Psyllid ID: psy3734

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MDFLKLTNLILILSEYSRTGSYSHHSAEDSPSELSDLNRMGVPSSGRGEEDVSEGEMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTGRKKDLVYRRIEVEIKFIPNDLVIFLTPS
cccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccc
ccHHHHccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHccccccccHEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
MDFLKLTNLILILSEysrtgsyshhsaedspselsdlnrmgvpssgrgeedvsegemedyaslpkrkqrryrttFTSFQLEELEKAFsrthypdvftstgsiavfkpfLLMKldlvknrpvqtyvaygtgrkkdLVYRRIEVEIKfipndlvifltps
MDFLKLTNLILILSEYSRTGSYSHHsaedspselsdlnRMGVPSSgrgeedvsegemedyaslpkrkqrryrTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKldlvknrpvqtyvaygtgrkkdlvYRRIEVeikfipndlvifltps
MDFLKLTNLILILSEYSRTGSYSHHSAEDSPSELSDLNRMGVPSSGRGEEDVSEGEMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTGRKKDLVYRRIEVEIKFIPNDLVIFLTPS
**FLKLTNLILILSEY*******************************************************RTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTGRKKDLVYRRIEVEIKFIPNDLVIFL***
*************************************************************************TFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTG****************************
MDFLKLTNLILILSEYSR*****************DLNR**********************SLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTGRKKDLVYRRIEVEIKFIPNDLVIFLTPS
MDFLKLTNLILILSEY*****************************************************RYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTGRKKDLVYRRIEVE***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFLKLTNLILILSEYSRTGSYSHHSAEDSPSELSDLNRMGVPSSGRGEEDVSEGEMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGTGRKKDLVYRRIEVEIKFIPNDLVIFLTPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q06453 408 Homeobox protein aristale yes N/A 0.462 0.178 0.548 1e-15
O35085 564 Homeobox protein ARX OS=M yes N/A 0.322 0.090 0.616 1e-12
O42115 453 Aristaless-related homeob yes N/A 0.322 0.112 0.616 1e-12
Q26657327 Aristaless homeobox prote yes N/A 0.322 0.155 0.6 3e-12
A6YP92 566 Homeobox protein ARX OS=R yes N/A 0.310 0.086 0.631 5e-12
Q96QS3 562 Homeobox protein ARX OS=H yes N/A 0.310 0.087 0.631 5e-12
Q90277 341 Visual system homeobox 1 N/A N/A 0.563 0.260 0.37 2e-10
P23759 520 Paired box protein Pax-7 no N/A 0.265 0.080 0.697 1e-09
P47239 503 Paired box protein Pax-7 no N/A 0.265 0.083 0.697 1e-09
O42250 344 Visual system homeobox 1 no N/A 0.462 0.212 0.404 2e-09
>sp|Q06453|AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster GN=al PE=1 SV=2 Back     alignment and function desciption
 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 59/93 (63%), Gaps = 20/93 (21%)

Query: 41  GVPS-----SGRGEEDVSEG----EMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTH 91
           G PS     SG     VS+G    E ++YA  PKRKQRRYRTTFTSFQLEELEKAFSRTH
Sbjct: 51  GAPSGASGASGGTNSPVSDGNSDCEADEYA--PKRKQRRYRTTFTSFQLEELEKAFSRTH 108

Query: 92  YPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTY 124
           YPDVFT        +  L MK+ L + R +Q +
Sbjct: 109 YPDVFT--------REELAMKIGLTEAR-IQVW 132
Involved in the morphogenesis of proximal and distal pattern elements in a subset of appendages. Also has a role in early imaginal disk development.
Drosophila melanogaster (taxid: 7227)
>sp|O35085|ARX_MOUSE Homeobox protein ARX OS=Mus musculus GN=Arx PE=2 SV=3 Back     alignment and function description
>sp|O42115|ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio GN=arx PE=2 SV=1 Back     alignment and function description
>sp|Q26657|ALX_STRPU Aristaless homeobox protein (Fragment) OS=Strongylocentrotus purpuratus GN=ALX PE=2 SV=2 Back     alignment and function description
>sp|A6YP92|ARX_RAT Homeobox protein ARX OS=Rattus norvegicus GN=Arx PE=2 SV=1 Back     alignment and function description
>sp|Q96QS3|ARX_HUMAN Homeobox protein ARX OS=Homo sapiens GN=ARX PE=1 SV=1 Back     alignment and function description
>sp|Q90277|VSX1_CARAU Visual system homeobox 1 OS=Carassius auratus GN=vsx1 PE=1 SV=1 Back     alignment and function description
>sp|P23759|PAX7_HUMAN Paired box protein Pax-7 OS=Homo sapiens GN=PAX7 PE=2 SV=3 Back     alignment and function description
>sp|P47239|PAX7_MOUSE Paired box protein Pax-7 OS=Mus musculus GN=Pax7 PE=2 SV=2 Back     alignment and function description
>sp|O42250|VSX1_DANRE Visual system homeobox 1 OS=Danio rerio GN=vsx1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
332029859248 Homeobox protein aristaless [Acromyrmex 0.582 0.370 0.5 3e-16
194766533 405 GF20646 [Drosophila ananassae] gi|190617 0.386 0.150 0.625 3e-14
242024058 412 homeobox protein arx, putative [Pediculu 0.518 0.199 0.510 3e-14
195032675 376 GH11220 [Drosophila grimshawi] gi|193904 0.386 0.162 0.625 3e-14
424034 384 transcription factor with prd-type homeo 0.443 0.182 0.564 5e-14
195350083 410 GM16736 [Drosophila sechellia] gi|195575 0.462 0.178 0.548 6e-14
24580629 408 aristaless [Drosophila melanogaster] gi| 0.462 0.178 0.548 7e-14
290262 408 prd-like homeobox protein [Drosophila me 0.462 0.178 0.548 7e-14
383865116 261 PREDICTED: homeobox protein aristaless-l 0.386 0.233 0.625 8e-14
85719151 314 aristaless [Harmonia axyridis] 0.670 0.337 0.416 1e-13
>gi|332029859|gb|EGI69728.1| Homeobox protein aristaless [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 63/108 (58%), Gaps = 16/108 (14%)

Query: 53  SEGEMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMK 112
           SE E +D+A  PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT +G  A         
Sbjct: 150 SEAEADDFA--PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTRSGPAATV------- 200

Query: 113 LDLVKNRPVQTYVAYGTGRKKDLVYRRI-------EVEIKFIPNDLVI 153
             LV N   + Y   G   +  +VY +        E E K IPN+  +
Sbjct: 201 WVLVINEDGREYAERGEAGRVSVVYGQAKLEPNLSEEENKAIPNEFSV 248

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194766533|ref|XP_001965379.1| GF20646 [Drosophila ananassae] gi|190617989|gb|EDV33513.1| GF20646 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|242024058|ref|XP_002432447.1| homeobox protein arx, putative [Pediculus humanus corporis] gi|212517880|gb|EEB19709.1| homeobox protein arx, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195032675|ref|XP_001988540.1| GH11220 [Drosophila grimshawi] gi|193904540|gb|EDW03407.1| GH11220 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|424034|pir||A46403 transcription factor with prd-type homeo domain and Pro/ Gln-rich domain al - fruit fly (Drosophila melanogaster) Back     alignment and taxonomy information
>gi|195350083|ref|XP_002041571.1| GM16736 [Drosophila sechellia] gi|195575531|ref|XP_002077631.1| GD23020 [Drosophila simulans] gi|194123344|gb|EDW45387.1| GM16736 [Drosophila sechellia] gi|194189640|gb|EDX03216.1| GD23020 [Drosophila simulans] Back     alignment and taxonomy information
>gi|24580629|ref|NP_722629.1| aristaless [Drosophila melanogaster] gi|60416352|sp|Q06453.2|AL_DROME RecName: Full=Homeobox protein aristaless gi|7296213|gb|AAF51505.1| aristaless [Drosophila melanogaster] gi|21464440|gb|AAM52023.1| RE68460p [Drosophila melanogaster] gi|220942482|gb|ACL83784.1| al-PA [synthetic construct] gi|220952686|gb|ACL88886.1| al-PA [synthetic construct] Back     alignment and taxonomy information
>gi|290262|gb|AAA28840.1| prd-like homeobox protein [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|383865116|ref|XP_003708021.1| PREDICTED: homeobox protein aristaless-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|85719151|dbj|BAE78538.1| aristaless [Harmonia axyridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
FB|FBgn0000061 408 al "aristaless" [Drosophila me 0.329 0.127 0.724 6.9e-15
ZFIN|ZDB-GENE-990415-15 453 arxa "aristaless related homeo 0.537 0.187 0.473 5e-13
UNIPROTKB|I3LRI8 451 I3LRI8 "Uncharacterized protei 0.424 0.148 0.544 3.7e-12
UNIPROTKB|J9NW39 520 ARX "Uncharacterized protein" 0.424 0.128 0.544 4.8e-12
UNIPROTKB|Q96QS3 562 ARX "Homeobox protein ARX" [Ho 0.424 0.119 0.544 5.5e-12
UNIPROTKB|E2QVR4 564 ARX "Uncharacterized protein" 0.424 0.118 0.544 5.6e-12
MGI|MGI:1097716 564 Arx "aristaless related homeob 0.424 0.118 0.544 5.6e-12
RGD|1562672 566 Arx "aristaless related homeob 0.424 0.118 0.544 5.6e-12
UNIPROTKB|D4A5S8 566 Arx "Homeobox protein ARX" [Ra 0.424 0.118 0.544 5.6e-12
UNIPROTKB|F1LQW2 566 Arx "Homeobox protein ARX" [Ra 0.424 0.118 0.544 5.6e-12
FB|FBgn0000061 al "aristaless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 6.9e-15, P = 6.9e-15
 Identities = 42/58 (72%), Positives = 46/58 (79%)

Query:    44 SSGRGEEDVSEG----EMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT 97
             +SG     VS+G    E ++YA  PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT
Sbjct:    59 ASGGTNSPVSDGNSDCEADEYA--PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT 114
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0007449 "proximal/distal pattern formation, imaginal disc" evidence=NAS
GO:0048800 "antennal morphogenesis" evidence=IMP
GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
GO:0035015 "elongation of arista core" evidence=IMP
GO:0045747 "positive regulation of Notch signaling pathway" evidence=IEP
GO:0035218 "leg disc development" evidence=IMP
GO:0022416 "chaeta development" evidence=IMP
GO:0043234 "protein complex" evidence=IPI
GO:0043565 "sequence-specific DNA binding" evidence=IDA;IPI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
ZFIN|ZDB-GENE-990415-15 arxa "aristaless related homeobox a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRI8 I3LRI8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW39 ARX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96QS3 ARX "Homeobox protein ARX" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVR4 ARX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1097716 Arx "aristaless related homeobox" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1562672 Arx "aristaless related homeobox" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A5S8 Arx "Homeobox protein ARX" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQW2 Arx "Homeobox protein ARX" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06453AL_DROMENo assigned EC number0.54830.46200.1789yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-08
smart0038957 smart00389, HOX, Homeodomain 7e-07
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-06
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 48.2 bits (116), Expect = 1e-08
 Identities = 17/29 (58%), Positives = 18/29 (62%)

Query: 69 RRYRTTFTSFQLEELEKAFSRTHYPDVFT 97
          RR RTTFT  QLEELEK F +  YP    
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEE 29

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG0484|consensus125 99.85
KOG0842|consensus307 99.83
KOG0488|consensus309 99.82
KOG0850|consensus245 99.81
KOG0485|consensus268 99.8
KOG0489|consensus261 99.79
KOG0494|consensus 332 99.74
KOG0843|consensus197 99.74
KOG0487|consensus308 99.73
KOG0492|consensus246 99.72
KOG2251|consensus 228 99.69
KOG0486|consensus 351 99.66
KOG0844|consensus 408 99.64
KOG0848|consensus317 99.58
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.51
KOG0491|consensus194 99.47
KOG0493|consensus342 99.47
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.44
KOG0847|consensus288 99.44
KOG0490|consensus235 99.42
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.23
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.18
KOG0849|consensus354 99.18
KOG0483|consensus198 99.14
COG5576156 Homeodomain-containing transcription factor [Trans 99.13
KOG4577|consensus 383 99.12
KOG3802|consensus398 98.82
KOG1168|consensus385 98.33
KOG0490|consensus235 97.79
KOG2252|consensus558 97.03
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 96.93
KOG0775|consensus304 96.9
KOG0774|consensus334 96.53
KOG1146|consensus 1406 95.3
KOG0487|consensus308 91.65
KOG0773|consensus342 86.01
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 83.98
KOG0842|consensus307 80.41
>KOG0484|consensus Back     alignment and domain information 
Probab=99.85  E-value=8.3e-23  Score=141.74  Aligned_cols=68  Identities=44%  Similarity=0.607  Sum_probs=62.4

Q ss_pred             CcCCCCCCCCCCCHHHHHHHHhccccCCCCChhhhhhhhhhhccchhhcccccCCCceeeeccchh-hHHHHHHHHhH
Q psy3734          64 PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGT-GRKKDLVYRRI  140 (158)
Q Consensus        64 ~~rk~rR~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~~~~~~~l~~~~~r~vKiWfQnrR-~~~k~~~~~~~  140 (158)
                      -.+|+||.||.||..||.+||+.|...|||+++.|++||        .+++|++. +|+||||||| |.+|+++....
T Consensus        13 ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA--------~kidLTEA-RVQVWFQNRRAKfRKQEr~a~~   81 (125)
T KOG0484|consen   13 EKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIA--------LKIDLTEA-RVQVWFQNRRAKFRKQERAAIA   81 (125)
T ss_pred             HHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHH--------HhhhhhHH-HHHHHHHhhHHHHHHHHHHHHH
Confidence            467899999999999999999999999999999999999        78888888 9999999999 99999875543

>KOG0842|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 2e-14
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 8e-11
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-09
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-08
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-08
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 5e-08
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 1e-05
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-05
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 3e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 8e-04
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/61 (65%), Positives = 44/61 (72%), Gaps = 9/61 (14%)
Query: 64  PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQT 123
           PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT           L MK+ L + R +Q 
Sbjct: 2   PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREE--------LAMKIGLTEAR-IQV 52
Query: 124 Y 124
           +
Sbjct: 53  W 53
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-21
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 8e-20
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-19
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 7e-19
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-18
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-17
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-16
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-15
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-15
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-14
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-14
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 8e-14
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-11
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-11
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-11
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-10
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-10
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-09
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-09
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-08
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 9e-08
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-07
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 9e-07
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 6e-06
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-05
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-05
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-05
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-05
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-05
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-05
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 3e-05
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-05
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 5e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 6e-05
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-04
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-04
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-04
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-04
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 3e-04
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 5e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score = 81.6 bits (202), Expect = 2e-21
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)

Query: 50 EDVSEGEMEDYASLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT 97
          ED+S+ E E   +L KRKQRR RTTF++ QL+ELE+AF RT YPD++T
Sbjct: 1  EDISDCESEPGIAL-KRKQRRSRTTFSASQLDELERAFERTQYPDIYT 47
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.77
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.77
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.75
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.75
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.75
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.74
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.74
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.74
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.74
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.73
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.73
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.73
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.73
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.73
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.72
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.72
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.72
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.72
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.72
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.72
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.72
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.72
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.71
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.71
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.71
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.71
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.7
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.7
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.7
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.7
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.7
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.69
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.69
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.68
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.68
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.68
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.68
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.68
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.68
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.68
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.67
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.67
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.67
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.67
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.67
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.65
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.65
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.65
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.64
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.64
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.64
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.64
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.64
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.63
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.62
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.62
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.62
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.61
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.59
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.59
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.59
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.58
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.58
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.57
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.57
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.56
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.56
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.56
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.54
2e19_A64 Transcription factor 8; homeobox domain, structura 99.5
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.5
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.48
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.39
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.38
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.11
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.06
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.04
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.94
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 85.13
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=3.4e-20  Score=124.67  Aligned_cols=64  Identities=23%  Similarity=0.254  Sum_probs=54.8

Q ss_pred             CcCCCCCCCCCCCHHHHHHHHhccccCCCCChhhhhhhhhhhccchhhcccccCCCceeeeccchh-hHHHHHH
Q psy3734          64 PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGT-GRKKDLV  136 (158)
Q Consensus        64 ~~rk~rR~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~~~~~~~l~~~~~r~vKiWfQnrR-~~~k~~~  136 (158)
                      ..++.+|.||.||..|+..||..|..++||+..++.+||..++        |.+. +|+||||||| ++||..+
T Consensus        18 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~--------l~~~-qV~vWFqNRR~k~kk~~k   82 (84)
T 2kt0_A           18 VPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILN--------LSYK-QVKTWFQNQRMKSKRWQK   82 (84)
T ss_dssp             CCSCSCCCSSCCCHHHHHHHHHHHHHSSSCCHHHHHHHHHHTT--------CCHH-HHHHHHHHHHHTTTSCCC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcC--------CCHH-HHHHHHHHHHHHHHHHhh
Confidence            4556788999999999999999999999999999999995555        4444 8999999999 8877643
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 7e-10
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-09
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-09
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-08
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-08
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-08
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-08
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-08
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-08
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 4e-08
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-08
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-07
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-07
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 4e-07
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 5e-07
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 9e-07
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-06
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-06
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-06
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-05
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-04
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 0.003
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 50.6 bits (121), Expect = 7e-10
 Identities = 12/34 (35%), Positives = 14/34 (41%)

Query: 62 SLPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDV 95
           L  R  R+ R  +T  Q  ELEK F    Y   
Sbjct: 7  WLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTR 40
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.78
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.78
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.77
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.77
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.76
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.76
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.75
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.75
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.74
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.74
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.73
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.73
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.73
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.73
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.73
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.72
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.68
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.66
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.64
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.63
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.62
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.62
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.61
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.59
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.55
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.48
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.46
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.38
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.31
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.28
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.25
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Msx-1 homeodomain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.78  E-value=2e-20  Score=116.39  Aligned_cols=56  Identities=23%  Similarity=0.291  Sum_probs=49.3

Q ss_pred             CCCCCCCCHHHHHHHHhccccCCCCChhhhhhhhhhhccchhhcccccCCCceeeeccchh-hHHH
Q psy3734          69 RRYRTTFTSFQLEELEKAFSRTHYPDVFTSTGSIAVFKPFLLMKLDLVKNRPVQTYVAYGT-GRKK  133 (158)
Q Consensus        69 rR~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~~~~~~~l~~~~~r~vKiWfQnrR-~~~k  133 (158)
                      ||.||.||.+|+.+||..|+.++||+...+++||..+++++.         +|+||||||| ++||
T Consensus         1 rr~Rt~ft~~Ql~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~---------~V~~WFqNrR~k~kr   57 (58)
T d1ig7a_           1 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTET---------QVKIWFQNRRAKAKR   57 (58)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHTTCCHH---------HHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChh---------heeecCcchHhHhcc
Confidence            568999999999999999999999999999999966665444         8999999999 6654
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure