Psyllid ID: psy3781


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MIAKEAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKLPST
cccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHccccccccccccccccccccccccccccEEccccccccccHHHHccccccEEcccccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEcccccccccHHHHHHccHHHHHHHHHcccccc
cHHHHHHccEEcccccccccccHHHHHHHcccEEEcccccccEccHHHHHcccccEEEcccccccEcHHHcccccccEEEccccccccccHHHHHHccccEEEccccccccccccHHHHcHHcccEEEccccccccccHHHHccccccEEEccccccccccHHHHHccccEEEEccccccccc
MIAKEAQVEQADLSynrlhvvnsklfditsireldlshnliqnlppdllnLRHLVYMNlennkletididfnfghlrelnlssnkfqqipkcifhldnleililnnndieeinqpekLVKMQKLTVLdlsnnnirkipYELGLAQQLHHLNlvgncfkyprqdilqkgtPFLLSYlrdklpst
MIAKEAQVEqadlsynrlhvVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLsylrdklpst
MIAKEAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHldnleililnnndieeinQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKLPST
************LSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLR******
MIAKEAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKL***
*********QADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKLPST
MIAKEAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLR******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAKEAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDFNFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKLPST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q9H9A6602 Leucine-rich repeat-conta yes N/A 0.950 0.289 0.338 4e-21
Q7SXW3601 Leucine-rich repeat-conta yes N/A 0.950 0.289 0.327 7e-21
Q6GPJ5605 Leucine-rich repeat-conta N/A N/A 0.978 0.295 0.329 8e-21
Q5RFE9602 Leucine-rich repeat-conta yes N/A 0.950 0.289 0.327 4e-20
Q5M8G4605 Leucine-rich repeat-conta yes N/A 0.950 0.287 0.327 4e-20
Q4R3P6602 Leucine-rich repeat-conta N/A N/A 0.950 0.289 0.327 4e-20
Q5ZLN0603 Leucine-rich repeat-conta yes N/A 0.950 0.288 0.327 5e-20
Q9CRC8602 Leucine-rich repeat-conta yes N/A 0.978 0.297 0.324 5e-20
Q8BGR2859 Leucine-rich repeat-conta no N/A 0.786 0.167 0.374 4e-16
Q5U308858 Leucine-rich repeat-conta no N/A 0.786 0.167 0.367 6e-16
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 108/177 (61%), Gaps = 3/177 (1%)

Query: 8   VEQADLSYNRLHVVNSKLFDITS-IRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLET 66
           V   + S N+L  +  ++ ++   + ++DLS N +  +  +L  L+ L +++L NN L +
Sbjct: 427 VTSINFSKNQLCEIPKRMVELKEMVSDVDLSFNKLSFISLELCVLQKLTFLDLRNNFLNS 486

Query: 67  IDIDF-NFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLT 125
           +  +  +   L+ +NLS N+F+ +P+ ++ +  LE ++++NN +  ++ P+K+  M+ LT
Sbjct: 487 LPEEMESLVRLQTINLSFNRFKMLPEVLYRIFTLETILISNNQVGSVD-PQKMKMMENLT 545

Query: 126 VLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKLPS 182
            LDL NN++ +IP ELG    L  L L GN F+ PR  IL KGT  +L YLRD++P+
Sbjct: 546 TLDLQNNDLLQIPPELGNCVNLRTLLLDGNPFRVPRAAILMKGTAAILEYLRDRIPT 602





Homo sapiens (taxid: 9606)
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=2 SV=2 Back     alignment and function description
>sp|Q8BGR2|LRC8D_MOUSE Leucine-rich repeat-containing protein 8D OS=Mus musculus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description
>sp|Q5U308|LRC8D_RAT Leucine-rich repeat-containing protein 8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
156551095 591 PREDICTED: leucine-rich repeat-containin 0.978 0.302 0.445 4e-31
357618946 601 putative mitotic protein phosphatase 1 r 0.994 0.302 0.416 7e-31
158286480 626 AGAP006993-PA [Anopheles gambiae str. PE 0.967 0.282 0.413 1e-28
195109404 694 GI24424 [Drosophila mojavensis] gi|19391 0.983 0.259 0.393 4e-27
350425451 602 PREDICTED: leucine-rich repeat-containin 0.972 0.295 0.403 9e-27
170029739 612 leucine-rich repeat-containing protein 4 0.978 0.292 0.373 1e-26
196008717 608 hypothetical protein TRIADDRAFT_27850 [T 0.994 0.299 0.389 1e-26
157135396 608 mitotic protein phosphatase 1 regulator, 0.983 0.296 0.382 2e-26
383849806 604 PREDICTED: leucine-rich repeat-containin 0.983 0.298 0.404 3e-26
380014404 602 PREDICTED: leucine-rich repeat-containin 0.961 0.292 0.420 4e-26
>gi|156551095|ref|XP_001603101.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 117/182 (64%), Gaps = 3/182 (1%)

Query: 3   AKEAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLL-NLRHLVYMNLEN 61
           AKEA+V   DLS N+L V+   +  +TS  +L LS+NL+  LP  L  +L  L Y++L  
Sbjct: 409 AKEAEVTCVDLSRNKLQVLTDAMSKVTSTTDLKLSYNLLAELPEWLGESLERLRYLDLSK 468

Query: 62  NKLETIDIDFN-FGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVK 120
           N L ++    +    L E+N+S NKF+++P+CI+ +  LEILI N+N +  IN P  L  
Sbjct: 469 NLLTSLPASLSQLRLLVEINISFNKFEEMPECIYEIAGLEILIANDNKMSCINVP-ALSN 527

Query: 121 MQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDKL 180
           +++L  LDLSNNNI  +P ELG  + L  L+L GNCFK PRQ  L KGT  +L+YLR+++
Sbjct: 528 LKRLAHLDLSNNNIGYVPPELGNLKNLRMLSLSGNCFKQPRQATLMKGTEEILAYLRNRI 587

Query: 181 PS 182
           P+
Sbjct: 588 PT 589




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357618946|gb|EHJ71730.1| putative mitotic protein phosphatase 1 regulator [Danaus plexippus] Back     alignment and taxonomy information
>gi|158286480|ref|XP_308777.4| AGAP006993-PA [Anopheles gambiae str. PEST] gi|157020488|gb|EAA04662.4| AGAP006993-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195109404|ref|XP_001999277.1| GI24424 [Drosophila mojavensis] gi|193915871|gb|EDW14738.1| GI24424 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|350425451|ref|XP_003494125.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170029739|ref|XP_001842749.1| leucine-rich repeat-containing protein 40 [Culex quinquefasciatus] gi|167864068|gb|EDS27451.1| leucine-rich repeat-containing protein 40 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|196008717|ref|XP_002114224.1| hypothetical protein TRIADDRAFT_27850 [Trichoplax adhaerens] gi|190583243|gb|EDV23314.1| hypothetical protein TRIADDRAFT_27850 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|157135396|ref|XP_001656638.1| mitotic protein phosphatase 1 regulator, putative [Aedes aegypti] gi|108881267|gb|EAT45492.1| AAEL003228-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|383849806|ref|XP_003700527.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380014404|ref|XP_003691222.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
FB|FBgn0028487693 f-cup "flyers-cup" [Drosophila 0.983 0.259 0.338 3.7e-22
MGI|MGI:1914394602 Lrrc40 "leucine rich repeat co 0.972 0.295 0.303 1.3e-18
FB|FBgn0035008240 CG3494 [Drosophila melanogaste 0.967 0.737 0.336 5.8e-18
ZFIN|ZDB-GENE-030131-6062601 lrrc40 "leucine rich repeat co 0.950 0.289 0.305 7.3e-18
MGI|MGI:1922368859 Lrrc8d "leucine rich repeat co 0.781 0.166 0.331 9e-13
UNIPROTKB|Q7L1W4858 LRRC8D "Leucine-rich repeat-co 0.781 0.166 0.331 1.1e-12
RGD|1309601858 Lrrc8d "leucine rich repeat co 0.743 0.158 0.330 1.5e-12
MGI|MGI:1927197582 Shoc2 "soc-2 (suppressor of cl 0.923 0.290 0.274 7.5e-12
ZFIN|ZDB-GENE-050208-523 561 shoc2 "soc-2 suppressor of cle 0.863 0.281 0.298 9e-12
UNIPROTKB|Q8AVI4577 shoc2 "Leucine-rich repeat pro 0.923 0.292 0.274 9.5e-12
FB|FBgn0028487 f-cup "flyers-cup" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 3.7e-22, P = 3.7e-22
 Identities = 62/183 (33%), Positives = 97/183 (53%)

Query:     2 IAKEAQVEQADLSYNRLHVVNSKLFDITS-IRELDLSHNLIQNLPPDLLNLRHLVYMNLE 60
             IA++  V   D + N+L  + + L  +   + EL LS+N+I  +P  +     + ++NL 
Sbjct:   512 IARDEGVHVVDFARNQLSTLPNGLQHMKDLVTELVLSNNVIGYVPQFISQFTRISFLNLS 571

Query:    61 NNKLETIDIDFN-FGHLRELNLSSNKFQQIPKCIFHXXXXXXXXXXXXXXXXXXQPEKLV 119
             NN L  +  +F     LRELN+++N+F  IP C++                       L 
Sbjct:   572 NNLLNDLPTEFGVLNTLRELNIANNRFPCIPNCVYELQGLEILIASENHIKML-NVSGLQ 630

Query:   120 KMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNCFKYPRQDILQKGTPFLLSYLRDK 179
              M++L+ LDL NN+I  +P  LG    + HL LVGN F+ PR  IL KGT  ++SYLRD+
Sbjct:   631 NMRRLSTLDLRNNDIETVPPILGNLTNITHLELVGNPFRQPRHQILMKGTDAIMSYLRDR 690

Query:   180 LPS 182
             +P+
Sbjct:   691 IPT 693


GO:0007265 "Ras protein signal transduction" evidence=ISS
MGI|MGI:1914394 Lrrc40 "leucine rich repeat containing 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0035008 CG3494 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1922368 Lrrc8d "leucine rich repeat containing 8D" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L1W4 LRRC8D "Leucine-rich repeat-containing protein 8D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309601 Lrrc8d "leucine rich repeat containing 8 family, member D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8AVI4 shoc2 "Leucine-rich repeat protein SHOC-2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 56.0 bits (135), Expect = 1e-09
 Identities = 54/150 (36%), Positives = 76/150 (50%), Gaps = 9/150 (6%)

Query: 13  LSYNRLH-VVNSKLFDITSIRELDLSHN-LIQNLPPDLLNLRHLVYMNLENNKLETIDID 70
           L YN L   +  ++  +TS+  LDL +N L   +P  L NL++L Y+ L  NKL +  I 
Sbjct: 219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKL-SGPIP 277

Query: 71  ---FNFGHLRELNLSSNKFQ-QIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTV 126
              F+   L  L+LS N    +IP+ +  L NLEIL L +N+      P  L  + +L V
Sbjct: 278 PSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTG-KIPVALTSLPRLQV 336

Query: 127 LDL-SNNNIRKIPYELGLAQQLHHLNLVGN 155
           L L SN    +IP  LG    L  L+L  N
Sbjct: 337 LQLWSNKFSGEIPKNLGKHNNLTVLDLSTN 366


Length = 968

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
KOG0617|consensus264 99.86
KOG0472|consensus565 99.85
KOG0617|consensus264 99.85
KOG0472|consensus 565 99.77
KOG4194|consensus 873 99.76
KOG4194|consensus 873 99.76
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.75
KOG0532|consensus 722 99.7
KOG0444|consensus 1255 99.67
KOG0444|consensus 1255 99.64
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.56
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
KOG0618|consensus 1081 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG4237|consensus 498 99.44
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.44
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.44
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
KOG1259|consensus490 99.41
KOG0618|consensus 1081 99.41
KOG4237|consensus 498 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
KOG1259|consensus490 99.36
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.36
KOG0532|consensus 722 99.3
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.26
KOG3207|consensus 505 99.22
KOG3207|consensus 505 99.19
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.15
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.04
KOG1909|consensus 382 99.01
KOG1909|consensus 382 99.0
KOG1644|consensus233 98.98
KOG4579|consensus177 98.9
KOG4579|consensus177 98.89
PLN03150623 hypothetical protein; Provisional 98.88
KOG0531|consensus 414 98.87
KOG0531|consensus 414 98.86
PLN03150623 hypothetical protein; Provisional 98.86
KOG2982|consensus 418 98.8
KOG1859|consensus 1096 98.77
KOG1859|consensus 1096 98.76
KOG4658|consensus 889 98.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.61
KOG1644|consensus233 98.57
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.53
KOG3665|consensus 699 98.45
KOG2120|consensus419 98.43
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
KOG4658|consensus 889 98.33
PRK15386 426 type III secretion protein GogB; Provisional 98.31
KOG3665|consensus 699 98.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.2
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
KOG2120|consensus419 98.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.06
KOG2982|consensus 418 98.05
KOG2123|consensus 388 97.89
KOG2739|consensus260 97.78
PRK15386 426 type III secretion protein GogB; Provisional 97.53
KOG2739|consensus 260 97.22
KOG2123|consensus 388 96.95
KOG4308|consensus 478 96.74
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.47
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.52
smart0037026 LRR Leucine-rich repeats, outliers. 95.52
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.44
smart0037026 LRR Leucine-rich repeats, outliers. 95.44
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.7
KOG4308|consensus 478 94.6
KOG1947|consensus 482 94.49
KOG4341|consensus483 93.89
KOG1947|consensus 482 93.44
KOG0473|consensus 326 93.08
KOG4341|consensus483 92.8
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 92.52
KOG0473|consensus 326 92.29
KOG3864|consensus221 91.42
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.6
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.52
KOG3763|consensus 585 82.92
KOG3864|consensus221 81.98
>KOG0617|consensus Back     alignment and domain information
Probab=99.86  E-value=1.4e-23  Score=137.18  Aligned_cols=172  Identities=28%  Similarity=0.526  Sum_probs=107.0

Q ss_pred             CCCccEEecCCCcceecccccccCCCccEEEcCCCcCCCCCccccCCCCCceEEcCCCccccccCcc-ccCCCCeEeCCC
Q psy3781           5 EAQVEQADLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDF-NFGHLRELNLSS   83 (183)
Q Consensus         5 ~~~l~~l~l~~~~i~~l~~~~~~~~~l~~l~l~~~~l~~l~~~~~~~~~L~~L~l~~n~l~~~~~~~-~~~~L~~L~l~~   83 (183)
                      +..++.|.+++|.++.+|+.+.++.+|+.+++.+|+++++|.+++.+++|+.|.++-|.+..+|.++ .++.|+.||+++
T Consensus        32 ~s~ITrLtLSHNKl~~vppnia~l~nlevln~~nnqie~lp~~issl~klr~lnvgmnrl~~lprgfgs~p~levldlty  111 (264)
T KOG0617|consen   32 MSNITRLTLSHNKLTVVPPNIAELKNLEVLNLSNNQIEELPTSISSLPKLRILNVGMNRLNILPRGFGSFPALEVLDLTY  111 (264)
T ss_pred             hhhhhhhhcccCceeecCCcHHHhhhhhhhhcccchhhhcChhhhhchhhhheecchhhhhcCccccCCCchhhhhhccc
Confidence            4455666666666666666666666666666666666666666666666666666666666666666 666666666666


Q ss_pred             CCCC--CcchhccCCCCCcEEEcCCCccccccCchhhhcCCCccEEeCCCCCCccCChhccccCcccEEeccCCc-----
Q psy3781          84 NKFQ--QIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPYELGLAQQLHHLNLVGNC-----  156 (183)
Q Consensus        84 ~~~~--~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~L~~l~l~~n~-----  156 (183)
                      |++.  .+|..++-+..|+.|++++|.+.-+  |...+.+++|+.+.+..|.+-++|..++.+..|+.|++.+|.     
T Consensus       112 nnl~e~~lpgnff~m~tlralyl~dndfe~l--p~dvg~lt~lqil~lrdndll~lpkeig~lt~lrelhiqgnrl~vlp  189 (264)
T KOG0617|consen  112 NNLNENSLPGNFFYMTTLRALYLGDNDFEIL--PPDVGKLTNLQILSLRDNDLLSLPKEIGDLTRLRELHIQGNRLTVLP  189 (264)
T ss_pred             cccccccCCcchhHHHHHHHHHhcCCCcccC--ChhhhhhcceeEEeeccCchhhCcHHHHHHHHHHHHhcccceeeecC
Confidence            6665  3455555555666666666666555  555666666666666666666666655555555555555554     


Q ss_pred             ---------------------CCCCcHHHhhhChHHHHHHHhh
Q psy3781         157 ---------------------FKYPRQDILQKGTPFLLSYLRD  178 (183)
Q Consensus       157 ---------------------~~~~~~~~~~~~~~~~~~~l~~  178 (183)
                                           +...+.+.|.-+..+.++|++.
T Consensus       190 pel~~l~l~~~k~v~r~E~NPwv~pIaeQf~lG~shV~~yirt  232 (264)
T KOG0617|consen  190 PELANLDLVGNKQVMRMEENPWVNPIAEQFLLGISHVIDYIRT  232 (264)
T ss_pred             hhhhhhhhhhhHHHHhhhhCCCCChHHHHHHhhHHHHHHHHhh
Confidence                                 4444555555566666666654



>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-06
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 1e-05
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 1e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 7e-05
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 4/93 (4%) Query: 6 AQVEQADLSYNRLHVVNSKLFD-ITSIRELDLSHNLIQNLPPDLLN-LRHLVYMNLENNK 63 AQ DL N L + + +FD +TS+ +L L N +Q+LP + N L L Y+NL N+ Sbjct: 28 AQTTYLDLETNSLKSLPNGVFDELTSLTQLYLGGNKLQSLPNGVFNKLTSLTYLNLSTNQ 87 Query: 64 LETI--DIDFNFGHLRELNLSSNKFQQIPKCIF 94 L+++ + L+EL L++N+ Q +P +F Sbjct: 88 LQSLPNGVFDKLTQLKELALNTNQLQSLPDGVF 120
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-22
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-18
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-22
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-21
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-18
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 8e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.87
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.87
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.84
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.83
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.83
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.83
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.82
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.8
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.8
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.8
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.8
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.75
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.73
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.69
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.69
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.68
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.63
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.62
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.6
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.34
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.28
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.24
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.15
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.47
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.21
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.71
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 83.14
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
Probab=99.90  E-value=1.7e-22  Score=145.98  Aligned_cols=165  Identities=22%  Similarity=0.308  Sum_probs=116.3

Q ss_pred             CCCCCCccEEecCCCcceec-ccccccCCCccEEEcCCCc-CCCC-CccccCCCCCceEEcCCCccccccCcc--ccCCC
Q psy3781           2 IAKEAQVEQADLSYNRLHVV-NSKLFDITSIRELDLSHNL-IQNL-PPDLLNLRHLVYMNLENNKLETIDIDF--NFGHL   76 (183)
Q Consensus         2 l~~~~~l~~l~l~~~~i~~l-~~~~~~~~~l~~l~l~~~~-l~~l-~~~~~~~~~L~~L~l~~n~l~~~~~~~--~~~~L   76 (183)
                      |..+++|+.|++++|.+..+ +..+..+++|+.|++++|. ++.+ +..+..+++|++|++++|.++.+++..  .+++|
T Consensus        52 ~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L  131 (285)
T 1ozn_A           52 FRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAAL  131 (285)
T ss_dssp             TTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSCTTCCCCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTC
T ss_pred             cccCCCCCEEECCCCccceeCHhhcCCccCCCEEeCCCCCCccccCHHHhcCCcCCCEEECCCCcCCEECHhHhhCCcCC
Confidence            55677777777777777766 3445567777777777776 6665 445666777777777777777665443  67777


Q ss_pred             CeEeCCCCCCCCcch-hccCCCCCcEEEcCCCccccccCchhhhcCCCccEEeCCCCCCccC-ChhccccCcccEEeccC
Q psy3781          77 RELNLSSNKFQQIPK-CIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKI-PYELGLAQQLHHLNLVG  154 (183)
Q Consensus        77 ~~L~l~~~~~~~~~~-~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~l~~~-~~~~~~~~~L~~l~l~~  154 (183)
                      ++|++++|.++.++. .+..+++|+.|++++|.++++. +..+..+++|+.|++++|.++++ |..+..+++|+.|++++
T Consensus       132 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~-~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~  210 (285)
T 1ozn_A          132 QYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVP-ERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFA  210 (285)
T ss_dssp             CEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCEEC-TTTTTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCS
T ss_pred             CEEECCCCcccccCHhHhccCCCccEEECCCCcccccC-HHHhcCccccCEEECCCCcccccCHhHccCcccccEeeCCC
Confidence            777777777776654 3556777777777777777764 44567777777777777777755 55577777777777777


Q ss_pred             CcCCCCcHHHhhh
Q psy3781         155 NCFKYPRQDILQK  167 (183)
Q Consensus       155 n~~~~~~~~~~~~  167 (183)
                      |.+++.+++.+..
T Consensus       211 n~l~~~~~~~~~~  223 (285)
T 1ozn_A          211 NNLSALPTEALAP  223 (285)
T ss_dssp             SCCSCCCHHHHTT
T ss_pred             CcCCcCCHHHccc
Confidence            7777777665544



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 38/144 (26%), Positives = 58/144 (40%), Gaps = 7/144 (4%)

Query: 12  DLSYNRLHVVNSKLFDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDF 71
           DL+ N++  +   L  +T + EL L  N I N+ P L  L  L  + L  N+LE I    
Sbjct: 247 DLANNQISNLAP-LSGLTKLTELKLGANQISNISP-LAGLTALTNLELNENQLEDISPIS 304

Query: 72  NFGHLRELNLSSNKFQQIPKCIFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSN 131
           N  +L  L L  N    I   +  L  L+ L   NN + +      L  +  +  L   +
Sbjct: 305 NLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSD---VSSLANLTNINWLSAGH 360

Query: 132 NNIRKIPYELGLAQQLHHLNLVGN 155
           N I  +   L    ++  L L   
Sbjct: 361 NQISDLT-PLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.79
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.75
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.75
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.54
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.3
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.27
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.13
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.12
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.58
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.57
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.89
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=5.5e-22  Score=140.32  Aligned_cols=152  Identities=25%  Similarity=0.289  Sum_probs=96.9

Q ss_pred             CccEEecCCCcceeccccc-ccCCCccEEEcCCCcCCCCCccccCCCCCceEEcCCCccccccCcc--------------
Q psy3781           7 QVEQADLSYNRLHVVNSKL-FDITSIRELDLSHNLIQNLPPDLLNLRHLVYMNLENNKLETIDIDF--------------   71 (183)
Q Consensus         7 ~l~~l~l~~~~i~~l~~~~-~~~~~l~~l~l~~~~l~~l~~~~~~~~~L~~L~l~~n~l~~~~~~~--------------   71 (183)
                      ++++|++++|.|+.+++.. .++++|++|++++|+++.++. +..+++|++|++++|.++..+..+              
T Consensus        32 ~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~  110 (266)
T d1p9ag_          32 DTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-DGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFN  110 (266)
T ss_dssp             TCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-CSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSS
T ss_pred             CCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccc
Confidence            4566666666666555432 345566666666665554432 234455555555555554443333              


Q ss_pred             -----------ccCCCCeEeCCCCCCCCcchh-ccCCCCCcEEEcCCCccccccCchhhhcCCCccEEeCCCCCCccCCh
Q psy3781          72 -----------NFGHLRELNLSSNKFQQIPKC-IFHLDNLEILILNNNDIEEINQPEKLVKMQKLTVLDLSNNNIRKIPY  139 (183)
Q Consensus        72 -----------~~~~L~~L~l~~~~~~~~~~~-~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~l~~~~~  139 (183)
                                 .+.+++++++.+|.++.++.. +..++.++.+++++|.++.+. +..++.+++|++|++++|.++.+|+
T Consensus       111 ~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~-~~~~~~l~~L~~L~Ls~N~L~~lp~  189 (266)
T d1p9ag_         111 RLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP-AGLLNGLENLDTLLLQENSLYTIPK  189 (266)
T ss_dssp             CCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCC-TTTTTTCTTCCEEECCSSCCCCCCT
T ss_pred             ccceeeccccccccccccccccccccceeccccccccccchhcccccccccccC-ccccccccccceeecccCCCcccCh
Confidence                       344455555555555555443 334677888888888887775 5667778888888888888888888


Q ss_pred             hccccCcccEEeccCCcCCCC
Q psy3781         140 ELGLAQQLHHLNLVGNCFKYP  160 (183)
Q Consensus       140 ~~~~~~~L~~l~l~~n~~~~~  160 (183)
                      .+..+++|+.|++++|++...
T Consensus       190 ~~~~~~~L~~L~L~~Np~~Cd  210 (266)
T d1p9ag_         190 GFFGSHLLPFAFLHGNPWLCN  210 (266)
T ss_dssp             TTTTTCCCSEEECCSCCBCCS
T ss_pred             hHCCCCCCCEEEecCCCCCCC
Confidence            777788888888888887764



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure