Psyllid ID: psy3765

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590--
KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARKY
ccccccEEEEcEEEEEcccccEEEcccccccccccccEEEcHHHHHHcccccccEEEEEcccccccccccccEEEEEccccccHHccccccccccccccccccEEEEEccccccccccEEEEEEcccccccccEEEccccccHHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEEcccccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEcEEEEEcccccccccccccccccccccEEEcHHHHHHcccccccEEEEEEcccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHccccEEEEEccccccccHHHHHHHHHccccccccccccccccccccccccccccccccc
ccHcccccEEEEEEEEcccccEEEEccccccccccccEEEcHHHHHHcccccccEEEEEEEccccccccEEEEEEccEccccHHHHHHcccHHccccccccccEEEEcccccccccccEEEEEEcccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHcccccccccEEcccccHHHHcccHHHHHHHHHHcccccHHHHEHHHHcccccccHHEEHHcccccccEEEEcHHHHHccEccEEEcccccccHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEccccccccccccEEEcHHHHHHcccccccEEEEEEEccccccccEEEEEEccEEEccccccHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHccccccccEEcccccHHHHccccHHHHccccc
ktkigerifgdgslevlpdgfgflrsqgsnymassddiylspsqirrfnlhtgdfvegeirvpknGERYFALLKIKKvngekpelsknrtlfdnltplhpkkLLLLERNIESKENITGRIIDliapigkgqrgllvaspksgkSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGeviastfdepayrhVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNtvipasgkvltggvdsnalqrpkrFFGAarnieeggSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEkrvypainlnksgtrreeLLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKigerifgdgslevlpdgfgflrsqgsnymassddiylspsqiRRFNLHtgilwkgeirvpkngERYFALLKIKkvnvaspksgkSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGeviastfdepaLSVMCKLARAYntvipasgkvltggvdsnalqrpkRFFGAARKY
ktkigerifgdgslevlpDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLhtgdfvegeirvpkngeRYFALLKIkkvngekpelsknrtlfdnltplhpKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIastfdepayrhvQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTvipasgkvltggvdsnalqRPKRFFGaarnieeggsLTIIATALIETGSRMDDVIYEEFkgtgnmevhlerrlaekrvypainlnksgtrreelliqddKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAEtqtidlevnsvkrlRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTgilwkgeirvpkNGERYFALLKIkkvnvaspksGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIpasgkvltggvdsnalqrpkrffgaarky
KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNltplhpkkllllERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARKY
*******IFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNG********RTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDER**********VRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDER**********VRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGV******************
******R*FGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACM*****************KRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARKY
KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARKY
*****ERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARKY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDACMPLVLAETQTIDLEVNSVKRLRKQELMFAIFKKKTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGILWKGEIRVPKNGERYFALLKIKKVNVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPALSVMCKLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query592 2.2.26 [Sep-21-2011]
Q7NXP1418 Transcription termination yes N/A 0.543 0.770 0.785 1e-166
Q06447419 Transcription termination yes N/A 0.439 0.620 0.720 1e-153
Q9PA21411 Transcription termination yes N/A 0.542 0.781 0.718 1e-149
P0A295419 Transcription termination yes N/A 0.540 0.763 0.711 1e-149
P0A296419 Transcription termination N/A N/A 0.540 0.763 0.711 1e-149
P0AG33419 Transcription termination yes N/A 0.540 0.763 0.711 1e-149
P0AG30419 Transcription termination N/A N/A 0.540 0.763 0.711 1e-149
P0AG31419 Transcription termination yes N/A 0.540 0.763 0.711 1e-149
P0AG32419 Transcription termination N/A N/A 0.540 0.763 0.711 1e-149
P52152418 Transcription termination yes N/A 0.445 0.631 0.704 1e-148
>sp|Q7NXP1|RHO_CHRVO Transcription termination factor Rho OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rho PE=3 SV=1 Back     alignment and function desciption
 Score =  586 bits (1511), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 274/349 (78%), Positives = 319/349 (91%)

Query: 1   KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEI 60
           + K GE IFG+G+LEVLPDGFGFLRS  ++Y+A  DDIY+SPSQIRRFNLHTGD +EGEI
Sbjct: 42  QAKKGESIFGEGTLEVLPDGFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIEGEI 101

Query: 61  RVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRI 120
           R PK+GERYFAL+K+ KVNGE PE SK++ LF+NLTPL P +   LER I ++ENITGRI
Sbjct: 102 RTPKDGERYFALVKVDKVNGEAPENSKHKILFENLTPLFPTEQFKLEREIRAEENITGRI 161

Query: 121 IDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQR 180
           IDLI+PIGKGQR LLVA PKSGK+++LQHIAHAIT NH EA++IV+LIDERPEEVTEMQR
Sbjct: 162 IDLISPIGKGQRALLVAPPKSGKTVMLQHIAHAITANHPEAVLIVLLIDERPEEVTEMQR 221

Query: 181 SVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPAS 240
           SVRGEV++STFDEPA RHVQVAEMV+EKAKRLVE KKDV+ILLDSITRLARAYNTV+PAS
Sbjct: 222 SVRGEVVSSTFDEPATRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPAS 281

Query: 241 GKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNM 300
           GKVLTGGVD+NALQRPKRFFGAARN+EEGGSLTI+ATALI+TGSRMDDVIYEEFKGTGN 
Sbjct: 282 GKVLTGGVDANALQRPKRFFGAARNVEEGGSLTIVATALIDTGSRMDDVIYEEFKGTGNS 341

Query: 301 EVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSL 349
           E+HL+RR+AEKR++PA+N+N+SGTRREELL+  D+LQ+IWVLRKLLY +
Sbjct: 342 EIHLDRRMAEKRIFPALNINRSGTRREELLVPQDQLQRIWVLRKLLYPM 390
Facilitates transcription termination by a mechanism that involves Rho binding to the nascent RNA, activation of Rho's RNA-dependent ATPase activity, and release of the mRNA from the DNA template.
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) (taxid: 243365)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q06447|RHO_NEIGO Transcription termination factor Rho OS=Neisseria gonorrhoeae GN=rho PE=3 SV=1 Back     alignment and function description
>sp|Q9PA21|RHO_XYLFA Transcription termination factor Rho OS=Xylella fastidiosa (strain 9a5c) GN=rho PE=3 SV=1 Back     alignment and function description
>sp|P0A295|RHO_SALTY Transcription termination factor Rho OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rho PE=3 SV=1 Back     alignment and function description
>sp|P0A296|RHO_SALTI Transcription termination factor Rho OS=Salmonella typhi GN=rho PE=3 SV=1 Back     alignment and function description
>sp|P0AG33|RHO_SHIFL Transcription termination factor Rho OS=Shigella flexneri GN=rho PE=3 SV=1 Back     alignment and function description
>sp|P0AG30|RHO_ECOLI Transcription termination factor Rho OS=Escherichia coli (strain K12) GN=rho PE=1 SV=1 Back     alignment and function description
>sp|P0AG31|RHO_ECOL6 Transcription termination factor Rho OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rho PE=3 SV=1 Back     alignment and function description
>sp|P0AG32|RHO_ECO57 Transcription termination factor Rho OS=Escherichia coli O157:H7 GN=rho PE=3 SV=1 Back     alignment and function description
>sp|P52152|RHO_ALLVD Transcription termination factor Rho OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / D) GN=rho PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query592
152980394421 transcription termination factor Rho [Ja 0.543 0.764 0.871 1e-179
134093951421 transcription termination factor Rho [He 0.543 0.764 0.865 1e-178
340786064420 transcription termination factor Rho [Co 0.543 0.766 0.859 1e-177
300310193420 transcription termination factor Rho pro 0.449 0.633 0.851 1e-177
399017711420 transcription termination factor Rho [He 0.543 0.766 0.848 1e-177
398836342420 transcription termination factor Rho [He 0.543 0.766 0.845 1e-176
415914733407 Transcription termination factor [Herbas 0.449 0.653 0.848 1e-176
445499390420 transcription termination factor Rho [Ja 0.543 0.766 0.851 1e-175
427400522420 transcription termination factor Rho [Ma 0.543 0.766 0.842 1e-175
395764065420 transcription termination factor Rho [Ja 0.543 0.766 0.851 1e-175
>gi|152980394|ref|YP_001352312.1| transcription termination factor Rho [Janthinobacterium sp. Marseille] gi|151280471|gb|ABR88881.1| Rho transcription termination factor [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
 Score =  635 bits (1637), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 304/349 (87%), Positives = 331/349 (94%)

Query: 1   KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEI 60
           + K GE+IFGDG+LEVLPDGFGFLRS  ++YMAS+DDIY+SPSQIRRFNLHTGD +EGE+
Sbjct: 42  RAKSGEQIFGDGALEVLPDGFGFLRSPDASYMASTDDIYISPSQIRRFNLHTGDSIEGEV 101

Query: 61  RVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRI 120
           R PK+GERYFAL+K+ KVNGE PE SK+R LF+NLTPLHP K LLLER++  +ENITGRI
Sbjct: 102 RTPKDGERYFALVKVDKVNGESPEASKHRILFENLTPLHPNKPLLLERDMRGEENITGRI 161

Query: 121 IDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQR 180
           IDLIAPIGKGQRGLLVASPKSGKS++LQHIAHAITTNH EA+MIV+LIDERPEEVTEMQR
Sbjct: 162 IDLIAPIGKGQRGLLVASPKSGKSVMLQHIAHAITTNHPEAVMIVLLIDERPEEVTEMQR 221

Query: 181 SVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPAS 240
           SVRGEV+ASTFDEPA RHVQVAEMVLEKAKRLVEMKKDV+ILLDSITRLARAYNTVIPAS
Sbjct: 222 SVRGEVVASTFDEPATRHVQVAEMVLEKAKRLVEMKKDVVILLDSITRLARAYNTVIPAS 281

Query: 241 GKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNM 300
           GKVLTGGVD+NALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNM
Sbjct: 282 GKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNM 341

Query: 301 EVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSL 349
           EVHLERRLAEKRVYPAINLNKSGTRREELLI+ D+LQKIWVLRKLLY +
Sbjct: 342 EVHLERRLAEKRVYPAINLNKSGTRREELLIKPDQLQKIWVLRKLLYGM 390

