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLN------------- 240 Query: 241 GGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDL 300 NLGHV RKLKKY EAL++H+QALV+ P AST+ IGYI +L G+ Sbjct: 241 --------------NLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLXGNF 286 Query: 301 DSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPG 340 ++AV+YFH + L+RDD+F+ T L + IE I +S + G Sbjct: 287 ENAVDYFHTALGLRRDDTFSVTXLGHCIEXYIGDSEAYIG 326
>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-65
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-13
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-12
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-12
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-09
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-09
2gw1_A 514 Mitochondrial precursor proteins import receptor; 4e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 9e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-11
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-11
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-07
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-11
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-11
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 5e-07
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 8e-07
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-11
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-08
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-10
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-10
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 1e-09
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 9e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-07
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-06
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-05
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-04
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
 Score =  216 bits (551), Expect = 4e-68
 Identities = 151/282 (53%), Positives = 200/282 (70%), Gaps = 28/282 (9%)

Query: 60  LADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGR-SDPARRFLGKATSLDKLFLPAWLMY 118
             +LF L+H+LVDLYP + ++W+AVGCYY ++G  ++ ARR+L KAT+L+K + PAW+ Y
Sbjct: 72  ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAY 131

Query: 119 GHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHE 178
           GHSFAVE+EHDQAMAAYF A  L KGCHLP LY+GLE GLTNN++LA +FF  ALSIA E
Sbjct: 132 GHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE 191

Query: 179 DPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVK 238
           DPFV+HE+GV+A+QN  +  AE  F++AL                           +K+K
Sbjct: 192 DPFVMHEVGVVAFQNGEWKTAEKWFLDAL---------------------------EKIK 224

Query: 239 QLGGEIIADKWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTG 298
            +G E+  DKWEPLLNNLGHV RKLKKY EAL++H+QALV+ P  AST+  IGYI +L G
Sbjct: 225 AIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMG 284

Query: 299 DLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLIEESPPFPG 340
           + ++AV+YFH  + L+RDD+F+ TML + IE  I +S  + G
Sbjct: 285 NFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIG 326


>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 100.0
4eqf_A365 PEX5-related protein; accessory protein, tetratric 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 100.0
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 100.0
3u4t_A272 TPR repeat-containing protein; structural genomics 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 100.0
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.98
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.98
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.97
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.97
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.97
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.97
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.97
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.97
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.97
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.96
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.96
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.96
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.96
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.96
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.96
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.96
3u4t_A272 TPR repeat-containing protein; structural genomics 99.96
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.95
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.95
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.95
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.95
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.95
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.95
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.95
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.94
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.94
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.94
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.94
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.93
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.93
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.93
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.93
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.92
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.92
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.91
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.91
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.91
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.91
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.91
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.91
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.91
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.91
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.9
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.9
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.88
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.88
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.88
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.88
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.87
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.87
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.87
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.87
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.86
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.85
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.85
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.84
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.84
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.84
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.83
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.83
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.83
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.83
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.82
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.82
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.82
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.81
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.8
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.8
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.8
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.8
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.79
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.79
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.78
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.78
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.78
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.78
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.76
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.76
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.75
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.75
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.75
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.75
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.74
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.74
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.74
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.74
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.73
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.73
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.73
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.73
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.73
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.72
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.72
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.72
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.71
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.71
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.71
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.7
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.7
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.7
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.7
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.68
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.68
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.68
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.65
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.65
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.65
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.64
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.64
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.63
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.63
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.63
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.63
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.62
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.61
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.6
3k9i_A117 BH0479 protein; putative protein binding protein, 99.6
3k9i_A117 BH0479 protein; putative protein binding protein, 99.59
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.58
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.58
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.58
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.55
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.55
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.44
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.41
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.4
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.39
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 99.38
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.38
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.37
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.3
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.27
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.27
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.26
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.22
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.22
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.22
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.19
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.14
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.11
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.1
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.0
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.96
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.91
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.86
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.82
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.81
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.78
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.74
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.73
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.62
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.58
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.48
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.34
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.25
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.23
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.07
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.82
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.79
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.68
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.4
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.23
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.14
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.99
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.97
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.93
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.91
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.89
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.84
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.68
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.65
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.61
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.58
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 96.55
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.54
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.54
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.46
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.44
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 96.35
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.3
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.09
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 96.03
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.94
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.72
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 95.41
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.01
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.28
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 91.79
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 90.89
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 89.6
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.16
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 83.54
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 83.5
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 83.1
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 82.24
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.8e-35  Score=252.75  Aligned_cols=298  Identities=17%  Similarity=0.179  Sum_probs=217.1

Q ss_pred             HHHHHHHHhHHHHhhccHHHHHHHHHHHH----------------------HHHHHHHHHHHHhcCCCcHHHHHHHHHHH
Q psy3701          31 KSALLLLKGRVYEALENRALAADCYKGAL----------------------LADLFKLAHELVDLYPDSAIAWYAVGCYY   88 (342)
Q Consensus        31 ~~~~~~~~g~~~~~~~~~~~A~~~~~~~~----------------------~~~a~~~~~~~~~~~p~~~~~~~~l~~~~   88 (342)
                      ....++.+|.++...|++++|+..|++++                      +++|...+++++..+|++..++..+|.++
T Consensus        66 ~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~  145 (388)
T 1w3b_A           66 LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL  145 (388)
T ss_dssp             CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHH
Confidence            45577788888999999999998888875                      14566667777777777777777777777


Q ss_pred             HHhCChHHHHHHHHHHhhcCCCcHHHHHHhhhHHHhhccHHHHHHHHHHHhccCCCCchHHHHHHHHHhhhCCHHHHHHH
Q psy3701          89 YLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMAAYFNAFNLFKGCHLPALYVGLECGLTNNARLASKF  168 (342)
Q Consensus        89 ~~~~~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~l~~~~~~~~~~~~A~~~  168 (342)
                      ...|++++|+..|++++..+|+++.+|..+|.++...|++++|+..|+++++.+|++..++..+|.++...|++++|+..
T Consensus       146 ~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~  225 (388)
T 1w3b_A          146 KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA  225 (388)
T ss_dssp             HTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHH
T ss_pred             HHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHH
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHHhhCCCChHHHHHHHHHHHHhcChhHHHHHHHHHHHhhhhcCccccccchhhHHHHhhhhHHHHHHHhch-hccCC
Q psy3701         169 FDLALSIAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGG-EIIAD  247 (342)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~  247 (342)
                      +++++..+|+++.++..+|.++...|++++|+..|+++++.+|.++..  .......+...|+ ..++...+.. ....|
T Consensus       226 ~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~--~~~l~~~~~~~g~-~~~A~~~~~~al~~~p  302 (388)
T 1w3b_A          226 YLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDA--YCNLANALKEKGS-VAEAEDCYNTALRLCP  302 (388)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHH--HHHHHHHHHHHSC-HHHHHHHHHHHHHHCT
T ss_pred             HHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHH--HHHHHHHHHHcCC-HHHHHHHHHHHHhhCc
Confidence            777777777777777777777777777777777777777777765310  0001111122222 2233333333 33456


Q ss_pred             CChHHHHHHHHHHHHhhhHHHHHHHHHHHHhhCCCchHHHHHHHHHHHHhCChHHHHHHHHHHHhcccCchhHHhHHHHH
Q psy3701         248 KWEPLLNNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYV  327 (342)
Q Consensus       248 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~  327 (342)
                      ....++..+|.++...|++++|+..++++++..|++..++..+|.++...|++++|+..|+++++++|+++.++..++.+
T Consensus       303 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~  382 (388)
T 1w3b_A          303 THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNT  382 (388)
T ss_dssp             TCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHHHH
Confidence            66778888888888888888888888888888888888888888888888888888888888888888888888888887


Q ss_pred             HHHh
Q psy3701         328 IEQL  331 (342)
Q Consensus       328 ~~~~  331 (342)
                      +...
T Consensus       383 ~~~~  386 (388)
T 1w3b_A          383 LKEM  386 (388)
T ss_dssp             HHHT
T ss_pred             HHHc
Confidence            7654



>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 342
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-09
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 9e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.3 bits (181), Expect = 2e-15
 Identities = 49/258 (18%), Positives = 93/258 (36%), Gaps = 36/258 (13%)

Query: 74  YPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWLMYGHSFAVENEHDQAMA 133
            P+ A+AW  +GC +   G    A     KA +LD  FL A++  G+        D+A+A
Sbjct: 165 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVA 224

Query: 134 AYFNAFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALSIAHEDPFVIHEMGVIAYQN 193
           AY  A +L     +    +           LA   +  A+ +    P     +     + 
Sbjct: 225 AYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEK 284

Query: 194 HNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGGEIIADKWEPLL 253
            +   AE+C+  AL                                             L
Sbjct: 285 GSVAEAEDCYNTALRLCPT------------------------------------HADSL 308

Query: 254 NNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMAL 313
           NNL ++ R+    EEA+  +++AL V P  A+    +  +    G L  A+ ++ + + +
Sbjct: 309 NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI 368

Query: 314 KRDDSFATTMLSYVIEQL 331
               + A + +   ++++
Sbjct: 369 SPTFADAYSNMGNTLKEM 386


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.96
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.94
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.93
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.85
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.83
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.82
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.8
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.79
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.78
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.77
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.76
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.74
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.72
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.72
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.71
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.71
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.7
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.68
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.66
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.66
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.65
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.64
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.64
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.63
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.61
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.6
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.52
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.46
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.45
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.44
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.37
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.31
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.24
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.19
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.07
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.94
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.62
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.56
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.55
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.29
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.88
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.07
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.15
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.3e-35  Score=247.55  Aligned_cols=281  Identities=15%  Similarity=0.134  Sum_probs=203.7

Q ss_pred             HHhHHHHhhccHHHHHHHHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHhCChHHHHHHHHHHhhcCCCcHHHHH
Q psy3701          37 LKGRVYEALENRALAADCYKGALLADLFKLAHELVDLYPDSAIAWYAVGCYYYLIGRSDPARRFLGKATSLDKLFLPAWL  116 (342)
Q Consensus        37 ~~g~~~~~~~~~~~A~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~  116 (342)
                      .+|..++..|++++|+..|++++            +.+|+++.++..+|.++...|++++|+..|+++++.+|+++.++.
T Consensus         4 ~la~~~~~~G~~~~A~~~~~~~l------------~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~   71 (388)
T d1w3ba_           4 ELAHREYQAGDFEAAERHCMQLW------------RQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYS   71 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHH------------HHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHH------------HhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHH
Confidence            46788888999999999998864            556666666666666666666666666666666666666666666


Q ss_pred             HhhhHHHhhccHHHHHHHHHH-----------------------------------------------------------
Q psy3701         117 MYGHSFAVENEHDQAMAAYFN-----------------------------------------------------------  137 (342)
Q Consensus       117 ~la~~~~~~g~~~~A~~~~~~-----------------------------------------------------------  137 (342)
                      .+|.++...|++++|+..+.+                                                           
T Consensus        72 ~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  151 (388)
T d1w3ba_          72 NLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRL  151 (388)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCH
T ss_pred             HHHHHhhhhccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchh
Confidence            666666555555555555544                                                           


Q ss_pred             -------------------------------------------HhccCCCCchHHHHHHHHHhhhCCHHHHHHHHHHHHh
Q psy3701         138 -------------------------------------------AFNLFKGCHLPALYVGLECGLTNNARLASKFFDLALS  174 (342)
Q Consensus       138 -------------------------------------------al~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~  174 (342)
                                                                 +++.+|++..++..+|.++...|++++|+..++++..
T Consensus       152 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~  231 (388)
T d1w3ba_         152 EEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALS  231 (388)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHH
T ss_pred             hhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHH
Confidence                                                       4444566666666666666666777777777777776


Q ss_pred             hCCCChHHHHHHHHHHHHhcChhHHHHHHHHHHHhhhhcCccccccchhhHHHHhhhhHHHHHHHhch-hccCCCChHHH
Q psy3701         175 IAHEDPFVIHEMGVIAYQNHNYTVAENCFMEALSKVKQLGGEIIADKWEPLLNNLGHKAEDKVKQLGG-EIIADKWEPLL  253 (342)
Q Consensus       175 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  253 (342)
                      ..|..+..+..+|.++...|++++|+..|+++++++|+++...  .....++...++. .++...+.. ....|.....+
T Consensus       232 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~--~~l~~~~~~~~~~-~~A~~~~~~~~~~~~~~~~~~  308 (388)
T d1w3ba_         232 LSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAY--CNLANALKEKGSV-AEAEDCYNTALRLCPTHADSL  308 (388)
T ss_dssp             HCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHH--HHHHHHHHHHSCH-HHHHHHHHHHHHHCTTCHHHH
T ss_pred             HhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHH--HHHHHHHHHcCCH-HHHHHHHHhhhccCCccchhh
Confidence            6777777777777777777777777777777777777663100  0011122222222 233333333 44567778899


Q ss_pred             HHHHHHHHHhhhHHHHHHHHHHHHhhCCCchHHHHHHHHHHHHhCChHHHHHHHHHHHhcccCchhHHhHHHHHHHHhh
Q psy3701         254 NNLGHVNRKLKKYEEALEFHKQALVVAPMKASTFCCIGYIQALTGDLDSAVNYFHKTMALKRDDSFATTMLSYVIEQLI  332 (342)
Q Consensus       254 ~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~  332 (342)
                      ..+|.++...|++++|+..|+++++.+|+++.++..+|.++..+|++++|+.+|+++++++|+++.++..|+.++.+++
T Consensus       309 ~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         309 NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             HHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTC
T ss_pred             hHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998765



>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure