Psyllid ID: psy3752
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1012 | ||||||
| 329912037 | 248 | SSU ribosomal protein S2p (SAe) [Oxaloba | 0.227 | 0.927 | 0.656 | 7e-93 | |
| 152980757 | 264 | 30S ribosomal protein S2 [Janthinobacter | 0.226 | 0.867 | 0.669 | 2e-92 | |
| 340786521 | 250 | 30S ribosomal protein S2 [Collimonas fun | 0.216 | 0.876 | 0.689 | 3e-92 | |
| 209573709 | 248 | RecName: Full=30S ribosomal protein S2 | 0.216 | 0.883 | 0.684 | 3e-92 | |
| 134094560 | 248 | 30S ribosomal protein S2 [Herminiimonas | 0.216 | 0.883 | 0.680 | 3e-92 | |
| 398836105 | 247 | ribosomal protein S2 [Herbaspirillum sp. | 0.216 | 0.886 | 0.689 | 1e-91 | |
| 237747785 | 246 | 30S ribosomal subunit protein S2 [Oxalob | 0.228 | 0.939 | 0.645 | 7e-91 | |
| 409405990 | 259 | 30S ribosomal protein S2 [Herbaspirillum | 0.215 | 0.841 | 0.697 | 9e-90 | |
| 300311493 | 246 | 30S ribosomal protein S2 [Herbaspirillum | 0.215 | 0.886 | 0.697 | 2e-89 | |
| 415953991 | 259 | 30S ribosomal subunit protein S2 [Herbas | 0.215 | 0.841 | 0.697 | 3e-89 |
| >gi|329912037|ref|ZP_08275648.1| SSU ribosomal protein S2p (SAe) [Oxalobacteraceae bacterium IMCC9480] gi|327545760|gb|EGF30894.1| SSU ribosomal protein S2p (SAe) [Oxalobacteraceae bacterium IMCC9480] | Back alignment and taxonomy information |
|---|
Score = 348 bits (894), Expect = 7e-93, Method: Compositional matrix adjust.
Identities = 155/236 (65%), Positives = 196/236 (83%), Gaps = 6/236 (2%)
Query: 175 KIMQAGVHFGHQTRFWNPKMSSYIFGHRNKIHIINLEKTLYMYEKAIRYIYQLGFSKGTL 234
++++AGVHFGHQTRFWNPKM+ YIFGHRNKIHI+NLEKTL MY+ A++YI QL ++GT+
Sbjct: 7 EMLEAGVHFGHQTRFWNPKMAPYIFGHRNKIHIVNLEKTLAMYQDAMKYIQQLSSNRGTI 66
Query: 235 LFVGTKRQARGVIANEAVRAGMPFIDQRWLGGLLTNFKTIKTSIQRLKEMDLFITNGSIR 294
L VGTKRQAR ++A EA RAGMPF+DQRWLGG+LTNFKTIKTSI+RLKEM+ I +GS+
Sbjct: 67 LMVGTKRQAREIVAAEAARAGMPFVDQRWLGGMLTNFKTIKTSIKRLKEMEASIADGSVE 126
Query: 295 KLSKKEALLFYRKQMKLNRVIGGIKNMNIIPDAIFIIDVGYHKGAVSEAIKLNIPIIGVV 354
KLSKKE L+F R+ +KL + IGGIK+M IPDAIF++DVGYHKGA++EA KL IP+IGVV
Sbjct: 127 KLSKKEGLMFEREMIKLQKSIGGIKDMGGIPDAIFVVDVGYHKGAITEAAKLGIPVIGVV 186
Query: 355 DTNHSPDGINYVIPGNDDSAKSIALYTKGIVDAFLDAKTVGELRSKTLAPIMECKK 410
DTNHSP+G+ Y+IPGNDDS+K+I LY +G+ DA L E R+ +L ++E K
Sbjct: 187 DTNHSPEGVTYIIPGNDDSSKAIMLYARGVADAIL------EGRASSLNDVVEAVK 236
|
Source: Oxalobacteraceae bacterium IMCC9480 Species: Oxalobacteraceae bacterium IMCC9480 Genus: Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|152980757|ref|YP_001353748.1| 30S ribosomal protein S2 [Janthinobacterium sp. Marseille] gi|151280834|gb|ABR89244.1| small subunit ribosomal protein S2 [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
|---|
| >gi|340786521|ref|YP_004751986.1| 30S ribosomal protein S2 [Collimonas fungivorans Ter331] gi|340551788|gb|AEK61163.1| SSU ribosomal protein S2p (SAe) [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|209573709|sp|A6SZQ1.2|RS2_JANMA RecName: Full=30S ribosomal protein S2 | Back alignment and taxonomy information |
|---|
| >gi|134094560|ref|YP_001099635.1| 30S ribosomal protein S2 [Herminiimonas arsenicoxydans] gi|166225279|sp|A4G4S1.1|RS2_HERAR RecName: Full=30S ribosomal protein S2 gi|133738463|emb|CAL61508.1| 30S ribosomal subunit protein S2 [Herminiimonas arsenicoxydans] | Back alignment and taxonomy information |
|---|
| >gi|398836105|ref|ZP_10593454.1| ribosomal protein S2 [Herbaspirillum sp. YR522] gi|398213936|gb|EJN00522.1| ribosomal protein S2 [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
| >gi|237747785|ref|ZP_04578265.1| 30S ribosomal subunit protein S2 [Oxalobacter formigenes OXCC13] gi|229379147|gb|EEO29238.1| 30S ribosomal subunit protein S2 [Oxalobacter formigenes OXCC13] | Back alignment and taxonomy information |
|---|
| >gi|409405990|ref|ZP_11254452.1| 30S ribosomal protein S2 [Herbaspirillum sp. GW103] gi|386434539|gb|EIJ47364.1| 30S ribosomal protein S2 [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|300311493|ref|YP_003775585.1| 30S ribosomal protein S2 [Herbaspirillum seropedicae SmR1] gi|124483406|emb|CAM32576.1| 30S ribosomal subunit protein S2 [Herbaspirillum seropedicae] gi|300074278|gb|ADJ63677.1| 30S ribosomal subunit protein S2 [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
|---|
| >gi|415953991|ref|ZP_11557319.1| 30S ribosomal subunit protein S2 [Herbaspirillum frisingense GSF30] gi|407757195|gb|EKF67231.1| 30S ribosomal subunit protein S2 [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1012 | ||||||
| UNIPROTKB|Q9KPV2 | 242 | rpsB "30S ribosomal protein S2 | 0.230 | 0.962 | 0.475 | 1.9e-58 | |
| TIGR_CMR|VC_2260 | 242 | VC_2260 "ribosomal protein S2" | 0.230 | 0.962 | 0.475 | 1.9e-58 | |
| TIGR_CMR|GSU_1921 | 251 | GSU_1921 "ribosomal protein S2 | 0.220 | 0.888 | 0.508 | 1.1e-57 | |
| TIGR_CMR|CPS_1553 | 242 | CPS_1553 "ribosomal protein S2 | 0.214 | 0.896 | 0.474 | 5.2e-57 | |
| TIGR_CMR|SO_1629 | 242 | SO_1629 "ribosomal protein S2" | 0.209 | 0.876 | 0.504 | 8.7e-57 | |
| UNIPROTKB|P0A7V0 | 241 | rpsB [Escherichia coli K-12 (t | 0.229 | 0.962 | 0.475 | 3.1e-56 | |
| TIGR_CMR|CHY_1787 | 232 | CHY_1787 "ribosomal protein S2 | 0.219 | 0.956 | 0.484 | 1.1e-54 | |
| TIGR_CMR|BA_3965 | 233 | BA_3965 "ribosomal protein S2" | 0.224 | 0.974 | 0.482 | 6.3e-54 | |
| TIGR_CMR|ECH_0514 | 288 | ECH_0514 "ribosomal protein S2 | 0.212 | 0.746 | 0.495 | 8.1e-54 | |
| TIGR_CMR|DET_0377 | 245 | DET_0377 "ribosomal protein S2 | 0.219 | 0.906 | 0.445 | 1.1e-51 |
| UNIPROTKB|Q9KPV2 rpsB "30S ribosomal protein S2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
Score = 605 (218.0 bits), Expect = 1.9e-58, P = 1.9e-58
Identities = 114/240 (47%), Positives = 169/240 (70%)
Query: 176 IMQAGVHFGHQTRFWNPKMSSYIFGHRNKIHIINLEKTLYMYEKAIRYIYQLGFSKGTLL 235
++ AGVHFGHQTR+WNPKM +IFG RN++HIINLEKT+ M+ +A+ + ++G KG +L
Sbjct: 9 MLTAGVHFGHQTRYWNPKMKQFIFGARNRVHIINLEKTVPMFNEALAELAKVGEKKGKVL 68
Query: 236 FVGTKRQARGVIANEAVRAGMPFIDQRWLGGLLTNFKTIKTSIQRLKEMDLFITNGSIRK 295
FVGTKR A + A+ + +++ RWLGG+LTN+KT++ SI+RLKE+++ T+G+ K
Sbjct: 69 FVGTKRAASESVKEAALASNQYYVNNRWLGGMLTNWKTVRQSIKRLKELEVQSTDGTFDK 128
Query: 296 LSKKEALLFYRKQMKLNRVIGGIKNMNIIPDAIFIIDVGYHKGAVSEAIKLNIPIIGVVD 355
L+KKEAL+ R+ KL + +GGIK+M +PDA+F+ID + A+ EA L IP+ VVD
Sbjct: 129 LTKKEALMRTREMEKLEKSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAVVD 188
Query: 356 TNHSPDGINYVIPGNDDSAKSIALYTKGIVDAFLDAKTVGELRSKTLAPIMECKKALIEA 415
TN SPDG++Y+IPGNDD+ +++ LY A+ + E R+K +A + E K +EA
Sbjct: 189 TNSSPDGVDYIIPGNDDAIRAVQLYLNAA------AQAINEGRNKDVAAVAE-KDGFVEA 241
|
|
| TIGR_CMR|VC_2260 VC_2260 "ribosomal protein S2" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1921 GSU_1921 "ribosomal protein S2" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_1553 CPS_1553 "ribosomal protein S2" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1629 SO_1629 "ribosomal protein S2" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A7V0 rpsB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1787 CHY_1787 "ribosomal protein S2" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3965 BA_3965 "ribosomal protein S2" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0514 ECH_0514 "ribosomal protein S2" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0377 DET_0377 "ribosomal protein S2" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1012 | |||
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 1e-117 | |
| cd04254 | 231 | cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, t | 1e-109 | |
| PRK00358 | 231 | PRK00358, pyrH, uridylate kinase; Provisional | 1e-102 | |
| COG0052 | 252 | COG0052, RpsB, Ribosomal protein S2 [Translation, | 6e-95 | |
| TIGR02075 | 232 | TIGR02075, pyrH_bact, uridylate kinase | 2e-94 | |
| cd04239 | 229 | cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase | 6e-90 | |
| COG0528 | 238 | COG0528, PyrH, Uridylate kinase [Nucleotide transp | 1e-89 | |
| TIGR01011 | 225 | TIGR01011, rpsB_bact, ribosomal protein S2, bacter | 6e-89 | |
| pfam00318 | 205 | pfam00318, Ribosomal_S2, Ribosomal protein S2 | 9e-83 | |
| PRK09377 | 290 | PRK09377, tsf, elongation factor Ts; Provisional | 2e-76 | |
| PRK12311 | 326 | PRK12311, rpsB, 30S ribosomal protein S2/unknown d | 6e-74 | |
| PRK00083 | 185 | PRK00083, frr, ribosome recycling factor; Reviewed | 7e-70 | |
| cd01425 | 193 | cd01425, RPS2, Ribosomal protein S2 (RPS2), involv | 3e-69 | |
| CHL00067 | 230 | CHL00067, rps2, ribosomal protein S2 | 1e-66 | |
| COG0264 | 296 | COG0264, Tsf, Translation elongation factor Ts [Tr | 4e-65 | |
| COG0233 | 187 | COG0233, Frr, Ribosome recycling factor [Translati | 3e-63 | |
| PRK14558 | 231 | PRK14558, pyrH, uridylate kinase; Provisional | 2e-60 | |
| pfam01765 | 165 | pfam01765, RRF, Ribosome recycling factor | 4e-59 | |
| PRK14556 | 249 | PRK14556, pyrH, uridylate kinase; Provisional | 7e-55 | |
| cd00520 | 179 | cd00520, RRF, Ribosome recycling factor (RRF) | 3e-53 | |
| TIGR00496 | 176 | TIGR00496, frr, ribosome recycling factor | 1e-48 | |
| PRK09481 | 211 | PRK09481, sspA, stringent starvation protein A; Pr | 2e-46 | |
| PRK14557 | 247 | PRK14557, pyrH, uridylate kinase; Provisional | 8e-46 | |
| TIGR00116 | 291 | TIGR00116, tsf, translation elongation factor Ts | 4e-43 | |
| cd03186 | 108 | cd03186, GST_C_SspA, C-terminal, alpha helical dom | 3e-36 | |
| PRK12332 | 198 | PRK12332, tsf, elongation factor Ts; Reviewed | 6e-32 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 1e-31 | |
| CHL00098 | 200 | CHL00098, tsf, elongation factor Ts | 1e-27 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 5e-22 | |
| cd02115 | 248 | cd02115, AAK, Amino Acid Kinases (AAK) superfamily | 1e-21 | |
| pfam00696 | 230 | pfam00696, AA_kinase, Amino acid kinase family | 2e-21 | |
| cd04253 | 221 | cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP k | 2e-16 | |
| TIGR02076 | 221 | TIGR02076, pyrH_arch, uridylate kinase, putative | 4e-15 | |
| pfam00889 | 134 | pfam00889, EF_TS, Elongation factor TS | 8e-14 | |
| pfam00889 | 134 | pfam00889, EF_TS, Elongation factor TS | 1e-11 | |
| PRK15113 | 214 | PRK15113, PRK15113, glutathione S-transferase; Pro | 1e-11 | |
| cd04246 | 239 | cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino | 1e-11 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 6e-11 | |
| cd04261 | 239 | cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino | 3e-10 | |
| PRK12332 | 198 | PRK12332, tsf, elongation factor Ts; Reviewed | 9e-10 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 9e-10 | |
| TIGR01012 | 196 | TIGR01012, Sa_S2_E_A, ribosomal protein Sa(cytosol | 1e-09 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 2e-09 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 4e-09 | |
| TIGR00657 | 441 | TIGR00657, asp_kinases, aspartate kinase | 4e-08 | |
| TIGR00656 | 401 | TIGR00656, asp_kin_monofn, aspartate kinase, monof | 8e-08 | |
| PRK04020 | 204 | PRK04020, rps2P, 30S ribosomal protein S2; Provisi | 8e-08 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 1e-07 | |
| COG0527 | 447 | COG0527, LysC, Aspartokinases [Amino acid transpor | 1e-07 | |
| cd03055 | 89 | cd03055, GST_N_Omega, GST_N family, Class Omega su | 3e-07 | |
| cd04234 | 227 | cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfa | 5e-07 | |
| cd03058 | 74 | cd03058, GST_N_Tau, GST_N family, Class Tau subfam | 6e-07 | |
| PLN02817 | 265 | PLN02817, PLN02817, glutathione dehydrogenase (asc | 6e-07 | |
| cd04260 | 244 | cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino A | 8e-07 | |
| PRK08210 | 403 | PRK08210, PRK08210, aspartate kinase I; Reviewed | 1e-06 | |
| PRK06635 | 404 | PRK06635, PRK06635, aspartate kinase; Reviewed | 6e-06 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 7e-06 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 9e-06 | |
| cd04258 | 292 | cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Ami | 1e-05 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 2e-05 | |
| PRK10542 | 201 | PRK10542, PRK10542, glutathionine S-transferase; P | 2e-05 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 3e-05 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 4e-05 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 9e-05 | |
| cd04243 | 293 | cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino | 1e-04 | |
| PRK07431 | 587 | PRK07431, PRK07431, aspartate kinase; Provisional | 3e-04 | |
| cd03180 | 110 | cd03180, GST_C_2, C-terminal, alpha helical domain | 4e-04 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 5e-04 | |
| cd03057 | 77 | cd03057, GST_N_Beta, GST_N family, Class Beta subf | 7e-04 | |
| PRK09084 | 448 | PRK09084, PRK09084, aspartate kinase III; Validate | 7e-04 | |
| COG1608 | 252 | COG1608, COG1608, Predicted archaeal kinase [Gener | 0.001 | |
| cd03207 | 101 | cd03207, GST_C_8, C-terminal, alpha helical domain | 0.001 | |
| PRK10357 | 202 | PRK10357, PRK10357, putative glutathione S-transfe | 0.002 | |
| cd04255 | 262 | cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD i | 0.002 | |
| cd03188 | 113 | cd03188, GST_C_Beta, C-terminal, alpha helical dom | 0.002 | |
| PLN02378 | 213 | PLN02378, PLN02378, glutathione S-transferase DHAR | 0.002 | |
| PRK08841 | 392 | PRK08841, PRK08841, aspartate kinase; Validated | 0.003 | |
| cd10291 | 110 | cd10291, GST_C_YfcG_like, C-terminal, alpha helica | 0.003 | |
| cd04244 | 298 | cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino | 0.003 |
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
Score = 360 bits (926), Expect = e-117
Identities = 117/219 (53%), Positives = 163/219 (74%)
Query: 174 EKIMQAGVHFGHQTRFWNPKMSSYIFGHRNKIHIINLEKTLYMYEKAIRYIYQLGFSKGT 233
+++++AGVHFGHQTR WNPKM YIFG RN IHII+L+KT+ M ++A ++ + + G
Sbjct: 7 KQLLEAGVHFGHQTRRWNPKMKPYIFGERNGIHIIDLQKTVPMLDEAYNFVRDVAANGGK 66
Query: 234 LLFVGTKRQARGVIANEAVRAGMPFIDQRWLGGLLTNFKTIKTSIQRLKEMDLFITNGSI 293
+LFVGTK+QA+ IA EA R GMP+++ RWLGG+LTNFKTI+ SI+RLKE++ +G+
Sbjct: 67 ILFVGTKKQAQEAIAEEAERCGMPYVNHRWLGGMLTNFKTIRKSIKRLKELEKMEEDGTF 126
Query: 294 RKLSKKEALLFYRKQMKLNRVIGGIKNMNIIPDAIFIIDVGYHKGAVSEAIKLNIPIIGV 353
KL+KKEAL+ R+ KL + +GGIK+M +PDA+F++D AV EA KL IP++ +
Sbjct: 127 EKLTKKEALMLTRELEKLEKSLGGIKDMGGLPDALFVVDPNKEHIAVKEARKLGIPVVAI 186
Query: 354 VDTNHSPDGINYVIPGNDDSAKSIALYTKGIVDAFLDAK 392
VDTN PDG++Y IPGNDD+ +SI LYT I DA L+ +
Sbjct: 187 VDTNCDPDGVDYPIPGNDDAIRSIKLYTSKIADAILEGR 225
|
Length = 258 |
| >gnl|CDD|239787 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >gnl|CDD|234735 PRK00358, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223130 COG0052, RpsB, Ribosomal protein S2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|213681 TIGR02075, pyrH_bact, uridylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|239772 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|223602 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130084 TIGR01011, rpsB_bact, ribosomal protein S2, bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|215856 pfam00318, Ribosomal_S2, Ribosomal protein S2 | Back alignment and domain information |
|---|
| >gnl|CDD|236491 PRK09377, tsf, elongation factor Ts; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183428 PRK12311, rpsB, 30S ribosomal protein S2/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178850 PRK00083, frr, ribosome recycling factor; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100106 cd01425, RPS2, Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome | Back alignment and domain information |
|---|
| >gnl|CDD|177007 CHL00067, rps2, ribosomal protein S2 | Back alignment and domain information |
|---|
| >gnl|CDD|223342 COG0264, Tsf, Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223311 COG0233, Frr, Ribosome recycling factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216689 pfam01765, RRF, Ribosome recycling factor | Back alignment and domain information |
|---|
| >gnl|CDD|173021 PRK14556, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238288 cd00520, RRF, Ribosome recycling factor (RRF) | Back alignment and domain information |
|---|
| >gnl|CDD|129587 TIGR00496, frr, ribosome recycling factor | Back alignment and domain information |
|---|
| >gnl|CDD|236537 PRK09481, sspA, stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173022 PRK14557, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232832 TIGR00116, tsf, translation elongation factor Ts | Back alignment and domain information |
|---|
| >gnl|CDD|198295 cd03186, GST_C_SspA, C-terminal, alpha helical domain of Stringent starvation protein A | Back alignment and domain information |
|---|
| >gnl|CDD|183447 PRK12332, tsf, elongation factor Ts; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214362 CHL00098, tsf, elongation factor Ts | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family | Back alignment and domain information |
|---|
| >gnl|CDD|239786 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >gnl|CDD|233711 TIGR02076, pyrH_arch, uridylate kinase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|189759 pfam00889, EF_TS, Elongation factor TS | Back alignment and domain information |
|---|
| >gnl|CDD|189759 pfam00889, EF_TS, Elongation factor TS | Back alignment and domain information |
|---|
| >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239779 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239794 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >gnl|CDD|183447 PRK12332, tsf, elongation factor Ts; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|188101 TIGR01012, Sa_S2_E_A, ribosomal protein Sa(cytosolic)/S2(archaeal) | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233076 TIGR00657, asp_kinases, aspartate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|233075 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >gnl|CDD|235201 PRK04020, rps2P, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223601 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239767 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >gnl|CDD|239793 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >gnl|CDD|236188 PRK08210, PRK08210, aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235843 PRK06635, PRK06635, aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239791 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239776 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >gnl|CDD|236018 PRK07431, PRK07431, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|236376 PRK09084, PRK09084, aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224524 COG1608, COG1608, Predicted archaeal kinase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239788 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >gnl|CDD|181563 PRK08841, PRK08841, aspartate kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|198324 cd10291, GST_C_YfcG_like, C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239777 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1012 | |||
| COG0052 | 252 | RpsB Ribosomal protein S2 [Translation, ribosomal | 100.0 | |
| PRK12311 | 326 | rpsB 30S ribosomal protein S2/unknown domain fusio | 100.0 | |
| TIGR01011 | 225 | rpsB_bact ribosomal protein S2, bacterial type. TI | 100.0 | |
| PRK05299 | 258 | rpsB 30S ribosomal protein S2; Provisional | 100.0 | |
| CHL00067 | 230 | rps2 ribosomal protein S2 | 100.0 | |
| COG0233 | 187 | Frr Ribosome recycling factor [Translation, riboso | 100.0 | |
| PF00318 | 211 | Ribosomal_S2: Ribosomal protein S2; InterPro: IPR0 | 100.0 | |
| COG0264 | 296 | Tsf Translation elongation factor Ts [Translation, | 100.0 | |
| cd01425 | 193 | RPS2 Ribosomal protein S2 (RPS2), involved in form | 100.0 | |
| TIGR01012 | 196 | Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archa | 100.0 | |
| PRK00083 | 185 | frr ribosome recycling factor; Reviewed | 100.0 | |
| PRK04020 | 204 | rps2P 30S ribosomal protein S2; Provisional | 100.0 | |
| PRK09377 | 290 | tsf elongation factor Ts; Provisional | 100.0 | |
| TIGR00116 | 290 | tsf translation elongation factor Ts. This protein | 100.0 | |
| TIGR00496 | 176 | frr ribosome recycling factor. This model finds on | 100.0 | |
| PTZ00254 | 249 | 40S ribosomal protein SA; Provisional | 100.0 | |
| cd00520 | 179 | RRF Ribosome recycling factor (RRF). Ribosome recy | 100.0 | |
| KOG0832|consensus | 251 | 100.0 | ||
| PF01765 | 165 | RRF: Ribosome recycling factor; InterPro: IPR02358 | 100.0 | |
| PRK12332 | 198 | tsf elongation factor Ts; Reviewed | 100.0 | |
| CHL00098 | 200 | tsf elongation factor Ts | 100.0 | |
| KOG4759|consensus | 263 | 100.0 | ||
| KOG1071|consensus | 340 | 100.0 | ||
| COG0528 | 238 | PyrH Uridylate kinase [Nucleotide transport and me | 100.0 | |
| PRK14556 | 249 | pyrH uridylate kinase; Provisional | 100.0 | |
| PRK14558 | 231 | pyrH uridylate kinase; Provisional | 100.0 | |
| PF00889 | 221 | EF_TS: Elongation factor TS; InterPro: IPR014039 T | 100.0 | |
| PRK00358 | 231 | pyrH uridylate kinase; Provisional | 100.0 | |
| PRK14557 | 247 | pyrH uridylate kinase; Provisional | 100.0 | |
| cd04239 | 229 | AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik | 100.0 | |
| cd04254 | 231 | AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi | 100.0 | |
| TIGR02075 | 233 | pyrH_bact uridylate kinase. This protein, also cal | 100.0 | |
| COG0263 | 369 | ProB Glutamate 5-kinase [Amino acid transport and | 99.97 | |
| KOG0830|consensus | 254 | 99.97 | ||
| cd04253 | 221 | AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP | 99.95 | |
| PRK12314 | 266 | gamma-glutamyl kinase; Provisional | 99.95 | |
| PTZ00489 | 264 | glutamate 5-kinase; Provisional | 99.95 | |
| cd04256 | 284 | AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase | 99.95 | |
| TIGR02076 | 221 | pyrH_arch uridylate kinase, putative. This family | 99.95 | |
| PRK13402 | 368 | gamma-glutamyl kinase; Provisional | 99.95 | |
| cd04242 | 251 | AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K | 99.94 | |
| PRK05429 | 372 | gamma-glutamyl kinase; Provisional | 99.94 | |
| TIGR01027 | 363 | proB glutamate 5-kinase. Bacterial ProB proteins h | 99.94 | |
| cd02115 | 248 | AAK Amino Acid Kinases (AAK) superfamily, catalyti | 99.94 | |
| cd04261 | 239 | AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina | 99.94 | |
| cd04246 | 239 | AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina | 99.94 | |
| COG1608 | 252 | Predicted archaeal kinase [General function predic | 99.94 | |
| cd04241 | 252 | AAK_FomA-like AAK_FomA-like: This CD includes a fo | 99.93 | |
| cd04255 | 262 | AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th | 99.93 | |
| KOG1154|consensus | 285 | 99.93 | ||
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 99.92 | |
| PRK08841 | 392 | aspartate kinase; Validated | 99.92 | |
| cd04234 | 227 | AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) | 99.92 | |
| cd04235 | 308 | AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot | 99.92 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.92 | |
| cd04260 | 244 | AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase | 99.92 | |
| TIGR00746 | 310 | arcC carbamate kinase. The seed alignment for this | 99.92 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 99.91 | |
| PRK14058 | 268 | acetylglutamate/acetylaminoadipate kinase; Provisi | 99.91 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 99.91 | |
| COG0548 | 265 | ArgB Acetylglutamate kinase [Amino acid transport | 99.91 | |
| TIGR01092 | 715 | P5CS delta l-pyrroline-5-carboxylate synthetase. T | 99.9 | |
| PRK12454 | 313 | carbamate kinase-like carbamoyl phosphate syntheta | 99.9 | |
| PRK12353 | 314 | putative amino acid kinase; Reviewed | 99.9 | |
| CHL00202 | 284 | argB acetylglutamate kinase; Provisional | 99.9 | |
| PLN02512 | 309 | acetylglutamate kinase | 99.9 | |
| PLN02418 | 718 | delta-1-pyrroline-5-carboxylate synthase | 99.89 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 99.89 | |
| cd04244 | 298 | AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina | 99.89 | |
| PRK12686 | 312 | carbamate kinase; Reviewed | 99.88 | |
| cd04250 | 279 | AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase | 99.88 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.88 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 99.88 | |
| PRK00942 | 283 | acetylglutamate kinase; Provisional | 99.88 | |
| KOG0868|consensus | 217 | 99.88 | ||
| KOG0406|consensus | 231 | 99.88 | ||
| PLN02395 | 215 | glutathione S-transferase | 99.88 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 99.88 | |
| PLN02473 | 214 | glutathione S-transferase | 99.88 | |
| cd04259 | 295 | AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super | 99.88 | |
| cd04238 | 256 | AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate | 99.87 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.87 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.87 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.87 | |
| cd04251 | 257 | AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina | 99.87 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 99.87 | |
| cd04249 | 252 | AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina | 99.87 | |
| cd04245 | 288 | AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki | 99.86 | |
| cd04257 | 294 | AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa | 99.86 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.86 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.86 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.86 | |
| PRK12352 | 316 | putative carbamate kinase; Reviewed | 99.86 | |
| PRK08373 | 341 | aspartate kinase; Validated | 99.86 | |
| cd04243 | 293 | AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina | 99.85 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.85 | |
| cd04258 | 292 | AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki | 99.84 | |
| PRK12354 | 307 | carbamate kinase; Reviewed | 99.84 | |
| cd04247 | 306 | AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa | 99.84 | |
| PRK09411 | 297 | carbamate kinase; Reviewed | 99.84 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.84 | |
| cd04240 | 203 | AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin | 99.84 | |
| PLN02551 | 521 | aspartokinase | 99.84 | |
| PF00696 | 242 | AA_kinase: Amino acid kinase family Match to Gluta | 99.84 | |
| TIGR02078 | 327 | AspKin_pair Pyrococcus aspartate kinase subunit, p | 99.83 | |
| TIGR00761 | 231 | argB acetylglutamate kinase. This model describes | 99.82 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 99.82 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 99.82 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.82 | |
| cd04237 | 280 | AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) | 99.81 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 99.79 | |
| PRK05925 | 440 | aspartate kinase; Provisional | 99.79 | |
| cd04252 | 248 | AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam | 99.79 | |
| KOG0867|consensus | 226 | 99.79 | ||
| COG0549 | 312 | ArcC Carbamate kinase [Amino acid transport and me | 99.79 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 99.79 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 99.79 | |
| cd04236 | 271 | AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA | 99.78 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.78 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 99.75 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.75 | |
| PRK09181 | 475 | aspartate kinase; Validated | 99.73 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.71 | |
| cd04248 | 304 | AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S | 99.7 | |
| KOG1695|consensus | 206 | 99.68 | ||
| PRK04531 | 398 | acetylglutamate kinase; Provisional | 99.65 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.64 | |
| COG2054 | 212 | Uncharacterized archaeal kinase related to asparto | 99.63 | |
| KOG0456|consensus | 559 | 99.61 | ||
| PLN02907 | 722 | glutamate-tRNA ligase | 99.56 | |
| KOG4420|consensus | 325 | 99.56 | ||
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.55 | |
| KOG1422|consensus | 221 | 99.41 | ||
| COG0264 | 296 | Tsf Translation elongation factor Ts [Translation, | 99.37 | |
| TIGR00116 | 290 | tsf translation elongation factor Ts. This protein | 99.37 | |
| PF00889 | 221 | EF_TS: Elongation factor TS; InterPro: IPR014039 T | 99.34 | |
| PRK09377 | 290 | tsf elongation factor Ts; Provisional | 99.33 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.28 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.22 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.21 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.15 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.13 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.13 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.06 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.06 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.06 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.05 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.04 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.04 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.03 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.02 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.02 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 98.99 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 98.99 | |
| CHL00098 | 200 | tsf elongation factor Ts | 98.98 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 98.97 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 98.96 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 98.95 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 98.95 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 98.95 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 98.94 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 98.93 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 98.93 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 98.92 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 98.87 | |
| PRK12332 | 198 | tsf elongation factor Ts; Reviewed | 98.86 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 98.82 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 98.79 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 98.79 | |
| KOG4244|consensus | 281 | 98.78 | ||
| KOG2903|consensus | 319 | 98.77 | ||
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 98.75 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 98.71 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 98.71 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 98.7 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 98.7 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 98.68 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 98.65 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 98.63 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 98.62 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 98.6 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 98.59 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 98.57 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 98.56 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 98.55 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 98.55 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 98.52 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 98.5 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 98.5 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 98.5 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.48 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 98.47 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 98.45 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 98.45 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 98.43 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 98.41 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.4 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 98.38 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 98.38 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 98.38 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 98.37 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 98.35 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 98.28 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 98.27 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.2 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 98.15 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 98.14 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 98.09 | |
| KOG3029|consensus | 370 | 98.06 | ||
| KOG3027|consensus | 257 | 98.04 | ||
| KOG2436|consensus | 520 | 97.99 | ||
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 97.98 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 97.94 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 97.94 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 97.93 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 97.88 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 97.83 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 97.81 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 97.79 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 97.71 | |
| KOG3028|consensus | 313 | 97.46 | ||
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 97.44 | |
| PRK05441 | 299 | murQ N-acetylmuramic acid-6-phosphate etherase; Re | 96.88 | |
| PRK12570 | 296 | N-acetylmuramic acid-6-phosphate etherase; Reviewe | 96.59 | |
| cd05007 | 257 | SIS_Etherase N-acetylmuramic acid 6-phosphate ethe | 96.23 | |
| TIGR00274 | 291 | N-acetylmuramic acid 6-phosphate etherase. This pr | 95.84 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 95.63 | |
| PRK06369 | 115 | nac nascent polypeptide-associated complex protein | 95.39 | |
| KOG1147|consensus | 712 | 95.29 | ||
| TIGR00264 | 116 | alpha-NAC-related protein. This hypothetical prote | 95.05 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 94.78 | |
| KOG1071|consensus | 340 | 94.75 | ||
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 94.69 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 94.56 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 94.07 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 93.29 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 88.62 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 87.48 | |
| PRK00414 | 192 | gmhA phosphoheptose isomerase; Reviewed | 87.45 | |
| TIGR03127 | 179 | RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of | 85.98 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 85.37 | |
| PF13580 | 138 | SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_ | 84.45 | |
| COG2103 | 298 | Predicted sugar phosphate isomerase [General funct | 83.11 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 82.13 | |
| COG1308 | 122 | EGD2 Transcription factor homologous to NACalpha-B | 81.17 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 80.75 | |
| cd05006 | 177 | SIS_GmhA Phosphoheptose isomerase is a member of t | 80.37 | |
| PRK10886 | 196 | DnaA initiator-associating protein DiaA; Provision | 80.27 |
| >COG0052 RpsB Ribosomal protein S2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-73 Score=576.56 Aligned_cols=224 Identities=49% Similarity=0.828 Sum_probs=220.5
Q ss_pred ccchhhhhhhcccccCccccccCCCCcceeecccCCceeecHHHHHHHHHHHHHHHHHHhhcCCEEEEEecChhhHHHHH
Q psy3752 169 SLTPAEKIMQAGVHFGHQTRFWNPKMSSYIFGHRNKIHIINLEKTLYMYEKAIRYIYQLGFSKGTLLFVGTKRQARGVIA 248 (1012)
Q Consensus 169 ~lt~~~~l~~a~~h~Gh~~~~wnp~m~~yi~~~r~g~~ii~l~~t~~~l~~a~~~i~~~~~~~~~ilfv~t~~~~~~~v~ 248 (1012)
.++ +++|+++|+||||++++|||+|++|||+.|||+|||||.+|+.+|+.|+++++.++.+||+|||||||++++++|+
T Consensus 3 ~vs-m~~lLeAGvHfGhqtr~wnpkm~~fIf~~RngihIIDL~kT~~~l~~A~~~v~~~~~~~g~ILfVgTK~~a~~~V~ 81 (252)
T COG0052 3 VVS-MKQLLEAGVHFGHQTRRWNPKMKPFIFGERNGIHIIDLQKTLERLREAYKFLRRIAANGGKILFVGTKKQAQEPVK 81 (252)
T ss_pred cCC-HHHHHHcCccccccccccCCcccccceeecCCcEEEEHHHHHHHHHHHHHHHHHHHcCCCEEEEEechHHHHHHHH
Confidence 367 8999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHcCCCeecCcccCccccChHHHHHHHHHHHHHHhhhccCcccCCCHHHHHHHHHHHHHHHhhhcCccCCCCCCCEE
Q psy3752 249 NEAVRAGMPFIDQRWLGGLLTNFKTIKTSIQRLKEMDLFITNGSIRKLSKKEALLFYRKQMKLNRVIGGIKNMNIIPDAI 328 (1012)
Q Consensus 249 ~~a~~~~~~~v~~rw~~G~lTN~~~~~~~~~~~~~~~~~~~~~~~~~~~kk~~~~~~~~~~kl~~~~~g~~~~~~~P~~~ 328 (1012)
++|++||++||++||+|||||||+||++++++|++++.+..++ |+.|||||.+.+.|+.+||+++|||||+|+++||++
T Consensus 82 ~~A~r~g~~yV~~RwLgG~LTN~~ti~~si~rl~~lE~~~~~~-~~~~tKkE~l~l~re~~kL~k~lgGIk~m~~~Pd~l 160 (252)
T COG0052 82 EFAERTGAYYVNGRWLGGMLTNFKTIRKSIKRLKELEKMEEDG-FDGLTKKEALMLTRELEKLEKSLGGIKDMKGLPDVL 160 (252)
T ss_pred HHHHHhCCceecCcccCccccCchhHHHHHHHHHHHHHHhhcc-cccccHHHHHHHHHHHHHHHHhhcchhhccCCCCEE
Confidence 9999999999999999999999999999999999999999999 999999999999999999999999999999999999
Q ss_pred EEeCCCCchhHHHHHHhcCCCeEEEecCCCCCCcceeeccCCCCchhhHHHHhhhhhhhhhhhhhh
Q psy3752 329 FIIDVGYHKGAVSEAIKLNIPIIGVVDTNHSPDGINYVIPGNDDSAKSIALYTKGIVDAFLDAKTV 394 (1012)
Q Consensus 329 iv~~~~~~~~ai~Ea~~l~iP~i~l~Dt~~~~~~i~~~IP~N~~s~~si~l~~~~l~~ai~~g~~v 394 (1012)
||+||..|++||+||+++||||||+|||||||+.||||||||||+++||.|++|+|++||++|+.-
T Consensus 161 ~ViDp~~e~iAv~EA~klgIPVvAlvDTn~dpd~VD~~IP~Ndda~rsi~Li~~~lA~ai~e~r~~ 226 (252)
T COG0052 161 FVIDPRKEKIAVKEANKLGIPVVALVDTNCDPDGVDYVIPGNDDAIRSIALIYWLLARAILEGRGG 226 (252)
T ss_pred EEeCCcHhHHHHHHHHHcCCCEEEEecCCCCCccCceeecCCChHHHHHHHHHHHHHHHHHHHhcc
Confidence 999999999999999999999999999999999999999999999999999999999999999863
|
|
| >PRK12311 rpsB 30S ribosomal protein S2/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01011 rpsB_bact ribosomal protein S2, bacterial type | Back alignment and domain information |
|---|
| >PRK05299 rpsB 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >CHL00067 rps2 ribosomal protein S2 | Back alignment and domain information |
|---|
| >COG0233 Frr Ribosome recycling factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00318 Ribosomal_S2: Ribosomal protein S2; InterPro: IPR001865 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01425 RPS2 Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome | Back alignment and domain information |
|---|
| >TIGR01012 Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archaeal) | Back alignment and domain information |
|---|
| >PRK00083 frr ribosome recycling factor; Reviewed | Back alignment and domain information |
|---|
| >PRK04020 rps2P 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >PRK09377 tsf elongation factor Ts; Provisional | Back alignment and domain information |
|---|
| >TIGR00116 tsf translation elongation factor Ts | Back alignment and domain information |
|---|
| >TIGR00496 frr ribosome recycling factor | Back alignment and domain information |
|---|
| >PTZ00254 40S ribosomal protein SA; Provisional | Back alignment and domain information |
|---|
| >cd00520 RRF Ribosome recycling factor (RRF) | Back alignment and domain information |
|---|
| >KOG0832|consensus | Back alignment and domain information |
|---|
| >PF01765 RRF: Ribosome recycling factor; InterPro: IPR023584 The ribosome recycling factor or ribosome release factor (RRF) dissociates ribosomes from mRNA after termination of translation, and is essential for bacterial growth [] | Back alignment and domain information |
|---|
| >PRK12332 tsf elongation factor Ts; Reviewed | Back alignment and domain information |
|---|
| >CHL00098 tsf elongation factor Ts | Back alignment and domain information |
|---|
| >KOG4759|consensus | Back alignment and domain information |
|---|
| >KOG1071|consensus | Back alignment and domain information |
|---|
| >COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14556 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14558 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00889 EF_TS: Elongation factor TS; InterPro: IPR014039 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] | Back alignment and domain information |
|---|
| >PRK00358 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14557 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >TIGR02075 pyrH_bact uridylate kinase | Back alignment and domain information |
|---|
| >COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0830|consensus | Back alignment and domain information |
|---|
| >cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >PRK12314 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00489 glutamate 5-kinase; Provisional | Back alignment and domain information |
|---|
| >cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >TIGR02076 pyrH_arch uridylate kinase, putative | Back alignment and domain information |
|---|
| >PRK13402 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >PRK05429 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01027 proB glutamate 5-kinase | Back alignment and domain information |
|---|
| >cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >COG1608 Predicted archaeal kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms | Back alignment and domain information |
|---|
| >cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >KOG1154|consensus | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08841 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >TIGR00746 arcC carbamate kinase | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase | Back alignment and domain information |
|---|
| >PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12353 putative amino acid kinase; Reviewed | Back alignment and domain information |
|---|
| >CHL00202 argB acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02512 acetylglutamate kinase | Back alignment and domain information |
|---|
| >PLN02418 delta-1-pyrroline-5-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
| >PRK12686 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00942 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria | Back alignment and domain information |
|---|
| >cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species | Back alignment and domain information |
|---|
| >cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PRK12352 putative carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08373 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PRK12354 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains | Back alignment and domain information |
|---|
| >PRK09411 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families | Back alignment and domain information |
|---|
| >TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative | Back alignment and domain information |
|---|
| >TIGR00761 argB acetylglutamate kinase | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >PRK05925 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >PRK04531 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0456|consensus | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00116 tsf translation elongation factor Ts | Back alignment and domain information |
|---|
| >PF00889 EF_TS: Elongation factor TS; InterPro: IPR014039 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] | Back alignment and domain information |
|---|
| >PRK09377 tsf elongation factor Ts; Provisional | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >CHL00098 tsf elongation factor Ts | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK12332 tsf elongation factor Ts; Reviewed | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >KOG2436|consensus | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed | Back alignment and domain information |
|---|
| >PRK12570 N-acetylmuramic acid-6-phosphate etherase; Reviewed | Back alignment and domain information |
|---|
| >cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >TIGR00274 N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >PRK06369 nac nascent polypeptide-associated complex protein; Reviewed | Back alignment and domain information |
|---|
| >KOG1147|consensus | Back alignment and domain information |
|---|
| >TIGR00264 alpha-NAC-related protein | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >KOG1071|consensus | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >PRK00414 gmhA phosphoheptose isomerase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >PF13580 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_A 3BJZ_D 2XBL_B 2X3Y_F 2YVA_B 3CVJ_D 3TRJ_D | Back alignment and domain information |
|---|
| >COG2103 Predicted sugar phosphate isomerase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily | Back alignment and domain information |
|---|
| >PRK10886 DnaA initiator-associating protein DiaA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1012 | ||||
| 1p87_B | 240 | Real Space Refined Coordinates Of The 30s Subunit F | 2e-61 | ||
| 1vs5_B | 241 | Crystal Structure Of The Bacterial Ribosome From Es | 2e-61 | ||
| 2gy9_B | 236 | Structure Of The 30s Subunit Of A Pre-Translocation | 2e-61 | ||
| 3fih_B | 218 | Ternary Complex-Bound E.Coli 70s Ribosome. This Ent | 3e-61 | ||
| 4hoj_A | 210 | Crystal Structure Of Glutathione Transferase Homolo | 6e-56 | ||
| 1i94_B | 255 | Crystal Structures Of The Small Ribosomal Subunit W | 7e-54 | ||
| 1fjg_B | 256 | Structure Of The Thermus Thermophilus 30s Ribosomal | 7e-54 | ||
| 1pns_B | 234 | Crystal Structure Of A Streptomycin Dependent Ribos | 8e-54 | ||
| 3fic_B | 235 | T. Thermophilus 70s Ribosome In Complex With Mrna, | 9e-54 | ||
| 2e5l_B | 227 | A Snapshot Of The 30s Ribosomal Subunit Capturing M | 1e-53 | ||
| 1x18_E | 231 | Contact Sites Of Era Gtpase On The Thermus Thermoph | 8e-52 | ||
| 1ybd_A | 239 | Crystal Structure Analysis Of Uridylate Kinase From | 8e-44 | ||
| 3ek5_A | 243 | Unique Gtp-Binding Pocket And Allostery Of Ump Kina | 1e-43 | ||
| 3bbn_B | 231 | Homology Model For The Spinach Chloroplast 30s Subu | 1e-41 | ||
| 2bnd_A | 241 | The Structure Of E.Coli Ump Kinase In Complex With | 1e-39 | ||
| 2bne_A | 241 | The Structure Of E. Coli Ump Kinase In Complex With | 1e-39 | ||
| 3nwy_A | 281 | Structure And Allosteric Regulation Of The Uridine | 7e-39 | ||
| 2a1f_A | 247 | Crystal Structure Of Uridylate Kinase Length = 247 | 5e-38 | ||
| 2bnf_A | 241 | The Structure Of E. Coli Ump Kinase In Complex With | 2e-35 | ||
| 1is1_A | 185 | Crystal Structure Of Ribosome Recycling Factor From | 8e-35 | ||
| 1ek8_A | 185 | Crystal Structure Of The Ribosome Recycling Factor | 7e-33 | ||
| 4gd1_Y | 183 | Structures Of The Bacterial Ribosome In Classical A | 1e-32 | ||
| 1ise_A | 185 | Crystal Structure Of A Mutant Of Ribosome Recycling | 6e-32 | ||
| 4a7w_A | 240 | Crystal Structure Of Uridylate Kinase From Helicoba | 4e-31 | ||
| 1eh1_A | 185 | Ribosome Recycling Factor From Thermus Thermophilus | 9e-31 | ||
| 1yy7_A | 213 | Crystal Structure Of Stringent Starvation Protein A | 1e-30 | ||
| 4gfq_A | 209 | 2.65 Angstrom Resolution Crystal Structure Of Ribos | 2e-30 | ||
| 2jjx_A | 255 | The Crystal Structure Of Ump Kinase From Bacillus A | 3e-30 | ||
| 2va1_A | 256 | Crystal Structure Of Ump Kinase From Ureaplasma Par | 2e-29 | ||
| 3lyk_A | 216 | Structure Of Stringent Starvation Protein A Homolog | 3e-29 | ||
| 1z9d_A | 252 | Crystal Structure Of A Putative Uridylate Kinase (U | 4e-29 | ||
| 3lyp_A | 215 | Structure Of Stringent Starvation Protein A Homolog | 8e-29 | ||
| 3agp_A | 1289 | Structure Of Viral Polymerase Form I Length = 1289 | 8e-28 | ||
| 3mmp_A | 678 | Structure Of The Qb Replicase, An Rna-Dependent Rna | 9e-28 | ||
| 1efu_B | 282 | Elongation Factor Complex Ef-TuEF-Ts From Escherich | 8e-27 | ||
| 4dej_A | 231 | Crystal Structure Of Glutathione Transferase-Like P | 9e-27 | ||
| 1wqf_A | 185 | Crystal Structure Of Ribosome Recycling Factor From | 2e-26 | ||
| 1dd5_A | 185 | Crystal Structure Of Thermotoga Maritima Ribosome R | 2e-25 | ||
| 3mdk_A | 217 | Structure Of Stringent Starvation Protein A (Sspa) | 2e-25 | ||
| 1ge9_A | 184 | Solution Structure Of The Ribosome Recycling Factor | 2e-23 | ||
| 1aip_C | 196 | Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt | 8e-11 | ||
| 1aip_C | 196 | Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt | 1e-04 | ||
| 1eem_A | 241 | Glutathione Transferase From Homo Sapiens Length = | 5e-10 | ||
| 3vln_A | 241 | Human Glutathione Transferase O1-1 C32s Mutant In C | 5e-10 | ||
| 3lfl_A | 240 | Crystal Structure Of Human Glutathione Transferase | 6e-10 | ||
| 3qag_A | 239 | Human Glutathione Transferase O2 With Glutathione - | 8e-10 | ||
| 1y69_8 | 113 | Rrf Domain I In Complex With The 50s Ribosomal Subu | 6e-09 | ||
| 1xb2_B | 291 | Crystal Structure Of Bos Taurus Mitochondrial Elong | 3e-08 | ||
| 3qav_A | 243 | Crystal Structure Of A Glutathione S-transferase Fr | 2e-07 | ||
| 1vi6_A | 208 | Crystal Structure Of Ribosomal Protein S2p Length = | 6e-07 | ||
| 1aw9_A | 216 | Structure Of Glutathione S-Transferase Iii In Apo F | 2e-06 | ||
| 1vi5_A | 208 | Crystal Structure Of Ribosomal Protein S2p Length = | 2e-06 | ||
| 4iq1_A | 231 | Crystal Structure Of Glutathione S-transferase Mha_ | 2e-05 | ||
| 3uap_A | 227 | Crystal Structure Of Glutathione Transferase (Targe | 3e-05 | ||
| 1tfe_A | 145 | Dimerization Domain Of Ef-Ts From T. Thermophilus L | 7e-05 | ||
| 1tfe_A | 145 | Dimerization Domain Of Ef-Ts From T. Thermophilus L | 1e-04 | ||
| 3lf9_A | 121 | Crystal Structure Of Hiv Epitope-Scaffold 4e10_d0_1 | 1e-04 | ||
| 4j2f_A | 223 | Crystal Structure Of A Glutathione Transferase Fami | 1e-04 | ||
| 2vo4_A | 219 | Glutathione Transferase From Glycine Max Length = 2 | 3e-04 | ||
| 4g9h_A | 211 | Crystal Structure Of Glutahtione S-Transferase Homo | 4e-04 | ||
| 3tot_A | 226 | Crystal Structure Of Glutathione Transferase (Targe | 4e-04 | ||
| 1oyj_A | 231 | Crystal Structure Solution Of Rice Gst1 (Osgstu1) I | 9e-04 |
| >pdb|1P87|B Chain B, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome Length = 240 | Back alignment and structure |
|
| >pdb|1VS5|B Chain B, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 241 | Back alignment and structure |
| >pdb|2GY9|B Chain B, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 236 | Back alignment and structure |
| >pdb|3FIH|B Chain B, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 218 | Back alignment and structure |
| >pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 | Back alignment and structure |
| >pdb|1I94|B Chain B, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 255 | Back alignment and structure |
| >pdb|1FJG|B Chain B, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 256 | Back alignment and structure |
| >pdb|1PNS|B Chain B, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 234 | Back alignment and structure |
| >pdb|3FIC|B Chain B, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 235 | Back alignment and structure |
| >pdb|2E5L|B Chain B, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction Length = 227 | Back alignment and structure |
| >pdb|1X18|E Chain E, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 231 | Back alignment and structure |
| >pdb|1YBD|A Chain A, Crystal Structure Analysis Of Uridylate Kinase From Neisseria Meningitidis Length = 239 | Back alignment and structure |
| >pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram- Negative Phytopathogen Bacterium Length = 243 | Back alignment and structure |
| >pdb|3BBN|B Chain B, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 231 | Back alignment and structure |
| >pdb|2BND|A Chain A, The Structure Of E.Coli Ump Kinase In Complex With Udp Length = 241 | Back alignment and structure |
| >pdb|2BNE|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Ump Length = 241 | Back alignment and structure |
| >pdb|3NWY|A Chain A, Structure And Allosteric Regulation Of The Uridine Monophosphate Kinase From Mycobacterium Tuberculosis Length = 281 | Back alignment and structure |
| >pdb|2A1F|A Chain A, Crystal Structure Of Uridylate Kinase Length = 247 | Back alignment and structure |
| >pdb|2BNF|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Utp Length = 241 | Back alignment and structure |
| >pdb|1IS1|A Chain A, Crystal Structure Of Ribosome Recycling Factor From Vibrio Parahaemolyticus Length = 185 | Back alignment and structure |
| >pdb|1EK8|A Chain A, Crystal Structure Of The Ribosome Recycling Factor (Rrf) From Escherichia Coli Length = 185 | Back alignment and structure |
| >pdb|4GD1|Y Chain Y, Structures Of The Bacterial Ribosome In Classical And Hybrid States Of Trna Binding Length = 183 | Back alignment and structure |
| >pdb|1ISE|A Chain A, Crystal Structure Of A Mutant Of Ribosome Recycling Factor From Escherichia Coli, Arg132gly Length = 185 | Back alignment and structure |
| >pdb|4A7W|A Chain A, Crystal Structure Of Uridylate Kinase From Helicobacter Pylori Length = 240 | Back alignment and structure |
| >pdb|1EH1|A Chain A, Ribosome Recycling Factor From Thermus Thermophilus Length = 185 | Back alignment and structure |
| >pdb|1YY7|A Chain A, Crystal Structure Of Stringent Starvation Protein A (Sspa), An Rna Polymerase-Associated Transcription Factor Length = 213 | Back alignment and structure |
| >pdb|4GFQ|A Chain A, 2.65 Angstrom Resolution Crystal Structure Of Ribosome Recycling Factor (Frr) From Bacillus Anthracis Length = 209 | Back alignment and structure |
| >pdb|2JJX|A Chain A, The Crystal Structure Of Ump Kinase From Bacillus Anthracis (Ba1797) Length = 255 | Back alignment and structure |
| >pdb|2VA1|A Chain A, Crystal Structure Of Ump Kinase From Ureaplasma Parvum Length = 256 | Back alignment and structure |
| >pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 | Back alignment and structure |
| >pdb|1Z9D|A Chain A, Crystal Structure Of A Putative Uridylate Kinase (Ump-Kinase) From Streptococcus Pyogenes Length = 252 | Back alignment and structure |
| >pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 | Back alignment and structure |
| >pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 | Back alignment and structure |
| >pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 | Back alignment and structure |
| >pdb|1EFU|B Chain B, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 282 | Back alignment and structure |
| >pdb|4DEJ|A Chain A, Crystal Structure Of Glutathione Transferase-Like Protein Il0419 (Target Efi-501089) From Idiomarina Loihiensis L2tr Length = 231 | Back alignment and structure |
| >pdb|1WQF|A Chain A, Crystal Structure Of Ribosome Recycling Factor From Mycobacterium Tuberculosis Length = 185 | Back alignment and structure |
| >pdb|1DD5|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Recycling Factor, Rrf Length = 185 | Back alignment and structure |
| >pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseudomonas Putida Length = 217 | Back alignment and structure |
| >pdb|1GE9|A Chain A, Solution Structure Of The Ribosome Recycling Factor Length = 184 | Back alignment and structure |
| >pdb|1AIP|C Chain C, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 196 | Back alignment and structure |
| >pdb|1AIP|C Chain C, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 196 | Back alignment and structure |
| >pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 | Back alignment and structure |
| >pdb|3VLN|A Chain A, Human Glutathione Transferase O1-1 C32s Mutant In Complex With Ascorbic Acid Length = 241 | Back alignment and structure |
| >pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 | Back alignment and structure |
| >pdb|3QAG|A Chain A, Human Glutathione Transferase O2 With Glutathione -New Crystal Form Length = 239 | Back alignment and structure |
| >pdb|1Y69|8 Chain 8, Rrf Domain I In Complex With The 50s Ribosomal Subunit From Deinococcus Radiodurans Length = 113 | Back alignment and structure |
| >pdb|1XB2|B Chain B, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 291 | Back alignment and structure |
| >pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 | Back alignment and structure |
| >pdb|1VI6|A Chain A, Crystal Structure Of Ribosomal Protein S2p Length = 208 | Back alignment and structure |
| >pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 | Back alignment and structure |
| >pdb|1VI5|A Chain A, Crystal Structure Of Ribosomal Protein S2p Length = 208 | Back alignment and structure |
| >pdb|4IQ1|A Chain A, Crystal Structure Of Glutathione S-transferase Mha_0454 (target Efi- 507015) From Mannheimia Haemolytica, Substrate-free Length = 231 | Back alignment and structure |
| >pdb|3UAP|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501774) From Methylococcus Capsulatus Str. Bath Length = 227 | Back alignment and structure |
| >pdb|1TFE|A Chain A, Dimerization Domain Of Ef-Ts From T. Thermophilus Length = 145 | Back alignment and structure |
| >pdb|1TFE|A Chain A, Dimerization Domain Of Ef-Ts From T. Thermophilus Length = 145 | Back alignment and structure |
| >pdb|3LF9|A Chain A, Crystal Structure Of Hiv Epitope-Scaffold 4e10_d0_1is1a_001_c Length = 121 | Back alignment and structure |
| >pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Ricinus Communis, Target Efi-501866 Length = 223 | Back alignment and structure |
| >pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 | Back alignment and structure |
| >pdb|4G9H|A Chain A, Crystal Structure Of Glutahtione S-Transferase Homolog From Yersinia Pestis, Target Efi-501894, With Bound Glutathione Length = 211 | Back alignment and structure |
| >pdb|3TOT|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501058) From Ralstonia Solanacearum Gmi1000 Length = 226 | Back alignment and structure |
| >pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione. Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1012 | |||
| 3r8n_B | 218 | 30S ribosomal protein S2; protein biosynthesis, RN | 1e-119 | |
| 2vqe_B | 256 | 30S ribosomal protein S2; tRNA-binding, rRNA-bindi | 1e-118 | |
| 3bbn_B | 231 | Ribosomal protein S2; small ribosomal subunit, spi | 1e-117 | |
| 2a1f_A | 247 | Uridylate kinase; PYRH, structural genomics, PSI, | 8e-75 | |
| 3ek6_A | 243 | Uridylate kinase; UMPK unique GTP B site, alloster | 1e-74 | |
| 1ybd_A | 239 | Uridylate kinase; alpha/beta/alpha fold, hexamer, | 2e-73 | |
| 3nwy_A | 281 | Uridylate kinase; allosterically activated form, A | 4e-73 | |
| 2va1_A | 256 | Uridylate kinase; UMPK, transferase, pyrimidine bi | 5e-73 | |
| 4a7w_A | 240 | Uridylate kinase; transferase; HET: GTP; 1.80A {He | 1e-72 | |
| 1z9d_A | 252 | Uridylate kinase, UK, UMP kinase; structural genom | 6e-72 | |
| 2ogx_B | 270 | Molybdenum storage protein subunit beta; open alph | 1e-71 | |
| 2jjx_A | 255 | Uridylate kinase, UMP kinase; structural genomics, | 7e-70 | |
| 1eh1_A | 185 | Ribosome recycling factor; translation, hinge vari | 6e-69 | |
| 1is1_A | 185 | Ribosome recycling factor; translation; 2.20A {Vib | 2e-68 | |
| 4gfq_A | 209 | Ribosome-recycling factor; structural genomics, ni | 2e-68 | |
| 1wqg_A | 185 | Ribosome recycling factor; translation factor, tri | 3e-68 | |
| 1ise_A | 185 | Ribosome recycling factor; translation; 2.20A {Esc | 5e-68 | |
| 1dd5_A | 185 | Ribosome recycling factor; three-helix bundle, bet | 5e-68 | |
| 2brx_A | 244 | Uridylate kinase; UMP kinase, amino acid kinase, p | 1e-67 | |
| 2j4j_A | 226 | Uridylate kinase; transferase, nucleoside monophos | 2e-67 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-64 | |
| 2ij9_A | 219 | Uridylate kinase; structural genomics, protein str | 2e-62 | |
| 1ge9_A | 184 | Ribosome recycling factor; three-helix bundle; NMR | 5e-62 | |
| 1xb2_B | 291 | EF-TS, elongation factor TS, mitochondrial, EF-TSM | 7e-61 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 1e-60 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 3e-60 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 9e-58 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 2e-56 | |
| 1vi6_A | 208 | 30S ribosomal protein S2P; structural genomics, ri | 3e-56 | |
| 2xzm_B | 241 | RPS0E; ribosome, translation; 3.93A {Tetrahymena t | 3e-52 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 6e-52 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 4e-51 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 5e-50 | |
| 3u5c_A | 252 | 40S ribosomal protein S0-A; translation, ribosome, | 9e-50 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 1e-49 | |
| 2ogx_A | 276 | Molybdenum storage protein subunit alpha; open alp | 3e-49 | |
| 2zkq_b | 295 | 40S ribosomal protein SA; protein-RNA complex, 40S | 3e-48 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 5e-48 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 2e-47 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 4e-47 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 5e-47 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 7e-47 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 3e-43 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 8e-47 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 5e-46 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 1e-45 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 1e-45 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 2e-45 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 5e-45 | |
| 3bch_A | 253 | 40S ribosomal protein SA; laminin receptor, P40 ri | 4e-44 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 2e-42 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 2e-41 | |
| 3lhp_S | 123 | 4E10_D0_1ISEA_004_N (T93); epitope-scaffold, immun | 2e-41 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 2e-41 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 1e-40 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 1e-38 | |
| 3lf9_A | 121 | 4E10_D0_1IS1A_001_C (T161); epitope-scaffold, immu | 1e-37 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 8e-35 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 1e-32 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 3e-32 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 7e-31 | |
| 1aip_C | 196 | EF-TS, elongation factor TS; nucleotide exchange, | 1e-28 | |
| 1aip_C | 196 | EF-TS, elongation factor TS; nucleotide exchange, | 2e-18 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 3e-26 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 4e-26 | |
| 3k4o_A | 266 | Isopentenyl phosphate kinase; small molecule kinas | 1e-25 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 3e-25 | |
| 1wih_A | 84 | Mitochondrial ribosome recycling factor; structura | 2e-23 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 8e-23 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 1e-21 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 5e-21 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 8e-21 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 2e-20 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 5e-20 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 7e-20 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 9e-20 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 2e-19 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 4e-19 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 4e-19 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 9e-19 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 1e-18 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 3e-18 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 4e-18 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 5e-17 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 2e-16 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 8e-16 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 1e-14 | |
| 1tfe_A | 145 | Elongation factor TS; 1.70A {Thermus thermophilus} | 4e-14 | |
| 1tfe_A | 145 | Elongation factor TS; 1.70A {Thermus thermophilus} | 3e-10 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 7e-14 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 3e-13 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 3e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 9e-12 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 1e-11 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 1e-11 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 2e-11 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 3e-11 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 5e-11 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 9e-11 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 1e-10 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 2e-10 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 2e-10 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 2e-10 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 2e-10 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 2e-10 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 3e-10 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 3e-10 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 6e-10 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 6e-10 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 7e-10 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 9e-10 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 2e-09 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 2e-09 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 2e-09 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 3e-09 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 3e-09 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 4e-09 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 5e-09 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 1e-08 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 1e-08 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 2e-08 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 2e-08 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 3e-08 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 3e-08 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 1e-07 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 1e-07 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 1e-07 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 2e-07 | |
| 3d40_A | 286 | FOMA protein; fosfomycin, antibiotic resistance, k | 2e-07 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 3e-07 | |
| 3ll5_A | 249 | Gamma-glutamyl kinase related protein; alternate m | 1e-06 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 2e-06 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 3e-06 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 3e-06 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 1e-05 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 3e-05 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 6e-05 |
| >2vqe_B 30S ribosomal protein S2; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.23.15.1 PDB: 1gix_E* 1hnw_B* 1hnx_B* 1hnz_B* 1hr0_B 1ibk_B* 1ibl_B* 1ibm_B 1j5e_B 1jgo_E* 1jgp_E* 1jgq_E* 1ml5_E* 1n32_B* 1n33_B* 1n34_B 1n36_B 1xmo_B* 1xmq_B* 1xnq_B* ... Length = 256 | Back alignment and structure |
|---|
| >3bbn_B Ribosomal protein S2; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 231 | Back alignment and structure |
|---|
| >2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 | Back alignment and structure |
|---|
| >3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 | Back alignment and structure |
|---|
| >1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 | Back alignment and structure |
|---|
| >3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 | Back alignment and structure |
|---|
| >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 | Back alignment and structure |
|---|
| >4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Length = 240 | Back alignment and structure |
|---|
| >1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 | Back alignment and structure |
|---|
| >2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 | Back alignment and structure |
|---|
| >2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 | Back alignment and structure |
|---|
| >1eh1_A Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus} SCOP: d.67.3.1 PDB: 2qbe_6 2qbg_6 2qbi_6* 2qbk_6* 2v46_Y* 2v48_Y* 2z4l_6* 2z4n_6* 3j0d_J 3j0e_G Length = 185 | Back alignment and structure |
|---|
| >1is1_A Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus} SCOP: d.67.3.1 PDB: 3r8n_Y Length = 185 | Back alignment and structure |
|---|
| >4gfq_A Ribosome-recycling factor; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Bacillus anthracis} Length = 209 | Back alignment and structure |
|---|
| >1wqg_A Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis, translation; 2.15A {Mycobacterium tuberculosis} SCOP: d.67.3.1 PDB: 1wqf_A 1wqh_A Length = 185 | Back alignment and structure |
|---|
| >1ise_A Ribosome recycling factor; translation; 2.20A {Escherichia coli} SCOP: d.67.3.1 PDB: 1ek8_A* 1zn0_A 1zn1_A 2rdo_8 Length = 185 | Back alignment and structure |
|---|
| >1dd5_A Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima} SCOP: d.67.3.1 PDB: 1t1m_C Length = 185 | Back alignment and structure |
|---|
| >2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 | Back alignment and structure |
|---|
| >2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Length = 219 | Back alignment and structure |
|---|
| >1ge9_A Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus} SCOP: d.67.3.1 Length = 184 | Back alignment and structure |
|---|
| >1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Length = 291 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >1vi6_A 30S ribosomal protein S2P; structural genomics, ribosome; 1.95A {Archaeoglobus fulgidus} SCOP: c.23.15.1 PDB: 1vi5_A Length = 208 | Back alignment and structure |
|---|
| >2xzm_B RPS0E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_B Length = 241 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >3u5c_A 40S ribosomal protein S0-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_A 3o30_A 3o2z_A 3u5g_A 3jyv_B* 1s1h_B Length = 252 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 | Back alignment and structure |
|---|
| >2zkq_b 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 295 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >3bch_A 40S ribosomal protein SA; laminin receptor, P40 ribosomal protein, acetylation, cytoplasm, phosphorylation, polymorphism; 2.15A {Homo sapiens} Length = 253 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >3lhp_S 4E10_D0_1ISEA_004_N (T93); epitope-scaffold, immune system; 2.70A {Artificial gene} PDB: 1y69_8 Length = 123 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3lf9_A 4E10_D0_1IS1A_001_C (T161); epitope-scaffold, immune system; 2.00A {Artificial gene} Length = 121 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Length = 196 | Back alignment and structure |
|---|
| >1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Length = 196 | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >1wih_A Mitochondrial ribosome recycling factor; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.67.3.1 Length = 84 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >1tfe_A Elongation factor TS; 1.70A {Thermus thermophilus} SCOP: d.43.1.1 Length = 145 | Back alignment and structure |
|---|
| >1tfe_A Elongation factor TS; 1.70A {Thermus thermophilus} SCOP: d.43.1.1 Length = 145 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Length = 64 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Length = 421 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Length = 600 | Back alignment and structure |
|---|
| >3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Length = 286 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Length = 446 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Length = 510 | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Length = 449 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1012 | ||||
| d2gy9b1 | 218 | c.23.15.1 (B:8-225) Ribosomal protein S2 {Escheric | 3e-64 | |
| d2uubb1 | 234 | c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus | 2e-63 | |
| d1wqga1 | 183 | d.67.3.1 (A:2-184) Ribosome recycling factor, RRF | 4e-44 | |
| d1eh1a_ | 185 | d.67.3.1 (A:) Ribosome recycling factor, RRF {Ther | 3e-43 | |
| d1is1a_ | 185 | d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibr | 4e-43 | |
| d1vi6a_ | 193 | c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Arch | 8e-42 | |
| d1ek8a_ | 185 | d.67.3.1 (A:) Ribosome recycling factor, RRF {Esch | 3e-41 | |
| d1dd5a_ | 184 | d.67.3.1 (A:) Ribosome recycling factor, RRF {Ther | 2e-40 | |
| d1ge9a_ | 184 | d.67.3.1 (A:) Ribosome recycling factor, RRF {Aqui | 1e-38 | |
| d2a1fa1 | 236 | c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi | 4e-36 | |
| d1ybda1 | 236 | c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri | 9e-35 | |
| d1z9da1 | 238 | c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc | 2e-32 | |
| d2ij9a1 | 219 | c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog | 1e-28 | |
| d1xb2b2 | 111 | d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), | 2e-23 | |
| d1efub4 | 85 | d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), | 1e-22 | |
| d1wiha_ | 84 | d.67.3.1 (A:) Ribosome recycling factor, RRF {Mous | 2e-19 | |
| d2brxa1 | 225 | c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc | 3e-19 | |
| d1eema1 | 139 | a.45.1.1 (A:103-241) Class omega GST {Human (Homo | 5e-15 | |
| d1oyja1 | 145 | a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat | 4e-14 | |
| d2cdqa1 | 304 | c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Ar | 5e-14 | |
| d1gwca1 | 138 | a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch | 5e-14 | |
| d1efub2 | 143 | d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), | 8e-13 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 1e-11 | |
| d1xb2b1 | 56 | a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N | 2e-11 | |
| d1efub3 | 54 | a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-t | 2e-11 | |
| d1aipc1 | 52 | a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-t | 2e-11 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 9e-11 | |
| d2hmfa1 | 302 | c.73.1.3 (A:2-303) Aspartokinase {Methanococcus ja | 1e-10 | |
| d1k0ma1 | 149 | a.45.1.1 (A:92-240) Chloride intracellular channel | 4e-10 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 6e-10 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 7e-10 | |
| d2j0wa1 | 292 | c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli | 7e-10 | |
| d1fw1a1 | 125 | a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa | 1e-09 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 1e-09 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 2e-09 | |
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 3e-09 | |
| d1k0ma2 | 86 | c.47.1.5 (A:6-91) Chloride intracellular channel 1 | 5e-09 | |
| d1gnwa1 | 126 | a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress | 6e-09 | |
| d1tfea_ | 142 | d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimeri | 2e-08 | |
| d1tfea_ | 142 | d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimeri | 4e-05 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 2e-08 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 2e-08 | |
| d1aw9a1 | 135 | a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays | 2e-08 | |
| d2cvda1 | 124 | a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s | 3e-08 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 3e-08 | |
| d1nhya1 | 144 | a.45.1.1 (A:76-219) GST-like domain of elongation | 6e-08 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 3e-07 | |
| d2gsqa1 | 127 | a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast | 3e-07 | |
| d2a2ra1 | 132 | a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi | 8e-07 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 9e-07 | |
| d2gsta1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv | 1e-06 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 2e-06 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 2e-06 | |
| d3gtub1 | 140 | a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi | 3e-06 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 3e-06 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 4e-06 | |
| d1xb2b3 | 109 | d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), | 5e-06 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 8e-06 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 9e-06 | |
| d1gsua1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus | 9e-06 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 2e-05 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 2e-05 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 3e-05 | |
| d2c4ja1 | 133 | a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi | 4e-05 | |
| d1duga1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j | 8e-05 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 1e-04 | |
| d2fhea1 | 136 | a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa | 1e-04 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 2e-04 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 4e-04 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 4e-04 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 6e-04 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 0.001 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 0.001 | |
| d1tu7a1 | 131 | a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu | 0.002 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 0.002 | |
| d1okta1 | 126 | a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla | 0.003 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 0.003 |
| >d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} Length = 218 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Ribosomal protein S2 family: Ribosomal protein S2 domain: Ribosomal protein S2 species: Escherichia coli [TaxId: 562]
Score = 214 bits (545), Expect = 3e-64
Identities = 102/217 (47%), Positives = 153/217 (70%)
Query: 177 MQAGVHFGHQTRFWNPKMSSYIFGHRNKIHIINLEKTLYMYEKAIRYIYQLGFSKGTLLF 236
++AGVHFGHQTR+WNPKM +IFG RNK+HIINLEKT+ M+ +A+ + ++ KG +LF
Sbjct: 2 LKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILF 61
Query: 237 VGTKRQARGVIANEAVRAGMPFIDQRWLGGLLTNFKTIKTSIQRLKEMDLFITNGSIRKL 296
VGTKR A + + A+ F++ RWLGG+LTN+KT++ SI+RLK+++ +G+ KL
Sbjct: 62 VGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKL 121
Query: 297 SKKEALLFYRKQMKLNRVIGGIKNMNIIPDAIFIIDVGYHKGAVSEAIKLNIPIIGVVDT 356
+KKEAL+ R+ KL +GGIK+M +PDA+F+ID + A+ EA L IP+ +VDT
Sbjct: 122 TKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDT 181
Query: 357 NHSPDGINYVIPGNDDSAKSIALYTKGIVDAFLDAKT 393
N PDG+++VIPGNDD+ +++ LY + + ++
Sbjct: 182 NSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRS 218
|
| >d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} Length = 234 | Back information, alignment and structure |
|---|
| >d1wqga1 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 | Back information, alignment and structure |
|---|
| >d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} Length = 185 | Back information, alignment and structure |
|---|
| >d1is1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibrio parahaemolyticus [TaxId: 670]} Length = 185 | Back information, alignment and structure |
|---|
| >d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 193 | Back information, alignment and structure |
|---|
| >d1ek8a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]} Length = 185 | Back information, alignment and structure |
|---|
| >d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima [TaxId: 2336]} Length = 184 | Back information, alignment and structure |
|---|
| >d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus [TaxId: 63363]} Length = 184 | Back information, alignment and structure |
|---|
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 | Back information, alignment and structure |
|---|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 | Back information, alignment and structure |
|---|
| >d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 111 | Back information, alignment and structure |
|---|
| >d1efub4 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Length = 85 | Back information, alignment and structure |
|---|
| >d1wiha_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Length = 84 | Back information, alignment and structure |
|---|
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 | Back information, alignment and structure |
|---|
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 304 | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 | Back information, alignment and structure |
|---|
| >d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Length = 143 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 56 | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 54 | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 52 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 302 | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 292 | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 | Back information, alignment and structure |
|---|
| >d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} Length = 142 | Back information, alignment and structure |
|---|
| >d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} Length = 142 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 109 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1012 | |||
| d2uubb1 | 234 | Ribosomal protein S2 {Thermus thermophilus [TaxId: | 100.0 | |
| d2gy9b1 | 218 | Ribosomal protein S2 {Escherichia coli [TaxId: 562 | 100.0 | |
| d1is1a_ | 185 | Ribosome recycling factor, RRF {Vibrio parahaemoly | 100.0 | |
| d1wqga1 | 183 | Ribosome recycling factor, RRF {Mycobacterium tube | 100.0 | |
| d1dd5a_ | 184 | Ribosome recycling factor, RRF {Thermotoga maritim | 100.0 | |
| d1ek8a_ | 185 | Ribosome recycling factor, RRF {Escherichia coli [ | 100.0 | |
| d1vi6a_ | 193 | Ribosomal protein S2 {Archaeon Archaeoglobus fulgi | 100.0 | |
| d1eh1a_ | 185 | Ribosome recycling factor, RRF {Thermus thermophil | 100.0 | |
| d1ge9a_ | 184 | Ribosome recycling factor, RRF {Aquifex aeolicus [ | 100.0 | |
| d2a1fa1 | 236 | Uridylate kinase PyrH {Haemophilus influenzae [Tax | 99.97 | |
| d2brxa1 | 225 | Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: | 99.96 | |
| d1ybda1 | 236 | Uridylate kinase PyrH {Neisseria meningitidis [Tax | 99.96 | |
| d2ij9a1 | 219 | Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax | 99.96 | |
| d1z9da1 | 238 | Uridylate kinase PyrH {Streptococcus pyogenes [Tax | 99.94 | |
| d2akoa1 | 250 | Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 | 99.92 | |
| d1wiha_ | 84 | Ribosome recycling factor, RRF {Mouse (Mus musculu | 99.92 | |
| d2ap9a1 | 291 | N-acetyl-l-glutamate kinase {Mycobacterium tubercu | 99.88 | |
| d2bufa1 | 300 | N-acetyl-l-glutamate kinase {Pseudomonas aeruginos | 99.87 | |
| d2btya1 | 282 | N-acetyl-l-glutamate kinase {Thermotoga maritima [ | 99.87 | |
| d2j0wa1 | 292 | Aspartokinase {Escherichia coli [TaxId: 562]} | 99.87 | |
| d1xb2b2 | 111 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.87 | |
| d1e19a_ | 313 | Carbamate kinase {Archaeon Pyrococcus furiosus [Ta | 99.86 | |
| d2hmfa1 | 302 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 99.86 | |
| d2cdqa1 | 304 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 99.86 | |
| d1efub4 | 85 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.82 | |
| d1tfea_ | 142 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.82 | |
| d1b7ba_ | 307 | Carbamate kinase {Enterococcus faecium [TaxId: 135 | 99.81 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 99.73 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 99.72 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 99.71 | |
| d1gs5a_ | 258 | N-acetyl-l-glutamate kinase {Escherichia coli [Tax | 99.69 | |
| d1xb2b3 | 109 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.59 | |
| d1efub2 | 143 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.58 | |
| d1efub2 | 143 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.55 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.5 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.49 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.48 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.47 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.45 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.43 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.43 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.41 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.41 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.41 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.4 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.39 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.38 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.38 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.38 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.37 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.37 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.37 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.37 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.35 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.34 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.34 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.34 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.29 | |
| d1tfea_ | 142 | Elongation factor Ts (EF-Ts), dimerisation domain | 99.28 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.28 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.26 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.23 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.22 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.18 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.17 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.13 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.1 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.07 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.07 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.07 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.07 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.05 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.04 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.03 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.03 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.01 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.0 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.0 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.0 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.94 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 98.93 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 98.91 | |
| d1xb2b3 | 109 | Elongation factor Ts (EF-Ts), dimerisation domain | 98.86 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 98.86 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 98.84 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 98.75 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 98.7 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.67 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 98.65 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 98.64 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.62 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 98.57 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 98.57 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 98.57 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 98.56 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 98.55 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 98.53 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 98.53 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.52 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 98.5 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 98.37 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 98.27 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 97.78 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.77 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.76 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 94.72 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 94.56 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 94.51 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 94.48 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 94.02 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 93.27 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 93.26 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 92.47 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.65 | |
| d1x94a_ | 191 | Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T | 91.6 | |
| d1x92a_ | 194 | Phosphoheptose isomerase GmhA1 {Pseudomonas aerugi | 91.57 | |
| d1tk9a_ | 188 | Phosphoheptose isomerase GmhA1 {Campylobacter jeju | 91.52 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 91.47 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 91.45 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 91.11 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 90.9 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 90.82 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 88.78 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 83.86 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 83.2 |
| >d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Ribosomal protein S2 family: Ribosomal protein S2 domain: Ribosomal protein S2 species: Thermus thermophilus [TaxId: 274]
Probab=100.00 E-value=1.1e-65 Score=535.34 Aligned_cols=221 Identities=44% Similarity=0.801 Sum_probs=217.9
Q ss_pred hhhhhhcccccCccccccCCCCcceeecccCCceeecHHHHHHHHHHHHHHHHHHhhcCCEEEEEecChhhHHHHHHHHH
Q psy3752 173 AEKIMQAGVHFGHQTRFWNPKMSSYIFGHRNKIHIINLEKTLYMYEKAIRYIYQLGFSKGTLLFVGTKRQARGVIANEAV 252 (1012)
Q Consensus 173 ~~~l~~a~~h~Gh~~~~wnp~m~~yi~~~r~g~~ii~l~~t~~~l~~a~~~i~~~~~~~~~ilfv~t~~~~~~~v~~~a~ 252 (1012)
+++|+++|+||||++++|||+|++||||.|+|+|||||++|+.+|++|+++|..++++||+||||||+++++++|+++|+
T Consensus 1 I~~ll~ag~H~Gh~~~~wnpkm~~yIyg~rngihIIdL~kT~~~L~~A~~~i~~~~~~~g~iLfVgTk~~~~~~i~~~A~ 80 (234)
T d2uubb1 1 VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAE 80 (234)
T ss_dssp CCCSSCTTSTTBCCCSCCCGGGGGGEEEEETTEEEECHHHHHHHHHHHHHHHHHHHHTTCCEEEECCSSSSHHHHHHHHH
T ss_pred ChhHHhCCCcccCCcCcCCCCCccceecccCCcEEEcHHHHHHHHHHHHHHHHHHHhcCCceeEEeccHHHHHHHHHHHH
Confidence 35789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HcCCCeecCcccCccccChHHHHHHHHHHHHHHhhhccCcccCCCHHHHHHHHHHHHHHHhhhcCccCCCCCCCEEEEeC
Q psy3752 253 RAGMPFIDQRWLGGLLTNFKTIKTSIQRLKEMDLFITNGSIRKLSKKEALLFYRKQMKLNRVIGGIKNMNIIPDAIFIID 332 (1012)
Q Consensus 253 ~~~~~~v~~rw~~G~lTN~~~~~~~~~~~~~~~~~~~~~~~~~~~kk~~~~~~~~~~kl~~~~~g~~~~~~~P~~~iv~~ 332 (1012)
+||++||++||+|||||||.|+++++++|++++....++.++.+||||...+.|++.||+++|+|+++|+++||+|||+|
T Consensus 81 ~~~~~yv~~RWlgG~LTN~~ti~~~i~~l~~l~~~~~~~~~~~~tkke~~~~~~~~~kl~k~~~Gi~~m~~~Pd~viv~d 160 (234)
T d2uubb1 81 RAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVD 160 (234)
T ss_dssp SSSCCEECSCCCTTTTTTHHHHHHHHHHHHHHHHHHSSTTGGGSCHHHHTHHHHHHHHHHHHSTTGGGCSSCCSEEEESC
T ss_pred HhCCEEeccceeCCccccccccchhhhhhHHHHHHhhcCcccccchHHHHHHHHHHHHHHHhhccchhhhhcceeEEEec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCchhHHHHHHhcCCCeEEEecCCCCCCcceeeccCCCCchhhHHHHhhhhhhhhhhhhh
Q psy3752 333 VGYHKGAVSEAIKLNIPIIGVVDTNHSPDGINYVIPGNDDSAKSIALYTKGIVDAFLDAKT 393 (1012)
Q Consensus 333 ~~~~~~ai~Ea~~l~iP~i~l~Dt~~~~~~i~~~IP~N~~s~~si~l~~~~l~~ai~~g~~ 393 (1012)
|..|++||+||.++||||||||||||||+.|||||||||||.+||+||+++|++||++|+.
T Consensus 161 ~~~~~~Ai~Ea~~l~IPvIaivDTn~dp~~vdypIP~NDds~~sI~li~~~l~~ai~~gk~ 221 (234)
T d2uubb1 161 PTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARG 221 (234)
T ss_dssp TTTTHHHHHHHHHHTCCEEEEECTTSCGGGCSEEEESCSSCHHHHHHHHHHHHHHHHTTSS
T ss_pred CCccHHHHHHHHhhCCCEEEEeecCCCccCCcEEEECCCchHHHHHHHHHHHHHHHHHHhc
Confidence 9999999999999999999999999999999999999999999999999999999999985
|
| >d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1is1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1wqga1 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ek8a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1wiha_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1efub4 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1x92a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|