Source: Janthinobacterium sp. Marseille

Species: Janthinobacterium sp. Marseille

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|134093951|ref|YP_001099026.1| transcription termination factor Rho [Herminiimonas arsenicoxydans] gi|133737854|emb|CAL60899.1| transcription termination factor (ATP-dependent helicase rho) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|340786064|ref|YP_004751529.1| transcription termination factor Rho [Collimonas fungivorans Ter331] gi|340551331|gb|AEK60706.1| Transcription termination factor Rho [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|300310193|ref|YP_003774285.1| transcription termination factor Rho protein [Herbaspirillum seropedicae SmR1] gi|409404638|ref|ZP_11253117.1| transcription termination factor Rho protein [Herbaspirillum sp. GW103] gi|300072978|gb|ADJ62377.1| transcription termination factor Rho protein [Herbaspirillum seropedicae SmR1] gi|386436157|gb|EIJ48980.1| transcription termination factor Rho protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|399017711|ref|ZP_10719900.1| transcription termination factor Rho [Herbaspirillum sp. CF444] gi|398102478|gb|EJL92658.1| transcription termination factor Rho [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|398836342|ref|ZP_10593679.1| transcription termination factor Rho [Herbaspirillum sp. YR522] gi|398211976|gb|EJM98587.1| transcription termination factor Rho [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|415914733|ref|ZP_11553782.1| Transcription termination factor [Herbaspirillum frisingense GSF30] gi|407761775|gb|EKF70767.1| Transcription termination factor [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|445499390|ref|ZP_21466245.1| transcription termination factor Rho [Janthinobacterium sp. HH01] gi|444789385|gb|ELX10933.1| transcription termination factor Rho [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|427400522|ref|ZP_18891760.1| transcription termination factor Rho [Massilia timonae CCUG 45783] gi|425720347|gb|EKU83269.1| transcription termination factor Rho [Massilia timonae CCUG 45783] Back     alignment and taxonomy information
>gi|395764065|ref|ZP_10444734.1| transcription termination factor Rho [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query592
TIGR_CMR|CBU_2086418 CBU_2086 "transcription termin 0.606 0.858 0.717 2.3e-135
UNIPROTKB|Q9KV50419 rho "Transcription termination 0.591 0.835 0.697 8.1e-131
TIGR_CMR|VC_0307419 VC_0307 "transcription termina 0.591 0.835 0.697 8.1e-131
UNIPROTKB|P0AG30419 rho "transcription termination 0.586 0.828 0.694 1.9e-129
TIGR_CMR|SO_0405421 SO_0405 "transcription termina 0.581 0.817 0.706 2.6e-127
TIGR_CMR|CPS_0176419 CPS_0176 "transcription termin 0.577 0.816 0.692 1.1e-126
TIGR_CMR|GSU_3108415 GSU_3108 "transcription termin 0.587 0.838 0.655 3e-124
TIGR_CMR|SPO_3894423 SPO_3894 "transcription termin 0.608 0.851 0.620 3.9e-115
TIGR_CMR|ECH_0200422 ECH_0200 "transcription termin 0.582 0.817 0.623 1.6e-111
TIGR_CMR|ECH_0994422 ECH_0994 "transcription termin 0.582 0.817 0.623 1.6e-111
TIGR_CMR|CBU_2086 CBU_2086 "transcription termination factor Rho" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 1326 (471.8 bits), Expect = 2.3e-135, P = 2.3e-135
 Identities = 259/361 (71%), Positives = 303/361 (83%)

Query:     3 KIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRV 62
             K GE IFGDG LE+L DGFGFLRS  S+Y+A  DDIY+SPSQIRRFNL TGD V G+IR 
Sbjct:    44 KKGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVSGKIRP 103

Query:    63 PKNGERYFALLKIKKVNGEKPELSKNRTLFDNXXXXXXXXXXXXERNIESKENITGRIID 122
             PK  ERYFALL++ ++N EKPE SK + LF+N            E    S E+IT RIID
Sbjct:   104 PKESERYFALLQVNEINLEKPEASKGKILFENLTPLFPNEQIRMETGNGSTEDITARIID 163

Query:   123 LIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSV 182
             LI+PIGKGQRGL+V+ PK+GK+++LQ+IAH+ITTNH E ++IV+LIDERPEEVTEM RSV
Sbjct:   164 LISPIGKGQRGLIVSPPKAGKTMMLQNIAHSITTNHPECVLIVLLIDERPEEVTEMDRSV 223

Query:   183 RGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGK 242
             +GEV+ASTFDEPA RHVQVAEMV+EKAKRLVE KKDV+ILLDSITRLARAYNTVIPASGK
Sbjct:   224 KGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPASGK 283

Query:   243 VLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEV 302
             VLTGGVD+NALQRPKRFFGAARN+EEGGSLTIIATAL+ETGS+MDDVIYEEFKGTGNME+
Sbjct:   284 VLTGGVDANALQRPKRFFGAARNVEEGGSLTIIATALVETGSKMDDVIYEEFKGTGNMEI 343

Query:   303 HLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIK 362
             HL+RR+AEKR +PAIN+N+SGTRREEL++  D LQK+W+LRK+L+   M     S F I 
Sbjct:   344 HLDRRIAEKRTFPAININRSGTRREELMMPQDVLQKVWILRKILHP--MDELAASEFLID 401

Query:   363 R 363
             R
Sbjct:   402 R 402
GO:0006353 "DNA-dependent transcription, termination" evidence=ISS
UNIPROTKB|Q9KV50 rho "Transcription termination factor Rho" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0307 VC_0307 "transcription termination factor Rho" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0AG30 rho "transcription termination factor Rho monomer; polarity suppressor" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0405 SO_0405 "transcription termination factor Rho" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0176 CPS_0176 "transcription termination factor Rho" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3108 GSU_3108 "transcription termination factor Rho" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3894 SPO_3894 "transcription termination factor Rho" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0200 ECH_0200 "transcription termination factor Rho" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0994 ECH_0994 "transcription termination factor Rho" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33561RHO_BORBU3, ., 6, ., 4, ., -0.63880.56080.6446yesN/A
Q9ZLS9RHO_HELPJ3, ., 6, ., 4, ., -0.58680.58440.7899yesN/A
P66028RHO_MYCTU3, ., 6, ., 4, ., -0.55520.56080.5514yesN/A
P66029RHO_MYCBO3, ., 6, ., 4, ., -0.55520.56080.5514yesN/A
Q89A22RHO_BUCBP3, ., 6, ., 4, ., -0.69910.54390.7684yesN/A
C7LJY3RHO_SULMS3, ., 6, ., 4, ., -0.58920.55910.8733yesN/A
O83281RHO_TREPA3, ., 6, ., 4, ., -0.64450.57600.6570yesN/A
Q03222RHO_BACSU3, ., 6, ., 4, ., -0.60700.56250.7798yesN/A
P38527RHO_THEMA3, ., 6, ., 4, ., -0.59940.57260.7939yesN/A
O67031RHO_AQUAE3, ., 6, ., 4, ., -0.61270.57260.7775yesN/A
Q7NXP1RHO_CHRVO3, ., 6, ., 4, ., -0.78510.54390.7703yesN/A
Q9PA21RHO_XYLFA3, ., 6, ., 4, ., -0.71830.54220.7810yesN/A
P56466RHO_HELPY3, ., 6, ., 4, ., -0.58400.58440.7899yesN/A
P57652RHO_BUCAI3, ., 6, ., 4, ., -0.70480.54390.7684yesN/A
Q06447RHO_NEIGO3, ., 6, ., 4, ., -0.72040.43910.6205yesN/A
P52153RHO_DEIRA3, ., 6, ., 4, ., -0.53680.56580.7863yesN/A
P52152RHO_ALLVD3, ., 6, ., 4, ., -0.70480.44590.6315yesN/A
P52156RHO_RHOS43, ., 6, ., 4, ., -0.64460.44250.6208yesN/A
P0AG33RHO_SHIFL3, ., 6, ., 4, ., -0.71180.54050.7637yesN/A
Q9ZD24RHO_RICPR3, ., 6, ., 4, ., -0.69470.57770.7483yesN/A
P0AG31RHO_ECOL63, ., 6, ., 4, ., -0.71180.54050.7637yesN/A
Q9HTV1RHO_PSEAE3, ., 6, ., 4, ., -0.71750.54050.7637yesN/A
Q92HL2RHO_RICCN3, ., 6, ., 4, ., -0.69180.57770.7467yesN/A
P0A295RHO_SALTY3, ., 6, ., 4, ., -0.71180.54050.7637yesN/A
Q1RIJ6RHO_RICBR3, ., 6, ., 4, ., -0.69880.57600.7594yesN/A
Q4ULF7RHO_RICFE3, ., 6, ., 4, ., -0.69470.57770.7467yesN/A
P0CH92RHO1_EHRCR3, ., 6, ., 4, ., -0.64790.56580.7938yesN/A
P0CH93RHO2_EHRCR3, ., 6, ., 4, ., -0.64790.56580.7938yesN/A
Q7UGV0RHO_RHOBA3, ., 6, ., 4, ., -0.55680.56750.6536yesN/A
P45835RHO_MYCLE3, ., 6, ., 4, ., -0.55520.56080.5442yesN/A
D1AWS1RHO_STRM93, ., 6, ., 4, ., -0.52770.52870.7524yesN/A
Q8RG42RHO_FUSNN3, ., 6, ., 4, ., -0.50880.54890.7869yesN/A
O51891RHO_BUCAP3, ., 6, ., 4, ., -0.70480.54390.7684yesN/A
Q68WL0RHO_RICTY3, ., 6, ., 4, ., -0.69470.57770.7483yesN/A
P44619RHO_HAEIN3, ., 6, ., 4, ., -0.71300.43910.6190yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3.14LOW CONFIDENCE prediction!
3rd Layer3.6.4LOW CONFIDENCE prediction!
3rd Layer3.6.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
PRK09376416 PRK09376, rho, transcription termination factor Rh 0.0
COG1158422 COG1158, Rho, Transcription termination factor [Tr 0.0
TIGR00767415 TIGR00767, rho, transcription termination factor R 0.0
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.0
PRK12608380 PRK12608, PRK12608, transcription termination fact 1e-174
cd01128249 cd01128, rho_factor, Transcription termination fac 1e-160
TIGR00767 415 TIGR00767, rho, transcription termination factor R 1e-93
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 2e-72
PRK09376 416 PRK09376, rho, transcription termination factor Rh 4e-57
PRK12608 380 PRK12608, PRK12608, transcription termination fact 5e-57
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-55
COG1158 422 COG1158, Rho, Transcription termination factor [Tr 6e-53
cd01128249 cd01128, rho_factor, Transcription termination fac 1e-50
PRK09376 416 PRK09376, rho, transcription termination factor Rh 1e-44
pfam0749778 pfam07497, Rho_RNA_bind, Rho termination factor, R 1e-41
COG1158 422 COG1158, Rho, Transcription termination factor [Tr 1e-40
pfam0749778 pfam07497, Rho_RNA_bind, Rho termination factor, R 1e-35
cd0445968 cd04459, Rho_CSD, Rho_CSD: Rho protein cold-shock 1e-33
cd0445968 cd04459, Rho_CSD, Rho_CSD: Rho protein cold-shock 3e-30
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flag 2e-22
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion appara 1e-20
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III sec 2e-20
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 1e-19
PRK06820440 PRK06820, PRK06820, type III secretion system ATPa 9e-18
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export A 1e-17
PRK07594433 PRK07594, PRK07594, type III secretion system ATPa 3e-17
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; V 5e-17
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 2e-16
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export A 3e-16
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; V 5e-16
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; V 1e-15
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 2e-15
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 7e-15
PRK06936439 PRK06936, PRK06936, type III secretion system ATPa 8e-15
PRK06315442 PRK06315, PRK06315, type III secretion system ATPa 8e-14
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; V 8e-14
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export A 2e-13
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; V 4e-13
smart0035764 smart00357, CSP, Cold shock protein domain 2e-12
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; V 3e-12
PRK09099441 PRK09099, PRK09099, type III secretion system ATPa 4e-12
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; V 2e-11
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; V 4e-10
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; V 3e-09
smart0035764 smart00357, CSP, Cold shock protein domain 5e-08
PRK05922434 PRK05922, PRK05922, type III secretion system ATPa 9e-08
TIGR03324497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 2e-05
TIGR03305449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 1e-04
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 0.001
smart0095943 smart00959, Rho_N, Rho termination factor, N-termi 0.001
PTZ00185574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisio 0.001
smart00382148 smart00382, AAA, ATPases associated with a variety 0.001
TIGR00962501 TIGR00962, atpA, proton translocating ATP synthase 0.002
TIGR01039461 TIGR01039, atpD, ATP synthase, F1 beta subunit 0.003
>gnl|CDD|236490 PRK09376, rho, transcription termination factor Rho; Provisional Back     alignment and domain information 
 Score =  701 bits (1812), Expect = 0.0
 Identities = 253/349 (72%), Positives = 310/349 (88%), Gaps = 2/349 (0%)

Query: 1   KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEI 60
           + + G  IFG+G LE+LPDGFGFLRS  +NY+   DDIY+SPSQIRRFNL TGD VEG+I
Sbjct: 42  QAEKGGDIFGEGVLEILPDGFGFLRSPDANYLPGPDDIYVSPSQIRRFNLRTGDTVEGKI 101

Query: 61  RVPKNGERYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRI 120
           R PK GERYFALLK++ VNGE PE ++NR LF+NLTPL+P + L LE    + E+++ RI
Sbjct: 102 RPPKEGERYFALLKVETVNGEDPEKARNRPLFENLTPLYPNERLRLET--GNPEDLSTRI 159

Query: 121 IDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQR 180
           IDLIAPIGKGQRGL+VA PK+GK+++LQ+IA++ITTNH E  +IV+LIDERPEEVT+MQR
Sbjct: 160 IDLIAPIGKGQRGLIVAPPKAGKTVLLQNIANSITTNHPEVHLIVLLIDERPEEVTDMQR 219

Query: 181 SVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPAS 240
           SV+GEV+ASTFDEPA RHVQVAEMV+EKAKRLVE  KDV+ILLDSITRLARAYNTV+P+S
Sbjct: 220 SVKGEVVASTFDEPAERHVQVAEMVIEKAKRLVEHGKDVVILLDSITRLARAYNTVVPSS 279

Query: 241 GKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNM 300
           GKVL+GGVD+NAL RPKRFFGAARNIEEGGSLTIIATALI+TGSRMD+VI+EEFKGTGNM
Sbjct: 280 GKVLSGGVDANALHRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNM 339

Query: 301 EVHLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSL 349
           E+HL+R+LAEKR++PAI++N+SGTR+EELL+  ++LQK+W+LRK+L  +
Sbjct: 340 ELHLDRKLAEKRIFPAIDINRSGTRKEELLLSPEELQKVWILRKILSPM 388

Length = 416
>gnl|CDD|224080 COG1158, Rho, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|162030 TIGR00767, rho, transcription termination factor Rho Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237150 PRK12608, PRK12608, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|238548 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>gnl|CDD|162030 TIGR00767, rho, transcription termination factor Rho Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|236490 PRK09376, rho, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237150 PRK12608, PRK12608, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|224080 COG1158, Rho, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|238548 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>gnl|CDD|236490 PRK09376, rho, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|203651 pfam07497, Rho_RNA_bind, Rho termination factor, RNA-binding domain Back     alignment and domain information
>gnl|CDD|224080 COG1158, Rho, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|203651 pfam07497, Rho_RNA_bind, Rho termination factor, RNA-binding domain Back     alignment and domain information
>gnl|CDD|239906 cd04459, Rho_CSD, Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>gnl|CDD|239906 cd04459, Rho_CSD, Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|214633 smart00357, CSP, Cold shock protein domain Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|214633 smart00357, CSP, Cold shock protein domain Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|198027 smart00959, Rho_N, Rho termination factor, N-terminal domain Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 592
PRK09376416 rho transcription termination factor Rho; Provisio 100.0
COG1158422 Rho Transcription termination factor [Transcriptio 100.0
PRK12678672 transcription termination factor Rho; Provisional 100.0
PRK12608380 transcription termination factor Rho; Provisional 100.0
TIGR00767415 rho transcription termination factor Rho. Members 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 100.0
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 100.0
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 100.0
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 100.0
PRK09280463 F0F1 ATP synthase subunit beta; Validated 100.0
CHL00060494 atpB ATP synthase CF1 beta subunit 100.0
TIGR01043578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 100.0
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 100.0
TIGR01042591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 100.0
PRK04196460 V-type ATP synthase subunit B; Provisional 100.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 100.0
PRK04192586 V-type ATP synthase subunit A; Provisional 100.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 100.0
COG1158 422 Rho Transcription termination factor [Transcriptio 100.0
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 100.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 100.0
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
PRK08927442 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08972444 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 100.0
CHL00059485 atpA ATP synthase CF1 alpha subunit 100.0
PTZ00185574 ATPase alpha subunit; Provisional 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 100.0
PRK06820440 type III secretion system ATPase; Validated 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 100.0
PRK08149428 ATP synthase SpaL; Validated 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 100.0
PRK08472434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK02118436 V-type ATP synthase subunit B; Provisional 100.0
PRK07594433 type III secretion system ATPase SsaN; Validated 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 100.0
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07721438 fliI flagellum-specific ATP synthase; Validated 100.0
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 100.0
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy 100.0
PRK146981017 V-type ATP synthase subunit A; Provisional 100.0
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 100.0
COG1156463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 100.0
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 100.0
KOG1352|consensus618 100.0
PRK09376 416 rho transcription termination factor Rho; Provisio 100.0
KOG1351|consensus489 100.0
cd01128249 rho_factor Transcription termination factor rho is 100.0
KOG1350|consensus521 100.0
TIGR00767 415 rho transcription termination factor Rho. Members 100.0
PRK12678 672 transcription termination factor Rho; Provisional 100.0
PRK12608 380 transcription termination factor Rho; Provisional 100.0
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 99.92
KOG1353|consensus340 99.92
PF0749778 Rho_RNA_bind: Rho termination factor, RNA-binding 99.91
PF0749778 Rho_RNA_bind: Rho termination factor, RNA-binding 99.89
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS 99.87
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 99.8
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS 99.8
cd01128249 rho_factor Transcription termination factor rho is 99.79
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 99.79
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 99.78
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 99.76
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 99.74
PRK06936 439 type III secretion system ATPase; Provisional 99.73
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 99.73
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 99.72
CHL00060 494 atpB ATP synthase CF1 beta subunit 99.71
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 99.7
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 99.7
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 99.69
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 99.68
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 99.66
PRK04196 460 V-type ATP synthase subunit B; Provisional 99.66
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 99.65
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 99.64
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 99.62
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 99.62
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 99.61
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 99.61
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 99.6
PRK05922 434 type III secretion system ATPase; Validated 99.6
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 99.59
PRK09099 441 type III secretion system ATPase; Provisional 99.59
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 99.59
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 99.59
CHL00059 485 atpA ATP synthase CF1 alpha subunit 99.58
PRK06820 440 type III secretion system ATPase; Validated 99.58
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 99.57
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 99.57
PRK08149 428 ATP synthase SpaL; Validated 99.54
PRK07594 433 type III secretion system ATPase SsaN; Validated 99.54
PRK02118 436 V-type ATP synthase subunit B; Provisional 99.53
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 99.51
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 99.51
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 99.51
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 99.5
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 99.5
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 99.48
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 99.45
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 99.45
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 99.41
PRK04192 586 V-type ATP synthase subunit A; Provisional 99.39
PTZ00185 574 ATPase alpha subunit; Provisional 99.38
PRK06315 442 type III secretion system ATPase; Provisional 99.23
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.83
PRK14698 1017 V-type ATP synthase subunit A; Provisional 98.61
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 98.18
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.06
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 98.05
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 98.05
smart00382148 AAA ATPases associated with a variety of cellular 97.97
cd01394218 radB RadB. The archaeal protein radB shares simila 97.91
PRK06067234 flagellar accessory protein FlaH; Validated 97.85
PRK09302509 circadian clock protein KaiC; Reviewed 97.82
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.79
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.78
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.76
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.67
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.63
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.61
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.61
PRK04328249 hypothetical protein; Provisional 97.61
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.6
PRK09302509 circadian clock protein KaiC; Reviewed 97.59
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.58
PRK09354349 recA recombinase A; Provisional 97.51
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.45
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.44
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.41
PF0749843 Rho_N: Rho termination factor, N-terminal domain; 97.41
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.39
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.39
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.37
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.37
PRK11823446 DNA repair protein RadA; Provisional 97.35
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.32
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.28
KOG2028|consensus554 97.24
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.22
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.21
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.18
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.18
PRK09519 790 recA DNA recombination protein RecA; Reviewed 97.15
PF00306113 ATP-synt_ab_C: ATP synthase alpha/beta chain, C te 97.11
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.1
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.1
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.08
PF05729166 NACHT: NACHT domain 96.99
PLN03186342 DNA repair protein RAD51 homolog; Provisional 96.96
PTZ00035337 Rad51 protein; Provisional 96.96
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.85
KOG1350|consensus 521 96.78
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.76
PF00004132 AAA: ATPase family associated with various cellula 96.75
PF13173128 AAA_14: AAA domain 96.73
PRK05973237 replicative DNA helicase; Provisional 96.68
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.67
smart0035764 CSP Cold shock protein domain. RNA-binding domain 96.64
cd03115173 SRP The signal recognition particle (SRP) mediates 96.63
PF0820658 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 96.62
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.58
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.54
PRK13342413 recombination factor protein RarA; Reviewed 96.5
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.46
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.3
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.3
PF00154322 RecA: recA bacterial DNA recombination protein; In 96.29
PRK14974336 cell division protein FtsY; Provisional 96.28
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 96.26
PRK08118167 topology modulation protein; Reviewed 96.23
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.22
PRK08084235 DNA replication initiation factor; Provisional 96.22
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.14
PRK10416318 signal recognition particle-docking protein FtsY; 96.1
PRK00149450 dnaA chromosomal replication initiation protein; R 96.03
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.01
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.0
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.93
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.92
TIGR00064272 ftsY signal recognition particle-docking protein F 95.91
PRK09183259 transposase/IS protein; Provisional 95.89
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.88
PF0820658 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 95.88
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.88
PRK08181269 transposase; Validated 95.88
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 95.87
PRK07261171 topology modulation protein; Provisional 95.86
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.83
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.8
smart0035764 CSP Cold shock protein domain. RNA-binding domain 95.8
PRK06921266 hypothetical protein; Provisional 95.79
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.77
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.74
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.71
PRK13341 725 recombination factor protein RarA/unknown domain f 95.71
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.7
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 95.69
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.64
PRK05541176 adenylylsulfate kinase; Provisional 95.62
PRK14087450 dnaA chromosomal replication initiation protein; P 95.61
PRK06893229 DNA replication initiation factor; Validated 95.6
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.57
PRK12377248 putative replication protein; Provisional 95.56
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.55
PRK06526254 transposase; Provisional 95.5
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.5
smart00382148 AAA ATPases associated with a variety of cellular 95.49
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.49
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.43
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.42
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.41
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.39
PRK09435332 membrane ATPase/protein kinase; Provisional 95.34
PRK08727233 hypothetical protein; Validated 95.31
PRK14088440 dnaA chromosomal replication initiation protein; P 95.22
PRK08116268 hypothetical protein; Validated 95.19
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 95.17
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.13
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.12
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.07
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 95.05
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.04
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.03
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.01
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.01
KOG1352|consensus 618 95.0
PRK00889175 adenylylsulfate kinase; Provisional 95.0
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.99
PRK10867433 signal recognition particle protein; Provisional 94.98
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 94.97
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.95
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.91
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.89
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.87
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 94.86
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.79
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 94.79
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.78
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.76
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.75
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 94.71
TIGR00959428 ffh signal recognition particle protein. This mode 94.69
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 94.69
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.68
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 94.66
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.65
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.65
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 94.65
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 94.64
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.62
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 94.61
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.59
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 94.58
COG3842352 PotA ABC-type spermidine/putrescine transport syst 94.58
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 94.57
PF00005137 ABC_tran: ABC transporter This structure is on hol 94.56
COG0593408 DnaA ATPase involved in DNA replication initiation 94.56
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.55
cd03269210 ABC_putative_ATPase This subfamily is involved in 94.55
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.54
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.53
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.52
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.52
PRK03846198 adenylylsulfate kinase; Provisional 94.51
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.5
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.47
PRK14086617 dnaA chromosomal replication initiation protein; P 94.47
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.45
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 94.44
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.44
CHL00181287 cbbX CbbX; Provisional 94.44
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.43
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.42
PRK05642234 DNA replication initiation factor; Validated 94.41
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.41
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 94.41
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 94.41
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 94.38
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 94.37
PRK07940394 DNA polymerase III subunit delta'; Validated 94.37
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.36
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 94.36
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 94.36
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.36
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.35
COG4619223 ABC-type uncharacterized transport system, ATPase 94.33
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.32
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 94.29
PRK06620214 hypothetical protein; Validated 94.28
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 94.28
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.28
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.28
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 94.28
TIGR00665434 DnaB replicative DNA helicase. This model describe 94.27
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.27
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.27
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.26
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.25
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.24
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 94.24
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.23
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.22
COG3638 258 ABC-type phosphate/phosphonate transport system, A 94.22
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.22
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 94.21
PF13479213 AAA_24: AAA domain 94.2
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 94.19
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.18
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.17
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.17
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 94.16
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.16
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 94.15
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.14
PF05729166 NACHT: NACHT domain 94.13
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.13
PRK08939306 primosomal protein DnaI; Reviewed 94.12
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.11
PRK07952244 DNA replication protein DnaC; Validated 94.1
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 94.1
PRK14240250 phosphate transporter ATP-binding protein; Provisi 94.1
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.1
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.1
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.09
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 94.08
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.07
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 94.06
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.06
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.04
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.03
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 94.03
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 94.02
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.02
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 93.98
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 93.98
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 93.98
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 93.97
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.95
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.95
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 93.94
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 93.94
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 93.94
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 93.93
PRK12422445 chromosomal replication initiation protein; Provis 93.93
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.92
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 93.92
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 93.92
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.91
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 93.9
PF1324576 AAA_19: Part of AAA domain 93.9
cd03246173 ABCC_Protease_Secretion This family represents the 93.9
PRK10908222 cell division protein FtsE; Provisional 93.89
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.89
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 93.88
PRK14242253 phosphate transporter ATP-binding protein; Provisi 93.88
PRK10865 857 protein disaggregation chaperone; Provisional 93.87
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.85
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 93.85
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 93.84
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 93.82
PRK14241258 phosphate transporter ATP-binding protein; Provisi 93.81
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 93.81
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.81
PRK05480209 uridine/cytidine kinase; Provisional 93.8
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 93.79
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 93.79
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 93.79
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 93.79
PTZ00301210 uridine kinase; Provisional 93.79
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 93.79
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 93.78
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 93.75
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 93.74
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 93.73
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 93.72
PHA00729226 NTP-binding motif containing protein 93.72
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 93.72
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 93.71
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 93.7
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 93.7
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.7
PRK14531183 adenylate kinase; Provisional 93.7
PRK14239252 phosphate transporter ATP-binding protein; Provisi 93.69
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 93.69
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 93.66
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 93.65
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 93.65
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 93.65
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 93.64
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.64
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 93.63
PRK14237267 phosphate transporter ATP-binding protein; Provisi 93.62
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.61
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 93.61
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 93.6
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 93.6
PRK10253265 iron-enterobactin transporter ATP-binding protein; 93.59
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 93.59
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 93.59
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 93.59
KOG0744|consensus423 93.58
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.58
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 93.58
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 93.57
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 93.55
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 93.53
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 93.52
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.52
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 93.52
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 93.52
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 93.52
PRK14243264 phosphate transporter ATP-binding protein; Provisi 93.51
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.51
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 93.5
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 93.49
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 93.49
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 93.48
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 93.48
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 93.48
PRK14530215 adenylate kinase; Provisional 93.47
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 93.47
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 93.47
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 93.46
PRK06217183 hypothetical protein; Validated 93.46
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 93.46
PRK09165497 replicative DNA helicase; Provisional 93.46
PRK14238271 phosphate transporter ATP-binding protein; Provisi 93.42
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 93.42
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 93.42
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 93.41
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 93.41
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 93.41
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 93.4
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 93.4
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.4
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 93.4
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 93.39
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 93.38
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.37
PRK09984262 phosphonate/organophosphate ester transporter subu 93.36
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 93.36
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 93.35
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 93.34
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 93.31
cd03114148 ArgK-like The function of this protein family is u 93.31
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 93.3
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 93.3
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.29
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 93.27
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 93.26
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 93.26
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 93.26
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 93.24
COG4525259 TauB ABC-type taurine transport system, ATPase com 93.24
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.23
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 93.22
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.21
cd03234226 ABCG_White The White subfamily represents ABC tran 93.2
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.19
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 93.19
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 93.19
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 93.19
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.19
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.18
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.18
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 93.18
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.17
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 93.16
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 93.16
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.14
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 93.14
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.13
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.12
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 93.11
PRK13546264 teichoic acids export protein ATP-binding subunit; 93.1
PRK05748448 replicative DNA helicase; Provisional 93.1
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 93.09
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 93.05
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 93.05
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 93.04
PRK14235267 phosphate transporter ATP-binding protein; Provisi 93.04
KOG1969|consensus877 93.03
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 93.02
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-99  Score=799.20  Aligned_cols=371  Identities=68%  Similarity=1.083  Sum_probs=362.5

Q ss_pred             CCCceEEeeEEEEEeCCCeeEEeCCCCCCCCCCCCeeECccccccccCCCCCeEEEEEECCCCCccccceeeeeecCCCC
Q psy3765           3 KIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNGEK   82 (592)
Q Consensus         3 ~~~~~~~~~G~le~~~dg~gflr~~~~~y~~~~~dvyV~~~~~r~~~L~vGd~l~GrV~~p~g~e~~~~l~~v~~ing~~   82 (592)
                      ++++.++++||||+++|||||||+.++||+|+++|||||++|+|+|+||.||.+.|.|+.|+++|+|++|++|+.|||.+
T Consensus        44 ~~~~~~~~~g~le~~~~g~gflr~~~~~y~~~~~d~yvs~~~ir~~~lr~gd~v~g~~r~~~~~e~~~~l~~v~~vng~~  123 (416)
T PRK09376         44 EKGGDIFGEGVLEILPDGFGFLRSPDANYLPGPDDIYVSPSQIRRFNLRTGDTVEGKIRPPKEGERYFALLKVETVNGED  123 (416)
T ss_pred             hcCCceEEEEEEEEcCCCCeEEeCCCcCCCCCCCCeeeCHHHHHhcCCCCCCEEEEEeeCCCCCCCccceEEEeeeCCCC
Confidence            45677999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCccccCCCCCCcccccccccccCCccccccceeeccccccccceeeeecCCCCChhHHHHHHHHHHHhcCCCeE
Q psy3765          83 PELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAI  162 (592)
Q Consensus        83 p~~~~~r~~~d~l~pi~p~~R~~ie~~ap~~l~TGiraID~l~PigkGQR~~I~g~~g~GKT~Ll~~Ia~~i~~~~~~~~  162 (592)
                      |+....|++|+.++|++|.+|.++++.  +++.+|+|+||+|+|||||||++||||+|+|||||+++|++++.++|++++
T Consensus       124 ~~~~~~r~~f~~l~p~~p~~R~~le~~--~~~~~~~rvID~l~PIGkGQR~lIvgppGvGKTTLaK~Ian~I~~nhFDv~  201 (416)
T PRK09376        124 PEKARNRPLFENLTPLYPNERLRLETG--NPEDLSTRIIDLIAPIGKGQRGLIVAPPKAGKTVLLQNIANSITTNHPEVH  201 (416)
T ss_pred             HHHhcCCCCcccCCCCChhhcccccCC--CCcccceeeeeeecccccCceEEEeCCCCCChhHHHHHHHHHHHhhcCCeE
Confidence            999999999999999999999999982  259999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeccchhHHHHHHhhccEEEEEeCCCCCHHHHHHHHHhHHHHHHHHHHcCCcEEEeccchhHHHHHHhhhccCCCC
Q psy3765         163 MIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGK  242 (592)
Q Consensus       163 ~I~~lIGeR~~Ev~e~~~~~~~~vV~~t~d~~~~~r~~~~~~a~t~AE~~r~~G~dVlll~Dsltr~A~A~reis~~~Ge  242 (592)
                      |+|++||||++||++|++++.++||++|+|+||..|+++++.++++||||+++|+||+|++||+||||+||||+++++||
T Consensus       202 ~~VvLIgER~~EVtdiqrsIlg~vv~st~d~~~~~~~~~a~~~ie~Ae~~~e~G~dVlL~iDsItR~arAqrev~~~sG~  281 (416)
T PRK09376        202 LIVLLIDERPEEVTDMQRSVKGEVVASTFDEPAERHVQVAEMVIEKAKRLVEHGKDVVILLDSITRLARAYNTVVPSSGK  281 (416)
T ss_pred             EEEEEeCCchhHHHHHHHHhcCcEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCCEEEEEEChHHHHHHHHhhhhccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcccccchHHHhhcccccCCcceeeEEEEEeecCCCCCcccccccccccCeEEEechHhHhcCCCCCCcCCCC
Q psy3765         243 VLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKS  322 (592)
Q Consensus       243 ~p~~Gyp~~l~~~~~~~~erA~~~~~~GSIT~i~tvlv~tg~d~~dpI~d~~~~i~dg~i~Ldr~La~~gifPAID~l~S  322 (592)
                      +|++||++++|+.|++||||||+++++||||+|+|+|+||||+|+|||+|++++++||||+|||+||++||||||||+.|
T Consensus       282 ~~sgG~~~~~~~~~~r~f~~Arn~e~~GSlT~i~T~LvetGs~mdd~I~ee~kg~~n~~ivLdR~lA~~r~fPAIDi~~S  361 (416)
T PRK09376        282 VLSGGVDANALHRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMELHLDRKLAEKRIFPAIDINRS  361 (416)
T ss_pred             CCCCCCChhHhhhhHHHHHhhcCCCCCcceEEEEEEEecCCCCCCccHHHHHhhhcCceEeECHHHHhcCCCCccCcccc
Confidence            99999999999999999999999989999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCCCHHHHHHHHHHHHHHhccccHHHHHhccccccCChhhhHHHhhc
Q psy3765         323 GTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDA  375 (592)
Q Consensus       323 ~SR~~~~~~~~~~~~~~~~lr~~l~~~~~~~~li~l~g~~~~~~~~k~~L~~~  375 (592)
                      +||+++++++++|++.++++|++|+.|++++.|..++.....+++|+++|...
T Consensus       362 ~sR~~~~l~~~~~~~~~~~lR~~l~~~~~~e~~e~~~~~~~~t~~n~e~~~~~  414 (416)
T PRK09376        362 GTRKEELLLSPEELQKVWILRKILSPMDEVEAMEFLLDKLKKTKTNEEFFDSM  414 (416)
T ss_pred             ccccccccCCHHHHHHHHHHHHHHHccCcHHHHHHHHHHHHcCCCHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999753

>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1353|consensus Back     alignment and domain information
>PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information
>PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PF07498 Rho_N: Rho termination factor, N-terminal domain; InterPro: IPR011112 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PF00306 ATP-synt_ab_C: ATP synthase alpha/beta chain, C terminal domain; InterPro: IPR000793 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>smart00357 CSP Cold shock protein domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>smart00357 CSP Cold shock protein domain Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
1pvo_A419 X-Ray Crystal Structure Of Rho Transcription Termin 1e-145
1pvo_A 419 X-Ray Crystal Structure Of Rho Transcription Termin 3e-36
2ht1_A433 The Closed Ring Structure Of The Rho Transcription 1e-145
2ht1_A 433 The Closed Ring Structure Of The Rho Transcription 3e-36
1pv4_A419 X-Ray Crystal Structure Of The Rho Transcription Te 1e-141
1pv4_A 419 X-Ray Crystal Structure Of The Rho Transcription Te 6e-35
3ice_A422 Rho Transcription Termination Factor Bound To Rna A 1e-140
3ice_A 422 Rho Transcription Termination Factor Bound To Rna A 7e-35
3l0o_A427 Structure Of Rna-Free Rho Transcription Termination 1e-110
3l0o_A 427 Structure Of Rna-Free Rho Transcription Termination 3e-50
1a63_A130 The Nmr Structure Of The Rna Binding Domain Of E.Co 3e-32
1a62_A130 Crystal Structure Of The Rna-Binding Domain Of The 1e-31
1a8v_A121 Structure Of The Rna-Binding Domain Of The Rho Tran 6e-30
2a8v_A118 Rho Transcription Termination FactorRNA COMPLEX Len 6e-30
2obl_A347 Structural And Biochemical Analysis Of A Prototypic 6e-14
2dpy_A438 Crystal Structure Of The Flagellar Type Iii Atpase 1e-13
1sky_E473 Crystal Structure Of The Nucleotide Free Alpha3beta 1e-05
2qe7_D462 Crystal Structure Of The F1-Atpase From The Thermoa 3e-05
>pdb|1PVO|A Chain A, X-Ray Crystal Structure Of Rho Transcription Termination Factor In Complex With Ssrna Substrate And Anppnp Length = 419 Back     alignment and structure 
Iteration: 1

 Score =  512 bits (1318), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/347 (69%), Positives = 296/347 (85%)
Query: 3   KIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRV 62
           K GE IFGDG LE+L DGFGFLRS  S+Y+A  DDIY+SPSQIRRFNL TGD + G+IR 
Sbjct: 44  KSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRP 103
Query: 63  PKNGERYFALLKIKKVNGEKPELSKNRTLFDNXXXXXXXXXXXXERNIESKENITGRIID 122
           PK GERYFALLK+ +VN +KPE ++N+ LF+N            ER   S E++T R++D
Sbjct: 104 PKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD 163
Query: 123 LIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSV 182
           L +PIG+GQRGL+VA PK+GK+++LQ+IA +I  NH + +++V+LIDERPEEVTEMQR V
Sbjct: 164 LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLV 223
Query: 183 RGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGK 242
           +GEV+ASTFDEPA RHVQVAEMV+EKAKRLVE KKDVIILLDSITRLARAYNTV+PASGK
Sbjct: 224 KGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGK 283
Query: 243 VLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEV 302
           VLTGGVD+NAL RPKRFFGAARN+EEGGSLTIIATALI+TGS+MD+VIYEEFKGTGNME+
Sbjct: 284 VLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMEL 343
Query: 303 HLERRLAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSL 349
           HL R++AEKRV+PAI+ N+SGTR+EELL   ++LQK+W+LRK+++ +
Sbjct: 344 HLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM 390
>pdb|1PVO|A Chain A, X-Ray Crystal Structure Of Rho Transcription Termination Factor In Complex With Ssrna Substrate And Anppnp Length = 419 Back     alignment and structure
>pdb|2HT1|A Chain A, The Closed Ring Structure Of The Rho Transcription Termination Factor In Complex With Nucleic Acid In The Motor Domains Length = 433 Back     alignment and structure
>pdb|2HT1|A Chain A, The Closed Ring Structure Of The Rho Transcription Termination Factor In Complex With Nucleic Acid In The Motor Domains Length = 433 Back     alignment and structure
>pdb|1PV4|A Chain A, X-Ray Crystal Structure Of The Rho Transcription Termination Factor In Complex With Single Stranded Dna Length = 419 Back     alignment and structure
>pdb|1PV4|A Chain A, X-Ray Crystal Structure Of The Rho Transcription Termination Factor In Complex With Single Stranded Dna Length = 419 Back     alignment and structure
>pdb|3ICE|A Chain A, Rho Transcription Termination Factor Bound To Rna And Adp-Bef3 Length = 422 Back     alignment and structure
>pdb|3ICE|A Chain A, Rho Transcription Termination Factor Bound To Rna And Adp-Bef3 Length = 422 Back     alignment and structure
>pdb|3L0O|A Chain A, Structure Of Rna-Free Rho Transcription Termination Factor From Thermotoga Maritima Length = 427 Back     alignment and structure
>pdb|3L0O|A Chain A, Structure Of Rna-Free Rho Transcription Termination Factor From Thermotoga Maritima Length = 427 Back     alignment and structure
>pdb|1A63|A Chain A, The Nmr Structure Of The Rna Binding Domain Of E.Coli Rho Factor Suggests Possible Rna-Protein Interactions, 10 Structures Length = 130 Back     alignment and structure
>pdb|1A62|A Chain A, Crystal Structure Of The Rna-Binding Domain Of The Transcriptional Terminator Protein Rho Length = 130 Back     alignment and structure
>pdb|1A8V|A Chain A, Structure Of The Rna-Binding Domain Of The Rho Transcription Terminator Length = 121 Back     alignment and structure
>pdb|2A8V|A Chain A, Rho Transcription Termination FactorRNA COMPLEX Length = 118 Back     alignment and structure
>pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 Back     alignment and structure
>pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 Back     alignment and structure
>pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 Back     alignment and structure
>pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
3ice_A422 Transcription termination factor RHO; transcriptio 0.0
3ice_A 422 Transcription termination factor RHO; transcriptio 6e-56
3ice_A 422 Transcription termination factor RHO; transcriptio 4e-42
3l0o_A427 Transcription termination factor RHO; helicase, RH 0.0
3l0o_A 427 Transcription termination factor RHO; helicase, RH 1e-103
1a62_A130 RHO; transcription termination, termination, RNA b 4e-45
1a62_A130 RHO; transcription termination, termination, RNA b 2e-44
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 1e-24
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 3e-24
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-19
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 6e-15
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 3e-14
3gqb_A578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 1e-09
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 9e-08
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Length = 422 Back     alignment and structure
 Score =  687 bits (1776), Expect = 0.0
 Identities = 247/356 (69%), Positives = 303/356 (85%), Gaps = 2/356 (0%)

Query: 8   IFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGE 67
           IFGDG LE+L DGFGFLRS  S+Y+A  DDIY+SPSQIRRFNL TGD + G+IR PK GE
Sbjct: 52  IFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGE 111

Query: 68  RYFALLKIKKVNGEKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPI 127
           RYFALLK+ +VN +KPE ++N+ LF+NLTPLH    L +ER   S E++T R++DL +PI
Sbjct: 112 RYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPI 171

Query: 128 GKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVI 187
           G+GQRGL+VA PK+GK+++LQ+IA +I  NH + +++V+LIDERPEEVTEMQR V+GEV+
Sbjct: 172 GRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVV 231

Query: 188 ASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGG 247
           ASTFDEPA RHVQVAEMV+EKAKRLVE KKDVIILLDSITRLARAYNTV+PASGKVLTGG
Sbjct: 232 ASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGG 291

Query: 248 VDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERR 307
           VD+NAL RPKRFFGAARN+EEGGSLTIIATALI+TGS+MD+VIYEEFKGTGNME+HL R+
Sbjct: 292 VDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRK 351

Query: 308 LAEKRVYPAINLNKSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKR 363
           +AEKRV+PAI+ N+SGTR+EELL   ++LQK+W+LRK+++   M       F I +
Sbjct: 352 IAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHP--MGEIDAMEFLINK 405
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Length = 422 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Length = 422 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Length = 427 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Length = 427 Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Length = 130 Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Length = 130 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query592
3l0o_A427 Transcription termination factor RHO; helicase, RH 100.0
3ice_A422 Transcription termination factor RHO; transcriptio 100.0
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 100.0
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 100.0
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 100.0
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 100.0
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 100.0
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 100.0
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 100.0
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 100.0
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 100.0
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 100.0
3vr4_A600 V-type sodium ATPase catalytic subunit A; V-ATPase 100.0
3gqb_A578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 100.0
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 100.0
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 100.0
3l0o_A 427 Transcription termination factor RHO; helicase, RH 100.0
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 100.0
3ice_A 422 Transcription termination factor RHO; transcriptio 100.0
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 100.0
1a62_A130 RHO; transcription termination, termination, RNA b 99.95
1a62_A130 RHO; transcription termination, termination, RNA b 99.85
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 99.79
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 99.79
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 99.79
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 99.77
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 99.77
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 99.75
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 99.75
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 99.75
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 99.74
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 99.66
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 99.58
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 99.53
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 99.52
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 99.48
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.25
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 98.64
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 98.16
3io5_A333 Recombination and repair protein; storage dimer, i 97.79
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.73
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.63
2z43_A324 DNA repair and recombination protein RADA; archaea 97.48
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.44
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.42
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.38
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.37
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.36
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.32
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.29
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.24
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.23
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.17
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.12
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.0
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.96
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.86
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.81
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.73
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.66
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.65
3bos_A242 Putative DNA replication factor; P-loop containing 96.64
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.53
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.49
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.49
3bs4_A260 Uncharacterized protein PH0321; structural genomic 96.43
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.42
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.42
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.38
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.37
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.34
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.32
3pvs_A447 Replication-associated recombination protein A; ma 96.26
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.25
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.2
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.17
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.13
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.12
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.1
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.1
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.04
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.02
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.0
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.93
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.88
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.69
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.63
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.56
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.52
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.5
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.49
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.48
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.46
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.4
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.26
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.25
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.25
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.24
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.23
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.16
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.14
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 95.08
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.05
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.04
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.99
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.98
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.9
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.87
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.84
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.79
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.75
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.75
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.75
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.72
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.68
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.61
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.6
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.6
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.6
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.6
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.55
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.51
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.5
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.49
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.46
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 94.45
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.45
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.44
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 94.44
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.42
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.39
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 94.39
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.36
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.34
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.34
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.3
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.29
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.26
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.23
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.21
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.2
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.2
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.2
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.19
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.18
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.18
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.17
1g6h_A257 High-affinity branched-chain amino acid transport 94.17
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.15
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 94.12
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 94.11
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.1
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.09
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.08
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.06
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.05
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.04
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.03
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.03
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.02
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 94.02
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.01
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.01
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 93.99
2ghi_A260 Transport protein; multidrug resistance protein, M 93.99
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 93.97
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.94
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 93.93
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.9
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.88
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.87
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 93.85
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.83
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 93.83
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.82
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.82
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.8
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.78
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 93.75
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.74
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 93.73
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 93.73
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 93.72
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 93.67
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 93.66
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.58
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 93.57
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.56
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 93.55
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 93.45
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.4
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.4
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.39
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 93.39
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 93.38
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 93.36
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.34
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.26
2og2_A359 Putative signal recognition particle receptor; nuc 93.24
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.23
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.22
2fna_A357 Conserved hypothetical protein; structural genomic 93.17
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.17
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.15
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.15
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 93.13
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 93.11
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.11
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.1
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 93.09
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.05
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 93.05
2qgz_A308 Helicase loader, putative primosome component; str 93.04
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 93.03
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 93.03
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 93.03
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.02
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.99
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.93
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.86
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.81
2ewv_A 372 Twitching motility protein PILT; pilus retraction 92.76
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.73
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 92.62
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.61
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.61
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.6
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 92.56
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 92.48
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 92.37
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 92.35
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.34
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.33
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 92.3
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.3
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 92.28
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.27
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.2
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.14
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.1
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 92.07
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 92.02
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 91.95
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.94
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 91.92
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 91.91
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.89
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 91.86
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.86
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 91.82
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.81
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.8
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 91.8
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 91.72
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.68
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 91.65
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 91.62
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.59
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 91.56
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.56
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.56
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.55
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.53
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 91.52
2r62_A268 Cell division protease FTSH homolog; ATPase domain 91.51
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.51
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 91.47
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.45
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 91.45
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.44
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.41
1via_A175 Shikimate kinase; structural genomics, transferase 91.4
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 91.4
2xxa_A433 Signal recognition particle protein; protein trans 91.35
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 91.25
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.25
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.16
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.15
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 91.15
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 91.15
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 91.13
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 91.12
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 91.09
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.08
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.06
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 91.03
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.02
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.01
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 90.99
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 90.97
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 90.93
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 90.88
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.85
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 90.82
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 90.78
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 90.72
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 90.7
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 90.69
4a74_A231 DNA repair and recombination protein RADA; hydrola 90.63
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 90.62
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 90.6
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.58
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 90.58
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.58
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 90.57
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 90.57
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 90.56
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.56
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 90.55
1p9r_A418 General secretion pathway protein E; bacterial typ 90.54
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 90.53
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.52
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.49
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 90.47
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.41
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 90.36
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 90.36
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.29
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 90.25
2www_A349 Methylmalonic aciduria type A protein, mitochondri 90.23
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.22
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 90.17
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 90.16
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 90.15
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.14
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.14
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.12
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 90.11
1b0u_A 262 Histidine permease; ABC transporter, transport pro 90.11
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 90.1
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.03
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 89.91
3bos_A242 Putative DNA replication factor; P-loop containing 89.91
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 89.88
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 89.87
1g6h_A 257 High-affinity branched-chain amino acid transport 89.85
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 89.8
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 89.79
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 89.77
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 89.77
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 89.72
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.72
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.7
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 89.7
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.64
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 89.64
2wji_A165 Ferrous iron transport protein B homolog; membrane 89.64
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.63
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.61
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 89.57
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 89.55
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.55
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 89.53
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 89.53
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 89.51
1ji0_A240 ABC transporter; ATP binding protein, structural g 89.48
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 89.47
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 89.46
2ytx_A97 Cold shock domain-containing protein E1; cell-free 89.44
3r20_A233 Cytidylate kinase; structural genomics, seattle st 89.44
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 89.4
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.39
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 89.39
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 89.38
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 89.35
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 89.35
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.34
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 89.33
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 89.33
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 89.32
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 89.31
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.29
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.28
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 89.27
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 89.23
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 89.22
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.21
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 89.19
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 89.15
2r44_A331 Uncharacterized protein; putative ATPase, structur 89.14
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 89.14
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 89.12
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 89.09
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 89.08
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 89.07
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 89.06
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 89.03
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 88.98
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 88.97
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 88.94
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.93
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 88.93
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 88.91
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 88.9
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 88.9
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 88.87
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 88.85
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 88.84
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 88.83
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 88.83
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 88.81
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 88.77
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 88.76
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 88.73
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 88.72
3tlx_A243 Adenylate kinase 2; structural genomics, structura 88.72
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.67
2yty_A88 Cold shock domain-containing protein E1; cell-free 88.67
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.65
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 88.61
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 88.58
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 88.57
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 88.57
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 88.56
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 88.51
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 88.5
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 88.49
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.49
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 88.49
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 88.47
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 88.45
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 88.45
2ghi_A 260 Transport protein; multidrug resistance protein, M 88.44
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 88.43
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 88.42
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 88.4
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 88.38
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 88.37
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 88.37
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 88.37
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.31
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 88.3
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 88.3
3kta_A182 Chromosome segregation protein SMC; structural mai 88.28
2chg_A226 Replication factor C small subunit; DNA-binding pr 88.26
1x65_A89 UNR protein; cell-free protein synthesis, beta-bar 88.21
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.2
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 88.19
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 88.19
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 88.14
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.11
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 88.09
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 88.07
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 88.06
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.04
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 88.04
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 88.02
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 87.93
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 87.89
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 87.89
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 87.88
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 87.87
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 87.85
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 87.84
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 87.82
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 87.79
2chq_A319 Replication factor C small subunit; DNA-binding pr 87.77
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 87.76
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 87.73
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.72
2ged_A193 SR-beta, signal recognition particle receptor beta 87.71
1tue_A212 Replication protein E1; helicase, replication, E1E 87.71
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 87.68
2ytv_A79 Cold shock domain-containing protein E1; cell-free 87.68
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 87.67
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 87.61
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 87.61
2id0_A 644 Exoribonuclease 2; RNAse, exonuclease, hydrolyase, 87.59
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 87.5
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 87.49
3cam_A67 Cold-shock domain family protein; cold shock prote 87.49
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 87.47
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 87.47
3vaa_A199 Shikimate kinase, SK; structural genomics, center 87.36
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 87.32
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 87.29
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 87.24
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 87.23
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 87.18
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 87.18
1h95_A79 CSD, Y-box binding protein; translation factor, tr 87.15
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 87.13
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 87.12
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 87.12
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 87.07
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 87.03
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 86.99
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 86.99
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 86.92
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 86.92
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.92
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 86.87
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 86.85
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 86.83
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 86.8
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 86.8
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 86.76
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 86.74
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=2.2e-106  Score=856.05  Aligned_cols=372  Identities=56%  Similarity=0.901  Sum_probs=361.3

Q ss_pred             CCCCCceEEeeEEEEEeCCCeeEEeCCCCCCCCCCCCeeECccccccccCCCCCeEEEEEECCCCCccccceeeeeecCC
Q psy3765           1 KTKIGERIFGDGSLEVLPDGFGFLRSQGSNYMASSDDIYLSPSQIRRFNLHTGDFVEGEIRVPKNGERYFALLKIKKVNG   80 (592)
Q Consensus         1 ~~~~~~~~~~~G~le~~~dg~gflr~~~~~y~~~~~dvyV~~~~~r~~~L~vGd~l~GrV~~p~g~e~~~~l~~v~~ing   80 (592)
                      ++++++.++++||||+++|||||||+.++||+|+++|||||++|+|+|+||+||.+.|.|+.|+.+|+|++|++|++|||
T Consensus        49 ~~~~~~~~~~~g~le~~~~g~gflr~~~~~y~~~~~d~yvs~~~ir~~~lr~gd~v~g~~r~~~~~e~~~~l~~v~~vng  128 (427)
T 3l0o_A           49 QTESTGYFFGEGVLEIHPEGFGFLRRIEDNLLPSNDDIYISPSQIRKFNLNTGDIISGVIRKPKEGEKYFAMIKIEAINY  128 (427)
T ss_dssp             GGSSSSEEEEEEEEEECTTSCEEEECGGGTTCCCSSCEEECHHHHHHTTCCTTCEEEEEEECCCSSSCSEEEEEEEEETT
T ss_pred             HHhhcCceeEEEEEEEcCCCceEeeCCccCCCCCCCCeeeCHHHHHhcCCCCCCEEEEEEeCCCCCcccccceEEEecCC
Confidence            35788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccccCccccCCCCCCcccccccccccCCccccccceeeccccccccceeeeecCCCCChhHHHHHHHHHHHhcCCC
Q psy3765          81 EKPELSKNRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSE  160 (592)
Q Consensus        81 ~~p~~~~~r~~~d~l~pi~p~~R~~ie~~ap~~l~TGiraID~l~PigkGQR~~I~g~~g~GKT~Ll~~Ia~~i~~~~~~  160 (592)
                      .+|+....|+.|+.++|++|.+|.++++   ++++||+|+||+|+|||||||++|||++|+|||+|+++|+++++++|++
T Consensus       129 ~~p~~~~~r~~fe~l~Pi~P~~R~~le~---e~~~tGiraID~l~PigrGQR~lIfg~~g~GKT~Ll~~Ia~~i~~~~~d  205 (427)
T 3l0o_A          129 RPVEAVNDRVNFDNLTPDYPRERFILET---DPKIYSTRLIDLFAPIGKGQRGMIVAPPKAGKTTILKEIANGIAENHPD  205 (427)
T ss_dssp             EEC----CCCCGGGSCEECCCSBCCCCC---STTCHHHHHHHHHSCCBTTCEEEEEECTTCCHHHHHHHHHHHHHHHCTT
T ss_pred             CChHHhccccccccCCCCCchhhccccc---cchhccchhhhhcccccCCceEEEecCCCCChhHHHHHHHHHHhhcCCC
Confidence            9999999999999999999999999994   3899999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEEeccchhHHHHHHhhccEEEEEeCCCCCHHHHHHHHHhHHHHHHHHHHcCCcEEEeccchhHHHHHHhhhccCC
Q psy3765         161 AIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPAS  240 (592)
Q Consensus       161 ~~~I~~lIGeR~~Ev~e~~~~~~~~vV~~t~d~~~~~r~~~~~~a~t~AE~~r~~G~dVlll~Dsltr~A~A~reis~~~  240 (592)
                      ++|||++||||++||++|+++++++||++|+|+||.+|++++++|+++||||||+|+||||++||+||||+|||||++++
T Consensus       206 v~~V~~lIGER~~EV~d~~~~~~G~VV~atadep~~~r~~~a~~altiAEyfrd~G~dVLil~DslTR~A~A~rEvs~~~  285 (427)
T 3l0o_A          206 TIRIILLIDERPEEVTDIRESTNAIVIAAPFDMPPDKQVKVAELTLEMAKRLVEFNYDVVILLDSLTRLARVYNIVVPPS  285 (427)
T ss_dssp             SEEEEEECSCCHHHHSSSSSSCCSEEEECCTTSCHHHHHHHHHHHHHHHHHHHHTTCEEEEEEECHHHHHHHHHHHSCCC
T ss_pred             eEEEEEEeccCcchHHHHHHHhCCeEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCCEEEecccchHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCcccccchHHHhhcccccCCcceeeEEEEEeecCCCCCcccccccccccCeEEEechHhHhcCCCCCCcCC
Q psy3765         241 GKVLTGGVDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLN  320 (592)
Q Consensus       241 Ge~p~~Gyp~~l~~~~~~~~erA~~~~~~GSIT~i~tvlv~tg~d~~dpI~d~~~~i~dg~i~Ldr~La~~gifPAID~l  320 (592)
                      ||+|++|||+++++.|++||||||+++++||||+|+|+++||||||+|||+|++++|+||||+|||+||++||||||||+
T Consensus       286 Ge~~s~Gypp~~~~~~~~~~erA~~ie~~GSIT~i~tvlvetgdd~~dpI~d~~~~i~dg~IvLsR~La~~giyPAIDvl  365 (427)
T 3l0o_A          286 GKLLTGGVDPAALYKPKRFFGAARNTREGGSLTIIATALVETGSKMDEVIFEEFKGTGNMELVLSRQLANKRIFPAINLL  365 (427)
T ss_dssp             SCCCSSSCCSSCSHHHHHHHHTCEEESSSCEEEEEEEEECSSSCSHHHHHHHHTTTCCSEEEEBCHHHHTTTCSSCBCST
T ss_pred             CCCCCCCcCchhhcchHHHHHhhcccCCCcceeEEEEEEecCCCCcCCcchHHhcccCCceEEEeHHHHhCCCCCccCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccCCCCCHHHHHHHHHHHHHHhccccHHHHHhccccccCChhhhHHHhhc
Q psy3765         321 KSGTRREELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDA  375 (592)
Q Consensus       321 ~S~SR~~~~~~~~~~~~~~~~lr~~l~~~~~~~~li~l~g~~~~~~~~k~~L~~~  375 (592)
                      .|+||+++.+++++|++.++++|++|+.|+++++|.++++..+++++|++||..+
T Consensus       366 ~S~SR~~~~l~~~~h~~~a~~lr~~la~y~e~e~l~~ll~~~~~t~~n~~f~~~~  420 (427)
T 3l0o_A          366 LSGTRREELLLDEETLKKVWLLRRMLSAMTEEEGLTLILNKLSETSSNEEFLKLI  420 (427)
T ss_dssp             TCEETTGGGTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHTCSSHHHHHHHC
T ss_pred             ccccccccccCCHHHHHHHHHHHHHHHhcchHHHHHHHHHHHhcCCCHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999854
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 592
d1xpua3289 c.37.1.11 (A:129-417) Transcription termination fa 2e-90
d1xpua3 289 c.37.1.11 (A:129-417) Transcription termination fa 1e-17
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 3e-53
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 2e-10
d2jdia3285 c.37.1.11 (A:95-379) Central domain of alpha subun 3e-45
d1fx0a3276 c.37.1.11 (A:97-372) Central domain of alpha subun 2e-40
d1a62a278 b.40.4.5 (A:48-125) Rho termination factor, RNA-bi 5e-36
d1a62a278 b.40.4.5 (A:48-125) Rho termination factor, RNA-bi 5e-31
d1a62a147 a.140.3.1 (A:1-47) Rho termination factor, N-termi 9e-05
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Transcription termination factor Rho, ATPase domain
species: Escherichia coli [TaxId: 562]

 Score =  278 bits (712), Expect = 2e-90
 Identities = 189/262 (72%), Positives = 234/262 (89%)

Query: 88  NRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIIL 147
           N+ LF+NLTPLH    L +ER   S E++T R++DL +PIG+GQRGL+VA PK+GK+++L
Sbjct: 1   NKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLL 60

Query: 148 QHIAHAITTNHSEAIMIVMLIDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLE 207
           Q+IA +I  NH + +++V+LIDERPEEVTEMQR V+GEV+ASTFDEPA RHVQVAEMV+E
Sbjct: 61  QNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIE 120

Query: 208 KAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRFFGAARNIE 267
           KAKRLVE KKDVIILLDSITRLARAYNTV+PASGKVLTGGVD+NAL RPKRFFGAARN+E
Sbjct: 121 KAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVE 180

Query: 268 EGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRRE 327
           EGGSLTIIATALI+TGS+MD+VIYEEFKGTGNME+HL R++AEKRV+PAI+ N+SGTR+E
Sbjct: 181 EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKE 240

Query: 328 ELLIQDDKLQKIWVLRKLLYSL 349
           ELL   ++LQK+W+LRK+++ +
Sbjct: 241 ELLTTQEELQKMWILRKIIHPM 262
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1a62a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 47 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query592
d1xpua3289 Transcription termination factor Rho, ATPase domai 100.0
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 100.0
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 100.0
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 100.0
d1a62a278 Rho termination factor, RNA-binding domain {Escher 99.91
d1a62a278 Rho termination factor, RNA-binding domain {Escher 99.89
d1xpua3 289 Transcription termination factor Rho, ATPase domai 99.86
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 99.78
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 99.78
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 99.77
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 98.01
d1fx0b1108 F1 ATP synthase beta subunit, domain 3 {Spinach (S 97.91
d1a62a147 Rho termination factor, N-terminal domain {Escheri 97.85
d2jdid1118 F1 ATP synthase beta subunit, domain 3 {Rat (Rattu 97.74
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.74
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.71
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.71
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.61
d1skye1114 F1 ATP synthase beta subunit, domain 3 {Bacillus s 97.61
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.29
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.85
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.77
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.6
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.59
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.45
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.33
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.17
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.16
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.11
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.03
d2ix0a279 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 95.91
d1okkd2207 GTPase domain of the signal recognition particle r 95.86
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.81
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.67
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.67
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.63
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.6
d1wfqa_89 Cold shock domain protein E1 (UNR) {Human (Homo sa 95.58
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.54
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.52
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.41
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.41
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.4
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.37
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.34
d1vmaa2213 GTPase domain of the signal recognition particle r 95.34
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.32
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.31
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.29
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.24
d2qy9a2211 GTPase domain of the signal recognition particle r 95.17
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.11
d2ix0a279 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 95.1
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.09
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.98
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.94
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.91
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.9
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.9
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.83
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.74
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.74
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.69
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.67
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.66
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.64
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.58
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.58
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.57
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.57
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.55
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.55
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.53
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.5
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.5
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.46
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.4
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.34
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 94.23
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.22
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.17
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.15
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.15
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.14
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 94.11
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.08
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.05
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 94.02
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.97
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.97
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.92
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.89
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.77
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.72
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.67
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.64
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.63
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 93.62
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 93.61
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.6
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.47
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.46
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.45
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.37
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.35
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.31
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.29
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.21
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.19
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.19
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.15
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.13
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.09
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.87
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.84
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.77
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.65
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.62
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.61
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.58
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.54
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.53
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.37
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.35
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.34
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.32
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.3
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.28
d1wfqa_89 Cold shock domain protein E1 (UNR) {Human (Homo sa 92.26
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.23
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.16
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.0
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 91.99
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.92
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.83
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.77
d1h95a_79 Y-box protein 1 cold shock domain (YB1-CSD) {Human 91.73
d1g2912 240 Maltose transport protein MalK, N-terminal domain 91.71
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.61
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.47
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.42
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 91.26
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.12
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.07
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.06
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.04
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.99
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.95
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.93
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.83
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.79
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.77
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.73
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.51
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 90.47
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 90.44
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 90.42
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 90.4
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.31
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 90.28
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.26
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.19
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.16
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 90.13
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.05
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.03
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.01
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.0
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 89.93
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 89.88
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 89.86
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.83
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.82
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.72
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.7
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 89.68
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.66
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.59
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.54
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 89.48
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.46
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.43
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.43
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.39
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.39
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.38
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.35
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.34
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.28
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.11
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.09
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.09
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.09
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.02
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.02
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.01
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.01
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.94
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.93
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.81
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 88.76
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.72
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.71
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.64
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.63
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.62
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.61
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 88.61
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 88.31
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 88.28
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.18
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 88.05
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.05
d1nrjb_209 Signal recognition particle receptor beta-subunit 87.97
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.97
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.9
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 87.88
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 87.81
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.77
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 87.75
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.72
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.67
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.66
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 87.62
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 87.58
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 87.58
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 87.51
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.51
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.47
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 87.47
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.46
d2qy9a2211 GTPase domain of the signal recognition particle r 87.45
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.33
d1svma_362 Papillomavirus large T antigen helicase domain {Si 87.17
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 87.11
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 87.1
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.05
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 87.05
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 86.99
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 86.9
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 86.89
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.86
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.86
d1okkd2207 GTPase domain of the signal recognition particle r 86.83
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 86.81
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.81
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.73
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 86.7
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 86.65
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 86.6
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.59
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 86.5
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.48
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.46
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.39
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.38
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.32
d1vmaa2213 GTPase domain of the signal recognition particle r 86.27
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 86.25
d1j8yf2211 GTPase domain of the signal sequence recognition p 86.2
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.2
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.16
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.06
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 85.96
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 85.94
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 85.82
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.78
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 85.64
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 85.58
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.57
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.55
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 85.53
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 85.53
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 85.52
d1g6pa_66 Major cold shock protein {Thermotoga maritima [Tax 85.48
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.48
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 85.46
d1mjca_69 Major cold shock protein {Escherichia coli [TaxId: 85.27
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.21
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.12
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 85.1
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 85.09
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 85.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 85.04
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.02
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.98
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 84.93
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 84.91
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 84.78
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 84.7
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.65
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 84.62
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.46
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 84.38
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 84.26
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 84.05
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.76
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.6
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.48
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 83.34
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 83.24
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 83.24
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 83.21
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.11
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 83.05
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 83.01
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 82.93
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 82.74
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.71
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 82.56
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 82.54
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.53
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 82.42
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 82.25
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.69
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.65
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 81.57
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 81.56
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 81.54
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.37
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.18
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 81.17
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 81.03
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 80.9
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 80.82
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 80.81
d1c9oa_66 Major cold shock protein {Bacillus caldolyticus [T 80.8
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 80.51
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 80.47
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.28
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 80.17
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Transcription termination factor Rho, ATPase domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.3e-77  Score=609.48  Aligned_cols=288  Identities=66%  Similarity=1.019  Sum_probs=271.5

Q ss_pred             cCccccCCCCCCcccccccccccCCccccccceeeccccccccceeeeecCCCCChhHHHHHHHHHHHhcCCCeEEEEEE
Q psy3765          88 NRTLFDNLTPLHPKKLLLLERNIESKENITGRIIDLIAPIGKGQRGLLVASPKSGKSIILQHIAHAITTNHSEAIMIVML  167 (592)
Q Consensus        88 ~r~~~d~l~pi~p~~R~~ie~~ap~~l~TGiraID~l~PigkGQR~~I~g~~g~GKT~Ll~~Ia~~i~~~~~~~~~I~~l  167 (592)
                      +|.+||+++|++|.+|.++|.+.|.+.+||+|+||+|+|||||||+||||++|+|||+|+++|++++..+|+++.+|+++
T Consensus         1 ~~~~fd~l~Pi~p~~r~~le~~~~~~~~~~~r~ID~l~PigrGQr~~I~g~~g~GKT~l~~~i~~~~~~~~~~~v~~~~~   80 (289)
T d1xpua3           1 NKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLL   80 (289)
T ss_dssp             CCCGGGCCCCCSTTSBCCC----CCSTHHHHHHHHHHSCCBTTCEEEEEECSSSSHHHHHHHHHHHHHHHCTTSEEEEEE
T ss_pred             CCCCCCCCCCCCCCCccccccCCCCcccccceeeeecccccCCCeeeEeCCCCCCHHHHHHHHHHHHhhcCCCeEEEEEe
Confidence            36789999999999999999988888999999999999999999999999999999999999999999999999899999


Q ss_pred             eccchhHHHHHHhhccEEEEEeCCCCCHHHHHHHHHhHHHHHHHHHHcCCcEEEeccchhHHHHHHhhhccCCCCCCCCC
Q psy3765         168 IDERPEEVTEMQRSVRGEVIASTFDEPAYRHVQVAEMVLEKAKRLVEMKKDVIILLDSITRLARAYNTVIPASGKVLTGG  247 (592)
Q Consensus       168 IGeR~~Ev~e~~~~~~~~vV~~t~d~~~~~r~~~~~~a~t~AE~~r~~G~dVlll~Dsltr~A~A~reis~~~Ge~p~~G  247 (592)
                      ||||++|+++|.+..+++||++|+|+||..|++++++|+++||||||+|+||||++||+||||+||||+|+++||+|++|
T Consensus        81 iger~~ev~~~~~~~~~~vv~~t~d~~~~~r~~~~~~a~~iAEyfrd~G~dVLli~Dsltr~A~A~rEis~~~ge~p~~g  160 (289)
T d1xpua3          81 IDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGG  160 (289)
T ss_dssp             EEECHHHHHHHHHHCSSEEEEEETTSCHHHHHHHHHHHHHHHHHHHTTTCEEEEEESCHHHHHHHHHHHSCC---CBSSS
T ss_pred             eceeHHHHHhHHhhcceEEEeccCCCchhHHHHHHHHHHHHHHHHHHhccCceeecCcHHHHHHHHHHHHhhccCCCcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccchHHHhhcccccCCcceeeEEEEEeecCCCCCcccccccccccCeEEEechHhHhcCCCCCCcCCCCCcccc
Q psy3765         248 VDSNALQRPKRFFGAARNIEEGGSLTIIATALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINLNKSGTRRE  327 (592)
Q Consensus       248 yp~~l~~~~~~~~erA~~~~~~GSIT~i~tvlv~tg~d~~dpI~d~~~~i~dg~i~Ldr~La~~gifPAID~l~S~SR~~  327 (592)
                      ||+++|+.+++||||||+++++||+|+++++++++|||+++||++++++++||||+|||+||++||||||||+.|+||++
T Consensus       161 yp~~~~~~~~~l~era~~~~~gGsit~~~~~~~~~~dd~~~pI~~~~~~i~dg~ivLsr~la~~g~~PAId~~~S~SR~~  240 (289)
T d1xpua3         161 VDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKE  240 (289)
T ss_dssp             SBTTTTHHHHHHHHTCEECTTSCEEEEEEEEECSSSCHHHHHHHHHHTTTSSEEEEBCHHHHTTTCSSCBCTTTCEESCG
T ss_pred             cChhhhhhhHHHHHhccCCCCCCcceEEEEEeecCCCccCchHHHHHhcccCeEEEEchhHHhCCCCCCCccCCcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHhccccHHHHHhccccccCChhhhHHHhhc
Q psy3765         328 ELLIQDDKLQKIWVLRKLLYSLTMTSFTVSLFFIKRTIPVEKNLLKDA  375 (592)
Q Consensus       328 ~~~~~~~~~~~~~~lr~~l~~~~~~~~li~l~g~~~~~~~~k~~L~~~  375 (592)
                      +.+++++|++.++.+|++|+.|++.+++..|+.....+++|+++|+.+
T Consensus       241 ~~l~~~~~~~~~~~lRr~l~~~~~~~~~e~Li~~l~~tk~N~efl~~~  288 (289)
T d1xpua3         241 ELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMM  288 (289)
T ss_dssp             GGGSCHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHTTSCSTHHHHHSC
T ss_pred             hhhCCHHHHHHHHHHHHHHHhcchHHHHHHHHHHHccCCCHHHHHHhh
Confidence            999999999999999999999999888888877777888999998754
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1a62a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure