Psyllid ID: psy37
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| 260790933 | 1038 | hypothetical protein BRAFLDRAFT_86166 [B | 0.964 | 0.259 | 0.487 | 3e-79 | |
| 384490525 | 1343 | hypothetical protein RO3G_06452 [Rhizopu | 0.903 | 0.187 | 0.475 | 5e-60 | |
| 390357122 | 1677 | PREDICTED: LOW QUALITY PROTEIN: kinesin- | 0.964 | 0.160 | 0.422 | 3e-59 | |
| 453231792 | 1628 | Protein UNC-104, isoform b [Caenorhabdit | 0.949 | 0.162 | 0.424 | 5e-59 | |
| 54042065 | 1584 | RecName: Full=Kinesin-like protein unc-1 | 0.949 | 0.167 | 0.424 | 5e-59 | |
| 7511463 | 1584 | kinesin-like protein unc-104 - Caenorhab | 0.949 | 0.167 | 0.424 | 5e-59 | |
| 453231794 | 1584 | Protein UNC-104, isoform a [Caenorhabdit | 0.949 | 0.167 | 0.424 | 5e-59 | |
| 156478 | 1584 | kinesin-related protein [Caenorhabditis | 0.949 | 0.167 | 0.424 | 6e-59 | |
| 270015064 | 1824 | hypothetical protein TcasGA2_TC014226 [T | 0.956 | 0.146 | 0.428 | 2e-58 | |
| 301620478 | 1890 | PREDICTED: kinesin-like protein KIF1B [X | 0.978 | 0.144 | 0.414 | 2e-58 |
| >gi|260790933|ref|XP_002590495.1| hypothetical protein BRAFLDRAFT_86166 [Branchiostoma floridae] gi|229275689|gb|EEN46506.1| hypothetical protein BRAFLDRAFT_86166 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Score = 301 bits (770), Expect = 3e-79, Method: Composition-based stats.
Identities = 162/332 (48%), Positives = 204/332 (61%), Gaps = 63/332 (18%)
Query: 11 KDFTFDHSYWSF-DPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGKTFTM 69
K F FD+SYWS + P FA Q +V+ D+G +++ AFEGYN C+FAYGQTG+GK++TM
Sbjct: 16 KAFNFDYSYWSHTNEQDPNFAGQSKVYQDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTM 75
Query: 70 MGS-------------------------------------KATTDNSPDAHKD---FTFD 89
MG K T P KD F FD
Sbjct: 76 MGKPEPRDQQGIIPQVAVRVRPFNNREIGRQAKCVISMKDKTTAIQHPKQSKDVKAFNFD 135
Query: 90 HSYWSF-DPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGKTFTMMGSKAR 148
+SYWS + P FA Q +V+ D+G +++ AFEGYN C+FAYGQTG+GK++TMMG
Sbjct: 136 YSYWSHTNEQDPNFAGQSKVYQDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKPEP 195
Query: 149 NFGEG---KDCVCSIVE------------AGDRLKEGAHINKSLVTLGSVISSLAELST- 192
+G + S+V+ GDRLKEGA+INKSL TLG VI +LAE S
Sbjct: 196 RDQQGIIPQVAKISLVDLAGSERANATGAKGDRLKEGANINKSLTTLGKVIHALAESSQS 255
Query: 193 -----KKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKN 247
KKS FIPYRDSVLTWLL+++LGGNSKT MIAA+SPAD+NY ETLSTLRYA+RAK
Sbjct: 256 GSKKRKKSDFIPYRDSVLTWLLRENLGGNSKTAMIAALSPADINYEETLSTLRYADRAKQ 315
Query: 248 IINKPTVNEDPNTRIIRELHDEITKLKAMLTS 279
I+ K VNEDPN R+IREL +E+ +LK +L S
Sbjct: 316 IVCKAVVNEDPNARLIRELKEEVMRLKELLKS 347
|
Source: Branchiostoma floridae Species: Branchiostoma floridae Genus: Branchiostoma Family: Branchiostomidae Order: Class: Phylum: Chordata Superkingdom: Eukaryota |
| >gi|384490525|gb|EIE81747.1| hypothetical protein RO3G_06452 [Rhizopus delemar RA 99-880] | Back alignment and taxonomy information |
|---|
| >gi|390357122|ref|XP_003728932.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein KIF1B-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|453231792|ref|NP_001022041.2| Protein UNC-104, isoform b [Caenorhabditis elegans] gi|412979512|emb|CCD64623.2| Protein UNC-104, isoform b [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|54042065|sp|P23678.3|UN104_CAEEL RecName: Full=Kinesin-like protein unc-104; AltName: Full=Uncoordinated protein 104 | Back alignment and taxonomy information |
|---|
| >gi|7511463|pir||T15822 kinesin-like protein unc-104 - Caenorhabditis elegans | Back alignment and taxonomy information |
|---|
| >gi|453231794|ref|NP_741019.3| Protein UNC-104, isoform a [Caenorhabditis elegans] gi|412979511|emb|CCD64622.2| Protein UNC-104, isoform a [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|156478|gb|AAA03517.1| kinesin-related protein [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|270015064|gb|EFA11512.1| hypothetical protein TcasGA2_TC014226 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|301620478|ref|XP_002939603.1| PREDICTED: kinesin-like protein KIF1B [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| UNIPROTKB|I3LEQ5 | 412 | I3LEQ5 "Uncharacterized protei | 0.408 | 0.276 | 0.745 | 1.4e-64 | |
| UNIPROTKB|F1NUI7 | 1306 | KIF16B "Uncharacterized protei | 0.408 | 0.087 | 0.762 | 1.6e-64 | |
| ZFIN|ZDB-GENE-090313-233 | 1318 | kif16ba "kinesin family member | 0.408 | 0.086 | 0.762 | 1.7e-62 | |
| MGI|MGI:1098240 | 1312 | Kif16b "kinesin family member | 0.408 | 0.086 | 0.745 | 3.9e-62 | |
| UNIPROTKB|Q96L93 | 1317 | KIF16B "Kinesin-like protein K | 0.408 | 0.086 | 0.745 | 3.9e-62 | |
| UNIPROTKB|F1PJY0 | 1313 | KIF16B "Uncharacterized protei | 0.408 | 0.086 | 0.745 | 4.9e-62 | |
| UNIPROTKB|F1PJW5 | 1317 | KIF16B "Uncharacterized protei | 0.408 | 0.086 | 0.745 | 5e-62 | |
| UNIPROTKB|G3X690 | 1388 | KIF16B "Uncharacterized protei | 0.408 | 0.082 | 0.745 | 6e-62 | |
| UNIPROTKB|F1SBI9 | 1318 | KIF16B "Uncharacterized protei | 0.408 | 0.086 | 0.745 | 6.4e-62 | |
| UNIPROTKB|I3LQ03 | 1329 | KIF16B "Uncharacterized protei | 0.408 | 0.085 | 0.745 | 6.6e-62 |
| UNIPROTKB|I3LEQ5 I3LEQ5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 439 (159.6 bits), Expect = 1.4e-64, Sum P(2) = 1.4e-64
Identities = 91/122 (74%), Positives = 101/122 (82%)
Query: 164 GDRLKEGAHINKSLVTLGSVISSLAELST--------KKSTFIPYRDSVLTWLLKDSLGG 215
G RLKEG +INKSLVTLG+VIS+LA+LS KK F+PYRDSVLTWLLKDSLGG
Sbjct: 239 GVRLKEGGNINKSLVTLGNVISALADLSQDAANPLVKKKQVFVPYRDSVLTWLLKDSLGG 298
Query: 216 NSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRIIRELHDEITKLKA 275
NSKTIMIA ISPADVNY ETLSTLRYANRAKNIINKPT+NED N ++IREL EI +LK
Sbjct: 299 NSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDANVKLIRELRAEIARLKM 358
Query: 276 ML 277
+L
Sbjct: 359 LL 360
|
|
| UNIPROTKB|F1NUI7 KIF16B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-233 kif16ba "kinesin family member 16Ba" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098240 Kif16b "kinesin family member 16B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96L93 KIF16B "Kinesin-like protein KIF16B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJY0 KIF16B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJW5 KIF16B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X690 KIF16B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBI9 KIF16B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LQ03 KIF16B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 3e-56 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 6e-49 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 4e-48 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 4e-47 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 1e-42 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 5e-42 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 3e-41 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-40 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 7e-38 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 4e-35 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 9e-35 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 7e-34 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 6e-33 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-32 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 8e-32 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 1e-30 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 3e-30 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 4e-26 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 6e-26 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 1e-24 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 1e-24 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 3e-24 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 4e-23 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 1e-22 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 5e-20 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 5e-20 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 2e-19 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 2e-19 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 2e-18 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 3e-18 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 6e-18 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 1e-17 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 7e-17 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-16 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-16 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 1e-16 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 1e-16 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 3e-16 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 8e-16 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 8e-16 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 3e-15 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 1e-14 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 1e-14 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 3e-14 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 1e-13 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 2e-13 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 2e-11 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 2e-11 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 5e-10 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 7e-10 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 3e-09 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 3e-09 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 4e-08 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 4e-08 |
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
Score = 184 bits (469), Expect = 3e-56
Identities = 71/96 (73%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
Query: 164 GDRLKEGAHINKSLVTLGSVISSLAELST----KKSTFIPYRDSVLTWLLKDSLGGNSKT 219
GDRLKEG++INKSL TLG VIS+LA+ S+ KKS+FIPYRDSVLTWLLK++LGGNSKT
Sbjct: 261 GDRLKEGSNINKSLTTLGKVISALADNSSAKSKKKSSFIPYRDSVLTWLLKENLGGNSKT 320
Query: 220 IMIAAISPADVNYSETLSTLRYANRAKNIINKPTVN 255
MIA ISPAD+NY ETLSTLRYA+RAK I+N VN
Sbjct: 321 AMIATISPADINYEETLSTLRYADRAKKIVNVAVVN 356
|
KIF1A (Unc104) transports synaptic vesicles to the nerve terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively. Length = 356 |
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0243|consensus | 1041 | 100.0 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| KOG0241|consensus | 1714 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| KOG0240|consensus | 607 | 100.0 | ||
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| KOG0244|consensus | 913 | 100.0 | ||
| KOG0246|consensus | 676 | 100.0 | ||
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0247|consensus | 809 | 100.0 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 100.0 | |
| KOG0245|consensus | 1221 | 97.93 | ||
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.78 | |
| KOG4280|consensus | 574 | 95.58 | ||
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.35 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.3 | |
| KOG0241|consensus | 1714 | 95.12 | ||
| PRK06620 | 214 | hypothetical protein; Validated | 94.97 | |
| PRK12377 | 248 | putative replication protein; Provisional | 94.57 | |
| PRK09087 | 226 | hypothetical protein; Validated | 94.43 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.16 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 94.12 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 94.04 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 94.03 | |
| PRK08116 | 268 | hypothetical protein; Validated | 93.99 | |
| PRK06526 | 254 | transposase; Provisional | 93.75 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 93.68 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 93.53 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 93.5 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 93.42 | |
| PRK08181 | 269 | transposase; Validated | 92.98 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 92.87 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 92.71 | |
| PRK08727 | 233 | hypothetical protein; Validated | 92.49 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 92.38 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 92.37 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 92.29 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 92.26 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 92.18 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 92.13 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 92.02 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 91.91 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 91.83 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 91.81 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 91.58 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 91.55 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 91.42 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 91.2 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 91.08 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 90.89 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 90.78 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 90.47 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 90.11 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 89.99 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 89.99 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 89.73 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 89.71 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 89.66 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 89.46 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 89.21 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 89.14 | |
| KOG0989|consensus | 346 | 89.12 | ||
| KOG0243|consensus | 1041 | 89.1 | ||
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 89.05 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 89.04 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 89.03 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 88.94 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 88.86 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 88.54 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 88.53 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 88.48 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 88.28 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 88.08 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 87.94 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 87.75 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 87.63 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 87.49 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 87.18 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 87.03 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 86.78 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 86.65 | |
| KOG0242|consensus | 675 | 86.28 | ||
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 86.22 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 86.2 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 86.02 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 85.98 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 85.61 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 85.48 | |
| PF13479 | 213 | AAA_24: AAA domain | 85.43 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 85.35 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 85.29 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 85.25 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 84.81 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 84.78 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 84.71 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 84.68 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 84.43 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 84.18 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 84.18 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 84.15 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 84.09 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 84.02 | |
| KOG0239|consensus | 670 | 83.88 | ||
| PRK06547 | 172 | hypothetical protein; Provisional | 83.59 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 83.43 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 83.14 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 83.05 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 83.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 82.87 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 82.44 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 82.38 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 82.25 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 82.06 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 81.97 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 81.85 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 81.74 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 81.63 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 81.5 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 81.43 | |
| KOG1803|consensus | 649 | 81.38 | ||
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 81.37 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 81.24 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 81.13 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 81.08 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 80.68 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 80.63 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 80.49 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 80.46 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 80.23 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 80.13 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 80.13 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 80.12 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 80.07 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 80.05 |
| >KOG0245|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-65 Score=475.34 Aligned_cols=262 Identities=52% Similarity=0.795 Sum_probs=228.0
Q ss_pred CCCCCCCcceeeeccceeecCCCCCCCCCHHHHHHHhHHHHHHHhccccCeeEeeccCcCCCceeEecCCC--CCCCCCC
Q psy37 3 TDNSPDAHKDFTFDHSYWSFDPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGKTFTMMGSK--ATTDNSP 80 (279)
Q Consensus 3 ~~~~~~~~~~~~fd~~~f~fd~vf~~~~~q~~vy~~~~~~lv~~v~~G~n~~v~~yG~tgSGKT~Tl~G~~--~~~G~~~ 80 (279)
.|.+++...+|+||++||+||..=+--++|.+||+.++.|+++.+++|||+||||||||||||||||+|-+ +++||||
T Consensus 39 ~~~~~k~~~~FtfD~SYWS~d~edPhfAsQ~qVYedlg~~mL~~AfEGYN~ClFAYGQTGSGKSYTMMG~~~~~e~GIIP 118 (1221)
T KOG0245|consen 39 NPKGSKDAPKFTFDYSYWSHDSEDPHFASQKQVYEDLGREMLDHAFEGYNVCLFAYGQTGSGKSYTMMGFQEPDEPGIIP 118 (1221)
T ss_pred cCCCcccCCceecceeeecCCCCCCchhhHHHHHHHHhHHHHHHHhcccceEEEEeccCCCCcceeeeccCCCCCCCchh
Confidence 46677888889999999999998888899999999999999999999999999999999999999999987 8899999
Q ss_pred CccccceecccccccCCCCcccccHHHHHhhhchhhHhhhhhccceeeeeccc-cCCCceEEEe----------------
Q psy37 81 DAHKDFTFDHSYWSFDPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQ-TGSGKTFTMM---------------- 143 (279)
Q Consensus 81 ~~~~~l~f~~~~~~~~~~~~~~~s~~ei~~~~~~~l~~s~~e~~~~~v~dl~~-~~~~~~~~~~---------------- 143 (279)
+.+.+| |..+....... .. +.+-+|++|||+|.|.|||+ +.+.....++
T Consensus 119 rlCEeL-F~ri~~nq~~~---~s----------y~VevSymEIYcErVrDLL~~p~~kg~LRVREHP~lGPYVedLS~~a 184 (1221)
T KOG0245|consen 119 RLCEEL-FSRIADNQSQQ---MS----------YSVEVSYMEIYCERVRDLLNAPKSKGGLRVREHPILGPYVEDLSKLA 184 (1221)
T ss_pred HHHHHH-HHHHhhccccc---ce----------EEEEEeehhHHHHHHHHHhhCCCCCCCceeeccCccChhHhHhhhcc
Confidence 999999 98876433322 22 45555899999999999987 4444333333
Q ss_pred -------------ccccc-------------------------------------------cccCccccchhhhhhhhhh
Q psy37 144 -------------GSKAR-------------------------------------------NFGEGKDCVCSIVEAGDRL 167 (279)
Q Consensus 144 -------------g~~~~-------------------------------------------~~~~~~~~~~~~~~~~~~~ 167 (279)
|++.| ...+|+|+.......|.|+
T Consensus 185 V~Sy~dI~~~md~GNkqRTtAATnMNdtSSRSHaVFtIvftQk~~~~~~~l~sek~SKIsLVDLAGSERasstGa~G~RL 264 (1221)
T KOG0245|consen 185 VTSYADIQDLMDEGNKQRTTAATNMNDTSSRSHAVFTIVFTQKKHDQDTGLDSEKVSKISLVDLAGSERASSTGANGDRL 264 (1221)
T ss_pred cccHHHHHHHHHhcchhhhhhhhccccccccceeEEEEEEEeeeccccCCCcceeeeeeeEEeccCcccccccCCCccch
Confidence 11111 1126777777777899999
Q ss_pred hhhhHHHHHHHHHHHHHHHHHhhhC---CCCCcccccchhHHHHhHhhcCCCceEEEEEEeCCCCcChHHHHHHHHHHHH
Q psy37 168 KEGAHINKSLVTLGSVISSLAELST---KKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANR 244 (279)
Q Consensus 168 ~e~~~in~Sl~~L~~~i~~l~~~~~---~~~~~ipyr~SkLT~lL~~~l~g~~~~~~i~~isp~~~~~~~tl~tL~fa~~ 244 (279)
+|+.+||+||++||+||.||++.+. ++..+||||||.||+||++.||||+||+||++|||...+|+|||+|||||.|
T Consensus 265 KEGa~INKSLtTLGkVISALAe~~~~k~~ks~fIPYRDSVLTWLLkEnLGGNSKTaMIAAlSPAdiNyeETLSTLRYAdR 344 (1221)
T KOG0245|consen 265 KEGANINKSLTTLGKVISALAESQKGKKKKSDFIPYRDSVLTWLLKENLGGNSKTAMIAALSPADINYEETLSTLRYADR 344 (1221)
T ss_pred hcccccchHHHHHHHHHHHHHHHhccCCCCCccccchHHHHHHHHHHhcCCcchhhhhhccChhhcChHHHHHHHHHhhH
Confidence 9999999999999999999999774 5567899999999999999999999999999999999999999999999999
Q ss_pred hccccCcccccCCccHHHHHHHHHHHHHHHHHhc
Q psy37 245 AKNIINKPTVNEDPNTRIIRELHDEITKLKAMLT 278 (279)
Q Consensus 245 ~~~i~~~~~~~~~~~~~~~~~l~~~~~~Lk~~l~ 278 (279)
+|+|+|++++|++++..+|++|++|+.+||++|.
T Consensus 345 AK~Iv~~avVNEdpnaKLIRELreEv~rLksll~ 378 (1221)
T KOG0245|consen 345 AKQIVNNAVVNEDPNAKLIRELREEVARLKSLLR 378 (1221)
T ss_pred hhhhhccceeCCCccHHHHHHHHHHHHHHHHHHh
Confidence 9999999999999999999999999999999874
|
|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 279 | ||||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-31 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-31 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 3e-31 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-31 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-30 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 8e-30 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-28 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 2e-28 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-26 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 1e-25 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 2e-25 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 4e-25 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 1e-23 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 1e-23 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 1e-23 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 1e-23 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 1e-23 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 1e-23 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 1e-23 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 1e-23 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 6e-23 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 3e-22 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 4e-22 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 6e-21 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 3e-19 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 8e-19 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 3e-18 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 3e-18 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 1e-17 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 2e-17 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 3e-17 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 4e-17 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-16 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 7e-15 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 1e-14 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 1e-14 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-14 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 1e-14 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-14 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 1e-14 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-14 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 3e-14 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 5e-14 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 5e-13 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 9e-13 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 3e-12 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 4e-12 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 4e-12 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 2e-11 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-11 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 5e-11 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 9e-11 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 1e-10 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 1e-10 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 1e-10 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 2e-10 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 5e-10 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 6e-09 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 6e-09 |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
|
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 2e-70 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 4e-36 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 6e-36 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 1e-69 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 1e-29 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 6e-29 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 3e-69 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 4e-27 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 1e-26 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 2e-68 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 2e-31 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 4e-30 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 4e-66 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 2e-26 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 3e-26 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 4e-66 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 2e-29 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 9e-29 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 6e-66 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 6e-37 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 3e-36 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 3e-64 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 8e-31 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 3e-30 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 5e-63 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 1e-37 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 4e-36 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 3e-62 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 2e-28 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 2e-28 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-61 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-26 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-26 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 3e-61 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 2e-28 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 4e-28 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 3e-60 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 2e-24 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 2e-24 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 5e-59 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 2e-28 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 7e-28 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 9e-56 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 2e-27 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 7e-27 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 7e-55 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 2e-54 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 2e-27 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 2e-27 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 2e-54 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 7e-23 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-22 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 1e-53 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 5e-27 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 6e-27 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 1e-53 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 1e-25 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 2e-25 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 2e-53 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 3e-53 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 3e-27 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 1e-26 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 3e-51 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 1e-25 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 2e-25 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 4e-51 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 3e-23 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 3e-23 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 5e-51 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 3e-25 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 3e-25 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 1e-49 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 2e-24 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 2e-24 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 3e-47 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 1e-23 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 1e-23 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 4e-46 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 6e-26 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 3e-25 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 |
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
Score = 220 bits (564), Expect = 2e-70
Identities = 67/104 (64%), Positives = 82/104 (78%), Gaps = 8/104 (7%)
Query: 164 GDRLKEGAHINKSLVTLGSVISSLAELST--------KKSTFIPYRDSVLTWLLKDSLGG 215
G RLKEGA+INKSL TLG VIS+LAE+ + KK+ FIPYRDSVLTWLL+++LGG
Sbjct: 262 GTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGG 321
Query: 216 NSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPN 259
NS+T M+AA+SPAD+NY ETLSTLRYA+RAK I N +VN +
Sbjct: 322 NSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVSVNHHHH 365
|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.97 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.96 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.52 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.38 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.36 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 95.2 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 93.61 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 92.81 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 92.56 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 92.26 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 91.7 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 91.66 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.49 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 91.31 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 91.31 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 91.17 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 91.12 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.59 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 90.49 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.47 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 90.37 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 89.9 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 89.88 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 89.82 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 89.66 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 89.42 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 89.3 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 88.94 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 88.82 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 88.8 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 88.79 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 88.78 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 88.62 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 88.42 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 88.37 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 88.3 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 88.29 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 88.29 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 88.27 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 88.25 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 88.23 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 88.19 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 88.1 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 88.05 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 88.04 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 87.99 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 87.92 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 87.88 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 87.76 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 87.29 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 87.18 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 87.04 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 86.94 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 86.67 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 86.35 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 86.32 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 86.2 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 86.16 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 85.93 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 85.81 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 85.2 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 84.64 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 84.59 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 84.58 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 84.5 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 84.49 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 84.48 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 84.37 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 84.33 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 84.28 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 83.99 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 83.78 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 83.54 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 83.5 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 83.42 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 83.39 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 83.32 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 83.01 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 82.8 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 82.71 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 82.63 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 82.55 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 82.52 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 82.49 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 82.32 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 82.2 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 81.86 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 81.84 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 81.73 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 81.45 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 81.26 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 81.22 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 81.21 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 80.98 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 80.77 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 80.76 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 80.72 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 80.59 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 80.46 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 80.37 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 80.35 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 80.29 |
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-62 Score=429.99 Aligned_cols=238 Identities=35% Similarity=0.527 Sum_probs=197.2
Q ss_pred ceeecCCCCCCCCCHHHHHHHhHHHHHHHhccccCeeEeeccCcCCCceeEecCCCCCCCCCCCccccceecccccccCC
Q psy37 18 SYWSFDPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGKTFTMMGSKATTDNSPDAHKDFTFDHSYWSFDP 97 (279)
Q Consensus 18 ~~f~fd~vf~~~~~q~~vy~~~~~~lv~~v~~G~n~~v~~yG~tgSGKT~Tl~G~~~~~G~~~~~~~~l~f~~~~~~~~~ 97 (279)
..|.||+||+++++|++||+. +.|+|+.+++|+|+||||||||||||||||+|+..++|++|+++.+| |..+......
T Consensus 47 ~~f~FD~Vf~~~~~Q~~Vy~~-~~~lv~~~l~G~n~tifAYGqTGSGKTyTM~G~~~~~Giipr~~~~l-F~~i~~~~~~ 124 (369)
T 3cob_A 47 KQHMYDRVFDGNATQDDVFED-TKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGADSNPGLTPRAMSEL-FRIMKKDSNK 124 (369)
T ss_dssp EEEECSEEECTTCCHHHHHHT-TTHHHHHHHTTCEEEEEEEECTTSSHHHHHTBCSSSBCHHHHHHHHH-HHHHHHTTTT
T ss_pred eEEecCEEECCCCCcceehhh-hhhhhHhhhcCCceEEEEECCCCCCCeEeecCCCCCCchhHHHHHHH-HHHHHhhccC
Confidence 458899999999999999999 57999999999999999999999999999999999999999999999 9877532211
Q ss_pred CCcccccHHHHHhhhchhhHhhhhhccceeeeeccccCCCc--e----------EEEecccc------------------
Q psy37 98 SSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGK--T----------FTMMGSKA------------------ 147 (279)
Q Consensus 98 ~~~~~~s~~ei~~~~~~~l~~s~~e~~~~~v~dl~~~~~~~--~----------~~~~g~~~------------------ 147 (279)
..+.+..+++|+|++.++|||.+.... . ..+.|...
T Consensus 125 --------------~~~~v~vS~~EIYnE~i~DLL~~~~~~~~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~~ll~~g~~ 190 (369)
T 3cob_A 125 --------------FSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSISTYEELKTIIQRGSE 190 (369)
T ss_dssp --------------EEEEEEEEEEEECSSCEEESSCCSSSCCCCCEEEECTTSCEEEETCCCEEECSHHHHHHHHHHHHH
T ss_pred --------------ceeEEEEEEEEEeCceeeecCCCcccCCcceEEEECCCCCEEccCCEEEEeCCHHHHHHHHHHHhh
Confidence 125566699999999999999754221 1 11111111
Q ss_pred -c---------------------------------------cccCccccchhhhhhhhhhhhhhHHHHHHHHHHHHHHHH
Q psy37 148 -R---------------------------------------NFGEGKDCVCSIVEAGDRLKEGAHINKSLVTLGSVISSL 187 (279)
Q Consensus 148 -~---------------------------------------~~~~~~~~~~~~~~~~~~~~e~~~in~Sl~~L~~~i~~l 187 (279)
| ...+|+|++......|.+++|+..||+||++|++||.+|
T Consensus 191 ~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL 270 (369)
T 3cob_A 191 QRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISAL 270 (369)
T ss_dssp HTCCCSCCTTCHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCSSCCCCCSSCSHHHHHHHHHTHHHHHHHHHHHHH
T ss_pred cceeecccCCCCCCcceEEEEEEEEEecCCCCcEEEEEEEEEeCCCCCcccccCccchhhHHHHHHHHHHHHHHHHHHHH
Confidence 1 111456665555577899999999999999999999999
Q ss_pred HhhhCCCCCcccccchhHHHHhHhhcCCCceEEEEEEeCCCCcChHHHHHHHHHHHHhccccCcccccCCccHHHHHHHH
Q psy37 188 AELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRIIRELH 267 (279)
Q Consensus 188 ~~~~~~~~~~ipyr~SkLT~lL~~~l~g~~~~~~i~~isp~~~~~~~tl~tL~fa~~~~~i~~~~~~~~~~~~~~~~~l~ 267 (279)
++ +..|||||+||||+||+|+|||+++|+||+||||...+++||++||+||+|+++|+|.|.+|.++ ..+.+|+
T Consensus 271 ~~----~~~hvPyRdSkLT~lLqdsLgGnskt~mIa~isP~~~~~~ETl~TLrfA~rak~i~~~~~~n~~~--~ei~~L~ 344 (369)
T 3cob_A 271 SS----GNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSS--KEVARLK 344 (369)
T ss_dssp HT----TCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHHTCBCCCCCCEEC--HHHHHHH
T ss_pred hc----CCCcCCCcCCHHHHHHHHhcCCCccEEEEEEeCCccccHHHHHHHHHHHHHHhhcccCCcccCCH--HHHHHHH
Confidence 95 67899999999999999999999999999999999999999999999999999999999999877 6667788
Q ss_pred HHHHHHHHHh
Q psy37 268 DEITKLKAML 277 (279)
Q Consensus 268 ~~~~~Lk~~l 277 (279)
+++..||.++
T Consensus 345 ~~l~~~~~~~ 354 (369)
T 3cob_A 345 KLVSYWKEQA 354 (369)
T ss_dssp HHTTCC----
T ss_pred HHHHHHHHhc
Confidence 8877777654
|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 279 | ||||
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 6e-54 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 3e-14 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 2e-50 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 8e-49 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 2e-11 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-47 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-08 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 2e-45 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 3e-43 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 4e-36 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 4e-06 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 5e-06 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 2e-34 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 4e-14 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 4e-14 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 3e-34 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 3e-11 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 5e-11 |
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Neurospora crassa [TaxId: 5141]
Score = 176 bits (447), Expect = 6e-54
Identities = 91/327 (27%), Positives = 136/327 (41%), Gaps = 69/327 (21%)
Query: 5 NSPDAHKDFTFDHSYWSFDPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSG 64
+S +A FTFD + Q +F+ VD GYN VFAYGQTG+G
Sbjct: 40 DSKEAQGSFTFDRVFD-------MSCKQSDIFDFSIKPTVDDILNGYNGTVFAYGQTGAG 92
Query: 65 KTFTMMGSKATTDNS-----------------PDAHKDFTF---------DHSYWSFDPS 98
K++TMMG+ + A+ ++T + P
Sbjct: 93 KSYTMMGTSIDDPDGRGVIPRIVEQIFTSILSSAANIEYTVRVSYMEIYMERIRDLLAPQ 152
Query: 99 SPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGK---TFTMMGSKARNF----- 150
+ E+ + + + + V+ + G T M ++
Sbjct: 153 NDNLPVHEEKNRGVYVKGLLEIYVSSVQEVYEVMRRGGNARAVAATNMNQESSRSHSIFV 212
Query: 151 ----------GEGKDCVCSIVE------------AGDRLKEGAHINKSLVTLGSVISSLA 188
G K +V+ +G L+E INKSL LG VI++L
Sbjct: 213 ITITQKNVETGSAKSGQLFLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINAL- 271
Query: 189 ELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKNI 248
+ KS+ +PYRDS LT +L++SLGGNS+T +I SP+ N +ETLSTLR+ RAK+I
Sbjct: 272 --TDGKSSHVPYRDSKLTRILQESLGGNSRTTLIINCSPSSYNDAETLSTLRFGMRAKSI 329
Query: 249 INKPTVNEDPNTRIIRELHDEITKLKA 275
NK VN + + EL + K K
Sbjct: 330 KNKAKVNAELS---PAELKQMLAKAKT 353
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.13 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.84 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.31 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.08 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.47 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 92.07 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 91.51 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 91.36 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.18 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 91.14 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 90.79 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 90.21 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 90.2 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 88.56 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 88.46 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 88.42 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 88.36 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 88.3 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 88.16 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 88.12 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 87.58 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 86.61 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 86.57 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 86.39 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 86.26 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 86.16 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 86.05 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 85.22 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 84.82 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 84.47 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 84.27 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 84.15 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 84.08 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 83.79 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 83.66 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 83.59 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 83.56 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 83.33 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 83.26 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 83.1 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 83.08 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 82.98 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 82.66 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 82.33 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.31 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 82.28 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 82.16 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 82.06 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 81.86 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 81.78 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 81.62 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 81.13 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 81.07 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 81.06 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 80.03 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=3.1e-58 Score=407.38 Aligned_cols=238 Identities=35% Similarity=0.519 Sum_probs=187.9
Q ss_pred ceeecCCCCCCCCCHHHHHHHhHHHHHHHhccccCeeEeeccCcCCCceeEecCCCCCCCCCCCccccceecccccccCC
Q psy37 18 SYWSFDPSSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGKTFTMMGSKATTDNSPDAHKDFTFDHSYWSFDP 97 (279)
Q Consensus 18 ~~f~fd~vf~~~~~q~~vy~~~~~~lv~~v~~G~n~~v~~yG~tgSGKT~Tl~G~~~~~G~~~~~~~~l~f~~~~~~~~~ 97 (279)
..|.||+||+++++|++||+.+ .|+|+++++|+|+||||||||||||||||+|+..++|++|+++.+| |..+.....
T Consensus 42 ~~f~FD~vf~~~~~q~~vy~~v-~~lv~~~l~G~n~~i~aYGqTGSGKTyTm~G~~~~~Giipr~~~~l-f~~i~~~~~- 118 (364)
T d1sdma_ 42 KQHMYDRVFDGNATQDDVFEDT-KYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGADSNPGLTPRAMSEL-FRIMKKDSN- 118 (364)
T ss_dssp EEEECSEEECTTCCHHHHHHTT-THHHHHHHTTCEEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHH-HHHHHHGGG-
T ss_pred eEEECCeecCCCCCHHHHHHHH-HHHHHHHhcCCceeeeccccCCCCcccccccCccccchhHHHHHHH-Hhhhhhccc-
Confidence 3578889999999999999975 7999999999999999999999999999999999999999999999 877653321
Q ss_pred CCcccccHHHHHhhhchhhHhhhhhccceeeeeccccCCCce------------EEEeccccc-----------------
Q psy37 98 SSPQFASQEQVFNDLGMDVVDAAFEGYNACVFAYGQTGSGKT------------FTMMGSKAR----------------- 148 (279)
Q Consensus 98 ~~~~~~s~~ei~~~~~~~l~~s~~e~~~~~v~dl~~~~~~~~------------~~~~g~~~~----------------- 148 (279)
...+.+..+++|+|++.++||+.+..... ..+.|....
T Consensus 119 -------------~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~g~~ 185 (364)
T d1sdma_ 119 -------------KFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSISTYEELKTIIQRGSE 185 (364)
T ss_dssp -------------TEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTTSCEEEETCCCEEECSHHHHHHHHHHHHH
T ss_pred -------------cccceEEEEEEEEeccccccccCcccccccccceeecccCccccccceeeeeCCHHHHHHHhhccce
Confidence 12255666999999999999997544321 111111111
Q ss_pred -----------------------------------------cccCccccchhhhhhhhhhhhhhHHHHHHHHHHHHHHHH
Q psy37 149 -----------------------------------------NFGEGKDCVCSIVEAGDRLKEGAHINKSLVTLGSVISSL 187 (279)
Q Consensus 149 -----------------------------------------~~~~~~~~~~~~~~~~~~~~e~~~in~Sl~~L~~~i~~l 187 (279)
...+|+|+.......|.+++|+..||+||++|++||.+|
T Consensus 186 ~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL 265 (364)
T d1sdma_ 186 QRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISAL 265 (364)
T ss_dssp HHCCCSSCTTCHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHH
T ss_pred eeccccccccccccccceEEEEEEEEeccCcceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHH
Confidence 111455655555677889999999999999999999999
Q ss_pred HhhhCCCCCcccccchhHHHHhHhhcCCCceEEEEEEeCCCCcChHHHHHHHHHHHHhccccCcccccCCccHHHHHHHH
Q psy37 188 AELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRIIRELH 267 (279)
Q Consensus 188 ~~~~~~~~~~ipyr~SkLT~lL~~~l~g~~~~~~i~~isp~~~~~~~tl~tL~fa~~~~~i~~~~~~~~~~~~~~~~~l~ 267 (279)
++ +..|||||+||||++|+|+|||+++|+||+||||+..+++||++||+||+++++|+|.|++|... ..+.+|+
T Consensus 266 ~~----~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~--~~~~~l~ 339 (364)
T d1sdma_ 266 SS----GNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSS--KEVARLK 339 (364)
T ss_dssp HH----TCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCCEEC--HHHHHHH
T ss_pred Hc----CCCcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCcccCCH--HHHHHHH
Confidence 95 67799999999999999999999999999999999999999999999999999999999998654 3466778
Q ss_pred HHHHHHHHHh
Q psy37 268 DEITKLKAML 277 (279)
Q Consensus 268 ~~~~~Lk~~l 277 (279)
+++..|++++
T Consensus 340 ~~i~~l~~~~ 349 (364)
T d1sdma_ 340 KLVSYWKEQA 349 (364)
T ss_dssp TTTTCC----
T ss_pred HHHHHHHHHH
Confidence 8877777765
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|