Psyllid ID: psy3785


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MFQSQNSGKMRDSARLVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALIMNDF
cccccccccccccccccccHHHHHccccccHHHHcccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccc
cHHHHHHHHHccccccccccHHHHHHHHccEEEcccccccHHHccHHHHHHHcccEEEccccccccccHHHHHcccccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHccccEEEccccccccccHHHHHHccccEEEccccccccccHHHHHHccccEEEccccccccccc
mfqsqnsgkmrdsARLVSLVGSASASALLYTYEissdtgsgesnmsqsepvlKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVydlphlykfnvsnnMIAKISDNIGNLTSLLVLNIsnnkieslpenigymkslthidashntisyvpwklFSKFHQnrssrfgcaLIMNDF
mfqsqnsgkmrdsARLVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALIMNDF
MFQSQNSGKMRDsarlvslvgsasasallYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHltnlnelalnnnqlEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALIMNDF
*******************V****ASALLYTYE*****************VLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALI****
MFQSQNSGKMRDSARLVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALIMN**
*************ARLVSLVGSASASALLYTYEISS************EPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALIMNDF
MFQSQNSGKMRDSARLVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQSQNSGKMRDSARLVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFGCALIMNDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q5M8G4 605 Leucine-rich repeat-conta yes N/A 0.570 0.173 0.420 5e-17
Q6GPJ5 605 Leucine-rich repeat-conta N/A N/A 0.456 0.138 0.401 2e-16
Q9H9A6 602 Leucine-rich repeat-conta yes N/A 0.586 0.179 0.390 7e-14
A8JAM0 1159 Coiled-coil domain-contai N/A N/A 0.456 0.072 0.383 1e-13
Q4R3P6 602 Leucine-rich repeat-conta N/A N/A 0.472 0.144 0.381 1e-13
Q5RFE9 602 Leucine-rich repeat-conta yes N/A 0.472 0.144 0.381 1e-13
B0W6M9 628 Leucine-rich repeat prote N/A N/A 0.570 0.167 0.392 4e-13
Q6UWE0 723 E3 ubiquitin-protein liga no N/A 0.565 0.143 0.345 1e-12
Q54AX5510 Leucine-rich repeat prote yes N/A 0.521 0.188 0.371 3e-12
Q80VQ1 524 Leucine-rich repeat-conta yes N/A 0.576 0.202 0.373 4e-12
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function desciption
 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%)

Query: 54  LKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKI 113
           L+ LN+ +N +K LP E++HL NL  L L +NQLE + +++  L  L + +VSNN +  I
Sbjct: 130 LQKLNISHNKIKQLPKELQHLQNLKSLLLQHNQLEELPDSIGHLSILEELDVSNNCLRSI 189

Query: 114 SDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVP 160
           S ++G LT L+  N+S+NK+ +LP  IG MK+L  +D + N +  VP
Sbjct: 190 SSSVGQLTGLVKFNLSSNKLTALPTEIGKMKNLKQLDCTSNLLENVP 236





Xenopus tropicalis (taxid: 8364)
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function description
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 Back     alignment and function description
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
443689982 481 hypothetical protein CAPTEDRAFT_174612, 0.663 0.253 0.408 1e-16
58332470 605 leucine-rich repeat-containing protein 4 0.570 0.173 0.420 2e-15
421097204 671 leucine rich repeat protein [Leptospira 0.597 0.163 0.418 7e-15
124010200 356 leucine-rich repeat containing protein [ 0.586 0.303 0.425 8e-15
148230653 605 leucine-rich repeat-containing protein 4 0.456 0.138 0.401 1e-14
281207071208 leucine-rich repeat-containing protein [ 0.586 0.519 0.412 1e-13
443724553 616 hypothetical protein CAPTEDRAFT_214841 [ 0.646 0.193 0.379 1e-13
186686533 1124 hypothetical protein Npun_R6524 [Nostoc 0.586 0.096 0.379 1e-13
209156068 447 Leucine-rich repeat-containing protein 4 0.576 0.237 0.420 2e-13
197632025 600 leucine rich repeat containing 40 [Salmo 0.576 0.176 0.420 2e-13
>gi|443689982|gb|ELT92244.1| hypothetical protein CAPTEDRAFT_174612, partial [Capitella teleta] Back     alignment and taxonomy information
 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 79/125 (63%), Gaps = 3/125 (2%)

Query: 53  KLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAK 112
           +LKV+N+  N +K LPD +  L+ L E+ L+ NQLE +  +   L  L +  +S+N++A 
Sbjct: 104 QLKVMNIVGNRVKSLPDSVSELSALEEIYLDENQLEGLPSSFVQLTCLQRLEISDNILAH 163

Query: 113 ISDNIGNLTSLLVLNISNNKIE-SLPENIGYMKSLTHIDASHNTISYVPWKLFSKFHQNR 171
           +  +IGNL+ L VLN+S NK+E SLPE+ G + S+  ID SHN +S +P K   +F+Q+ 
Sbjct: 164 LPKDIGNLSKLRVLNVSGNKLEGSLPESFGDISSVCEIDLSHNQLSELPPK--CRFNQSL 221

Query: 172 SSRFG 176
              F 
Sbjct: 222 VKLFA 226




Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota

>gi|58332470|ref|NP_001011310.1| leucine-rich repeat-containing protein 40 [Xenopus (Silurana) tropicalis] gi|82232111|sp|Q5M8G4.1|LRC40_XENTR RecName: Full=Leucine-rich repeat-containing protein 40 gi|56789102|gb|AAH88034.1| hypothetical LOC496765 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|421097204|ref|ZP_15557898.1| leucine rich repeat protein [Leptospira borgpetersenii str. 200901122] gi|410799695|gb|EKS01761.1| leucine rich repeat protein [Leptospira borgpetersenii str. 200901122] Back     alignment and taxonomy information
>gi|124010200|ref|ZP_01694856.1| leucine-rich repeat containing protein [Microscilla marina ATCC 23134] gi|123983744|gb|EAY24171.1| leucine-rich repeat containing protein [Microscilla marina ATCC 23134] Back     alignment and taxonomy information
>gi|148230653|ref|NP_001085672.1| leucine-rich repeat-containing protein 40 [Xenopus laevis] gi|82236544|sp|Q6GPJ5.1|LRC40_XENLA RecName: Full=Leucine-rich repeat-containing protein 40 gi|49257387|gb|AAH73124.1| MGC84527 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|281207071|gb|EFA81255.1| leucine-rich repeat-containing protein [Polysphondylium pallidum PN500] Back     alignment and taxonomy information
>gi|443724553|gb|ELU12513.1| hypothetical protein CAPTEDRAFT_214841 [Capitella teleta] Back     alignment and taxonomy information
>gi|186686533|ref|YP_001869729.1| hypothetical protein Npun_R6524 [Nostoc punctiforme PCC 73102] gi|186468985|gb|ACC84786.1| leucine-rich repeat protein [Nostoc punctiforme PCC 73102] Back     alignment and taxonomy information
>gi|209156068|gb|ACI34266.1| Leucine-rich repeat-containing protein 40 [Salmo salar] Back     alignment and taxonomy information
>gi|197632025|gb|ACH70736.1| leucine rich repeat containing 40 [Salmo salar] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
DICTYBASE|DDB_G0294094510 lrrA "leucine-rich repeat-cont 0.635 0.229 0.316 1.2e-10
TAIR|locus:2142773262 AT5G07910 "AT5G07910" [Arabido 0.364 0.255 0.402 8e-10
RGD|1308146 582 Shoc2 "soc-2 (suppressor of cl 0.586 0.185 0.268 8.3e-10
MGI|MGI:1920564 347 Lrrc69 "leucine rich repeat co 0.668 0.354 0.282 8.6e-10
TAIR|locus:2088807 471 PIRL2 "AT3G26500" [Arabidopsis 0.711 0.278 0.282 9.7e-10
UNIPROTKB|A8JAM0 1159 FAP50 "Coiled-coil domain-cont 0.581 0.092 0.289 1.3e-09
MGI|MGI:1927197 582 Shoc2 "soc-2 (suppressor of cl 0.586 0.185 0.259 1.4e-09
DICTYBASE|DDB_G0278509 1248 DDB_G0278509 "MLK family prote 0.586 0.086 0.311 1.4e-09
MGI|MGI:1914394 602 Lrrc40 "leucine rich repeat co 0.581 0.177 0.336 2.4e-09
UNIPROTKB|F1NRN7 529 SHOC2 "Leucine-rich repeat pro 0.586 0.204 0.259 2.5e-09
DICTYBASE|DDB_G0294094 lrrA "leucine-rich repeat-containing protein (LRR)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 1.2e-10, P = 1.2e-10
 Identities = 37/117 (31%), Positives = 58/117 (49%)

Query:    46 SQSEPVLKLKVLNLQYNNLKGLPDEIRHXXXXXXXXXXXXXXEMINEAVYDLPHLYKFNV 105
             S+   ++ LK L L  N L  LP EI                + I   + +L  L K N+
Sbjct:   335 SEIGKLVNLKKLLLSNNLLIALPPEIASMKALKEFEASNNQLQAIPTEIGELSGLTKINL 394

Query:   106 SNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWK 162
             S N +  I  + GNL+ L + ++ +N+I  LP  +  +KS T ID SHN ++ +PW+
Sbjct:   395 SGNKLTSIPASFGNLSELQICDLKSNEIAELPTTLDGLKSCTKIDLSHNMLTELPWE 451


GO:0045335 "phagocytic vesicle" evidence=IDA
GO:0043327 "chemotaxis to cAMP" evidence=IMP
GO:0043326 "chemotaxis to folate" evidence=IMP
GO:0031589 "cell-substrate adhesion" evidence=IMP
GO:0031154 "culmination involved in sorocarp development" evidence=IMP
GO:0031152 "aggregation involved in sorocarp development" evidence=IMP
GO:0030833 "regulation of actin filament polymerization" evidence=IMP
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0007163 "establishment or maintenance of cell polarity" evidence=IMP
GO:0005737 "cytoplasm" evidence=IEA;IDA
GO:0044351 "macropinocytosis" evidence=RCA
TAIR|locus:2142773 AT5G07910 "AT5G07910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1308146 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1920564 Lrrc69 "leucine rich repeat containing 69" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8JAM0 FAP50 "Coiled-coil domain-containing protein lobo homolog" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278509 DDB_G0278509 "MLK family protein kinase DDB_G0278509" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1914394 Lrrc40 "leucine rich repeat containing 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRN7 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-12
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 63.1 bits (153), Expect = 5e-12
 Identities = 41/108 (37%), Positives = 68/108 (62%)

Query: 53  KLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAK 112
            LK L+L +N+L  LP  + +L+NLN L L+ N++  +   +  L  L + ++SNN I +
Sbjct: 164 NLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIE 223

Query: 113 ISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVP 160
           +  ++ NL +L  L +SNNK+E LPE+IG + +L  +D S+N IS + 
Sbjct: 224 LLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSIS 271


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG0617|consensus264 99.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.7
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.69
KOG0617|consensus264 99.64
KOG4194|consensus 873 99.62
KOG0444|consensus 1255 99.62
KOG0444|consensus 1255 99.6
KOG4194|consensus 873 99.54
KOG0472|consensus 565 99.51
KOG0472|consensus565 99.45
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.35
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.35
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.32
KOG0618|consensus 1081 99.29
KOG0618|consensus 1081 99.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.28
KOG4237|consensus 498 99.23
KOG0532|consensus 722 99.23
KOG1259|consensus490 99.22
KOG0532|consensus 722 99.2
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.18
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.13
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.11
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.11
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
PLN03150623 hypothetical protein; Provisional 98.99
PLN03150623 hypothetical protein; Provisional 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG1259|consensus490 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG4579|consensus177 98.8
KOG1909|consensus382 98.79
KOG3207|consensus 505 98.75
KOG4237|consensus 498 98.7
KOG1859|consensus 1096 98.69
KOG3207|consensus 505 98.65
KOG4579|consensus177 98.62
KOG1859|consensus 1096 98.59
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.43
KOG0531|consensus 414 98.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.37
KOG3665|consensus 699 98.28
KOG1644|consensus233 98.27
KOG4658|consensus 889 98.23
KOG4658|consensus 889 98.23
KOG1909|consensus382 98.22
KOG0531|consensus 414 98.21
KOG1644|consensus233 98.19
KOG2982|consensus 418 98.19
KOG3665|consensus 699 98.03
KOG2120|consensus419 97.91
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.89
PRK15386 426 type III secretion protein GogB; Provisional 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.73
KOG2739|consensus260 97.71
KOG2120|consensus419 97.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.4
KOG2982|consensus 418 97.35
KOG2739|consensus 260 97.33
KOG2123|consensus 388 97.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.69
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.58
KOG2123|consensus 388 96.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.99
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.61
smart0037026 LRR Leucine-rich repeats, outliers. 95.56
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.56
KOG0473|consensus 326 94.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.37
smart0037026 LRR Leucine-rich repeats, outliers. 94.37
KOG0473|consensus 326 93.5
KOG4308|consensus 478 92.07
KOG4308|consensus 478 91.64
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.67
KOG1947|consensus 482 87.57
KOG1947|consensus 482 85.39
KOG3864|consensus221 82.86
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.23
KOG3864|consensus221 81.1
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.42
>KOG0617|consensus Back     alignment and domain information
Probab=99.75  E-value=1.4e-20  Score=129.81  Aligned_cols=150  Identities=22%  Similarity=0.351  Sum_probs=135.9

Q ss_pred             ccccccccCCCcCccccEEEeecCCCCCCCCcccccCCCCccEEEecCCccccCchhhhCCCCCCEEEcccCccc--cch
Q psy3785          14 ARLVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLE--MIN   91 (184)
Q Consensus        14 ~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~lp~~~~~l~~L~~L~l~~n~l~--~~~   91 (184)
                      +.+..+++.++.+.+|+.|++.+|++.  .+|.++.++++|+.|.+.-|++..+|.+|+.++.|+.|++++|++.  .+|
T Consensus        43 NKl~~vppnia~l~nlevln~~nnqie--~lp~~issl~klr~lnvgmnrl~~lprgfgs~p~levldltynnl~e~~lp  120 (264)
T KOG0617|consen   43 NKLTVVPPNIAELKNLEVLNLSNNQIE--ELPTSISSLPKLRILNVGMNRLNILPRGFGSFPALEVLDLTYNNLNENSLP  120 (264)
T ss_pred             CceeecCCcHHHhhhhhhhhcccchhh--hcChhhhhchhhhheecchhhhhcCccccCCCchhhhhhccccccccccCC
Confidence            344557788888999999999999887  7899999999999999999999999999999999999999999988  688


Q ss_pred             hhhcCCCCceEEEccccccccchhhhcCCCCCCEEEccCCCCCCcchhhhcCCCCCEEeccCCCCCCCcHHHhh
Q psy3785          92 EAVYDLPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISYVPWKLFS  165 (184)
Q Consensus        92 ~~~~~l~~l~~L~l~~n~~~~~~~~~~~~~~L~~l~l~~n~l~~l~~~~~~~~~L~~l~L~~n~l~~~~~~~~~  165 (184)
                      ..|+.|..|+.|.+++|.+..+|+..+.+.+|+.+.+.+|.+-++|.+++.++.|+.+.+.+|.++.+|.++..
T Consensus       121 gnff~m~tlralyl~dndfe~lp~dvg~lt~lqil~lrdndll~lpkeig~lt~lrelhiqgnrl~vlppel~~  194 (264)
T KOG0617|consen  121 GNFFYMTTLRALYLGDNDFEILPPDVGKLTNLQILSLRDNDLLSLPKEIGDLTRLRELHIQGNRLTVLPPELAN  194 (264)
T ss_pred             cchhHHHHHHHHHhcCCCcccCChhhhhhcceeEEeeccCchhhCcHHHHHHHHHHHHhcccceeeecChhhhh
Confidence            88889999999999999999999999999999999999999999999999999999999999999999987664



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-04
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 50/88 (56%), Gaps = 3/88 (3%) Query: 90 INEAVYDLPHLYKFNVSNNMI-AKISDNIGNLTSLLVLNISNNKIES-LPENIGYMKSLT 147 I + + +P+L+ N+ +N I I D +G+L L +L++S+NK++ +P+ + + LT Sbjct: 645 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 704 Query: 148 HIDASHNTISYVPWKLFSKFHQNRSSRF 175 ID S+N +S P +F ++F Sbjct: 705 EIDLSNNNLSG-PIPEMGQFETFPPAKF 731
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-22
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-18
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-18
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-14
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-15
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-15
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-15
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-17
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-12
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.76
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.76
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.75
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.74
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.74
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.73
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.73
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.72
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.72
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.72
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.72
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.72
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.72
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.72
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.72
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.71
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.7
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.7
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.69
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.67
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.67
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.65
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.64
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.64
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.64
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.59
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.59
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.58
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.55
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.42
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.33
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.2
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.17
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.96
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.93
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.77
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.74
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.47
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.22
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.76
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.85  E-value=7.1e-21  Score=146.66  Aligned_cols=141  Identities=23%  Similarity=0.230  Sum_probs=82.3

Q ss_pred             ccccccCCCcCccccEEEeecCCCCCCCCcccccCCCCccEEEecCCccccCchhhhCCCCCCEEEcccCccc-cchhhh
Q psy3785          16 LVSLVGSASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLE-MINEAV   94 (184)
Q Consensus        16 ~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~lp~~~~~l~~L~~L~l~~n~l~-~~~~~~   94 (184)
                      +..++..+..++.|+.|++++|.+.  .+|..+..+++|++|++++|.++.+|..+..+++|++|++++|++. .+|..+
T Consensus        93 l~~lp~~l~~l~~L~~L~L~~n~l~--~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~  170 (328)
T 4fcg_A           93 LPQFPDQAFRLSHLQHMTIDAAGLM--ELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPL  170 (328)
T ss_dssp             CSSCCSCGGGGTTCSEEEEESSCCC--CCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCS
T ss_pred             chhcChhhhhCCCCCEEECCCCCcc--chhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECCCCCCccccChhH
Confidence            3455555666667777777766665  5566666666677777777766666666666666666666665432 444433


Q ss_pred             cC---------CCCceEEEccccccccchhhhcCCCCCCEEEccCCCCCCcchhhhcCCCCCEEeccCCCCCC
Q psy3785          95 YD---------LPHLYKFNVSNNMIAKISDNIGNLTSLLVLNISNNKIESLPENIGYMKSLTHIDASHNTISY  158 (184)
Q Consensus        95 ~~---------l~~l~~L~l~~n~~~~~~~~~~~~~~L~~l~l~~n~l~~l~~~~~~~~~L~~l~L~~n~l~~  158 (184)
                      ..         +++|++|++++|.++.+|..++.++.|+.+++++|.++.+|..++.+++|+.+++++|.+.+
T Consensus       171 ~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~  243 (328)
T 4fcg_A          171 ASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALR  243 (328)
T ss_dssp             EEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCC
T ss_pred             hhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchh
Confidence            22         55555555555555555555555555555555555555555445555555555555554444



>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2 227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 52.8 bits (126), Expect = 5e-10
 Identities = 21/108 (19%), Positives = 45/108 (41%), Gaps = 4/108 (3%)

Query: 55  KVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMINEAVYDLPHLYKFNVSNNMIAKIS 114
           +VL+L + +L  L   +  L  +  L L++N+L  +  A+  L  L     S+N +  + 
Sbjct: 1   RVLHLAHKDLTVLC-HLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVD 59

Query: 115 DNIGNLTSLLVLNISNNKIESLP--ENIGYMKSLTHIDASHNTISYVP 160
                   L  L + NN+++     + +     L  ++   N++    
Sbjct: 60  GVANL-PRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEE 106


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.56
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.31
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.99
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.94
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.93
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.91
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.91
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.72
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.68
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.75
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=1.7e-18  Score=127.88  Aligned_cols=150  Identities=19%  Similarity=0.219  Sum_probs=95.7

Q ss_pred             CCcCccccEEEeecCCCCCCCCcccccCCCCccEEEecCCccccCchhhhCCCCCCEEEcccCccccch-hhhcCCCCce
Q psy3785          23 ASASALLYTYEISSDTGSGESNMSQSEPVLKLKVLNLQYNNLKGLPDEIRHLTNLNELALNNNQLEMIN-EAVYDLPHLY  101 (184)
Q Consensus        23 ~~~~~~l~~l~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~lp~~~~~l~~L~~L~l~~n~l~~~~-~~~~~l~~l~  101 (184)
                      +..+++|+.|++++|.+.  .++ .++.+++|+.|++++|+++..+..+..+++|+.|+++++.+..++ ..+..+.+++
T Consensus        51 f~~l~~L~~L~L~~N~l~--~l~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~  127 (266)
T d1p9ag_          51 LMPYTRLTQLNLDRAELT--KLQ-VDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQ  127 (266)
T ss_dssp             GTTCTTCCEEECTTSCCC--EEE-CCSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCC
T ss_pred             hhcccccccccccccccc--ccc-cccccccccccccccccccccccccccccccccccccccccceeeccccccccccc
Confidence            445555555555555543  222 223455555555555555555555555555666666655555443 3333556666


Q ss_pred             EEEccccccccch-hhhcCCCCCCEEEccCCCCCCcchh-hhcCCCCCEEeccCCCCCCCcHHHhhhhhcccccccc
Q psy3785         102 KFNVSNNMIAKIS-DNIGNLTSLLVLNISNNKIESLPEN-IGYMKSLTHIDASHNTISYVPWKLFSKFHQNRSSRFG  176 (184)
Q Consensus       102 ~L~l~~n~~~~~~-~~~~~~~~L~~l~l~~n~l~~l~~~-~~~~~~L~~l~L~~n~l~~~~~~~~~~~~~l~~~~~~  176 (184)
                      .+.+++|.++.++ ..+..++.++.+++++|.++.++.. +..+++|+.++|++|.|+.+|..++. ...++.+.++
T Consensus       128 ~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~-~~~L~~L~L~  203 (266)
T d1p9ag_         128 ELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFG-SHLLPFAFLH  203 (266)
T ss_dssp             EEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTT-TCCCSEEECC
T ss_pred             cccccccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcccChhHCC-CCCCCEEEec
Confidence            6666666666664 3456778889999999999877644 67788999999999999999887664 5666666665



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure