Psyllid ID: psy3862


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-
MFQKFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMYFI
cHHHHcccHHHHHHccccccccccccccccEEEccccccEEEEEEccccccccccccEEEEccccccccHHHHHHHHHcccEEEEEEEccHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEccccccEEEEEEEcccccEEEEEccccccccccccHHHHHHHHHHccccEEEEccccccccEEEEEccccccEEEHHHHHHHHHHHccccEEEccHHHHHHHHHcccccccccEEccccccccccccccEEEEEEcccccccccccEEEEEcccccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccEEEEcEEEccEEEEcEEEEEEEEEEccccccccccccEEccccccccHHHHHHHHccccEEEEcccccccccccccEEEEccEEEEEEEEccHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHcccccccccccccccccccccccEEEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHcccccccccccccccccccccEEEEEcccccccccc
cccHHHHHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHHHHHccccEHccccccHcHHHHHHHHHHccccEEEEEcccHHHHHHcHHHHccccccEEEEccccccHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccEEEEEcccccccccHEEHccccHHHHHccHHHHHHccccHHHHHHHHHHccccEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHcHHEEEEEEEcccccEEEEEEEEHHHHcccccccccccccEEEEEEEccccHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccEEEEEEEccEEEEEccccHHHHHHHHHHHHHHHccccEEEcccEEccHHHHHHHHHcccEEEEcHHccccccccccEEEEEccEEEEEcccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHcccEEEEcccccccccccccEEccccccHHHccccHHcccccccHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHHHHHccHccHHHHHHHHHccEEEEEEHHcccEEEc
MFQKFLTAMAQKIINDIKLdfkdvmlrpkrstlksrsevditrtftfrnsgktyqgvpiiaanmdtVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADvikvgigpgsvcttrlknktsdfFLIQFYscipqagnvvtGEMVEELILSGADvikvgigpgsvcttrlktgvgypqfsAVLECADAAHGLGGHIISFLTAMAQKIINDIKLdfkdvmlrpkrstlksrsevditrtftfrnsgktyqgvpiiaanmdtVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAfavqnpdvikhvadggctspgdvAKAMGAGADFVMLGGmfaghdqsggeltnIEYMFFPLvgdmnsylggvvdggctspgdvAKAMGAGADFVMLGGmfaghdqsggeliekdgKKVKLFYGMSSTTAMDKHAGGVAEYraaegktvqvpyrgdvndTVQDILGGLRSACTYVgasklkelprraTFIRCTAQLNNVNDTVQDILGGLRSACTYVgasklkelprraTFIRCTAQLNnvaaegktvqvpyrgdvndTVQDILGGLRSACTYVgasklkelprraTFIRCTAQLNNMYFI
MFQKFLTAMAQKIindikldfkdvmlrpkrstlksrsevditrtftfrnsgktyqgvPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMlrpkrstlksrsevditrtftfrnsgktyqgvPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEgktvqvpyrgdVNDTVQDILGGLRSACTYVGasklkelprrATFIrctaqlnnvnDTVQDILGGLRSACTYVGasklkelprrATFIRCTAqlnnvaaegktvqvpyrgdVNDTVQDILGGLRSACTYVGasklkelprratFIRCtaqlnnmyfi
MFQKFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMYFI
****FLTAMAQKIINDIKLDFKDVMLR**********EVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRP*********EVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMYF*
*FQKFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISF*TAM*QKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTT************RAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQD*****R**********************CTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQL**MYFI
MFQKFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMYFI
MFQKFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMYFI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQKFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMYFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query671 2.2.26 [Sep-21-2011]
Q32L93348 GMP reductase 2 OS=Bos ta yes N/A 0.320 0.617 0.578 1e-85
Q9P2T1348 GMP reductase 2 OS=Homo s yes N/A 0.320 0.617 0.582 2e-85
Q99L27348 GMP reductase 2 OS=Mus mu yes N/A 0.320 0.617 0.559 1e-82
Q9DCZ1345 GMP reductase 1 OS=Mus mu no N/A 0.321 0.626 0.546 2e-81
Q9Z244345 GMP reductase 1 OS=Rattus no N/A 0.321 0.626 0.546 3e-81
O16294358 Probable GMP reductase OS yes N/A 0.321 0.603 0.544 8e-81
P36959345 GMP reductase 1 OS=Homo s no N/A 0.321 0.626 0.542 1e-80
P27442356 GMP reductase OS=Ascaris N/A N/A 0.321 0.606 0.544 1e-79
Q9NJD8364 GMP reductase OS=Onchocer N/A N/A 0.320 0.590 0.527 6e-77
B5Y1T3347 GMP reductase OS=Klebsiel yes N/A 0.320 0.619 0.535 6e-76
>sp|Q32L93|GMPR2_BOVIN GMP reductase 2 OS=Bos taurus GN=GMPR2 PE=2 SV=1 Back     alignment and function desciption
 Score =  317 bits (813), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/268 (57%), Positives = 187/268 (69%), Gaps = 53/268 (19%)

Query: 13  IINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEM 72
           I ND+KLDFKDV+LRPKRSTLKSRSEVD+TR+F FRNS + Y G+PIIAANMDTVGTFEM
Sbjct: 4   IDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFAFRNSKQMYTGIPIIAANMDTVGTFEM 63

Query: 73  AKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEI 132
           AK L K  LFT +HK+Y+LE+WK FA QNPD ++H+A SSG  + D   L++IL A+P++
Sbjct: 64  AKVLCKFSLFTAVHKHYSLEQWKEFASQNPDCLEHLAASSGTGSSDFEQLEQILNAIPQV 123

Query: 133 EYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPG 192
           +Y+CLDVANGY++ FV+FV+ +R+ +P+H I+AGNVVTGEMVEELILSGAD+IKVGIGPG
Sbjct: 124 KYVCLDVANGYSEHFVEFVKDVRKRFPEHTIMAGNVVTGEMVEELILSGADIIKVGIGPG 183

Query: 193 SVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRL 252
           SVCTTR K                                                    
Sbjct: 184 SVCTTRKK---------------------------------------------------- 191

Query: 253 KTGVGYPQFSAVLECADAAHGLGGHIIS 280
            TGVGYPQ SAV+ECADAAHGL GHIIS
Sbjct: 192 -TGVGYPQLSAVMECADAAHGLKGHIIS 218




Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 7EC: .EC: 1EC: .EC: 7
>sp|Q9P2T1|GMPR2_HUMAN GMP reductase 2 OS=Homo sapiens GN=GMPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q99L27|GMPR2_MOUSE GMP reductase 2 OS=Mus musculus GN=Gmpr2 PE=2 SV=2 Back     alignment and function description
>sp|Q9DCZ1|GMPR1_MOUSE GMP reductase 1 OS=Mus musculus GN=Gmpr PE=2 SV=1 Back     alignment and function description
>sp|Q9Z244|GMPR1_RAT GMP reductase 1 OS=Rattus norvegicus GN=Gmpr PE=2 SV=1 Back     alignment and function description
>sp|O16294|GMPR_CAEEL Probable GMP reductase OS=Caenorhabditis elegans GN=F32D1.5 PE=3 SV=1 Back     alignment and function description
>sp|P36959|GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens GN=GMPR PE=1 SV=1 Back     alignment and function description
>sp|P27442|GMPR_ASCSU GMP reductase OS=Ascaris suum PE=2 SV=1 Back     alignment and function description
>sp|Q9NJD8|GMPR_ONCVO GMP reductase OS=Onchocerca volvulus GN=gmr-1 PE=2 SV=1 Back     alignment and function description
>sp|B5Y1T3|GUAC_KLEP3 GMP reductase OS=Klebsiella pneumoniae (strain 342) GN=guaC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query671
431907149428 GMP reductase 2 [Pteropus alecto] 0.491 0.771 0.468 1e-96
148709072309 guanosine monophosphate reductase [Mus m 0.418 0.909 0.568 8e-88
383858337350 PREDICTED: GMP reductase 1-like [Megachi 0.320 0.614 0.608 2e-87
387540104366 GMP reductase 2 isoform 1 [Macaca mulatt 0.329 0.603 0.589 2e-85
156547587348 PREDICTED: GMP reductase 1-like [Nasonia 0.320 0.617 0.585 2e-85
109083144348 PREDICTED: GMP reductase 2 isoform 7 [Ma 0.320 0.617 0.593 5e-85
380786083348 GMP reductase 2 isoform 1 [Macaca mulatt 0.320 0.617 0.593 6e-85
410961992348 PREDICTED: GMP reductase 2 [Felis catus] 0.320 0.617 0.585 1e-84
332373366345 unknown [Dendroctonus ponderosae] 0.320 0.623 0.589 2e-84
355748251295 GMP reductase 1 [Macaca fascicularis] 0.418 0.952 0.561 3e-84
>gi|431907149|gb|ELK11215.1| GMP reductase 2 [Pteropus alecto] Back     alignment and taxonomy information
 Score =  360 bits (924), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 209/446 (46%), Positives = 261/446 (58%), Gaps = 116/446 (26%)

Query: 13  IINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEM 72
           I ND+KLDFKDV+LRPKRSTLKSRSEVD+TR+F+FRNS + Y G+PIIAANMDTVGTFEM
Sbjct: 22  IDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQMYTGIPIIAANMDTVGTFEM 81

Query: 73  AKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEI 132
           AK L+K  LFT +HK+Y+LE+WK FA QN D +KH+A SSG S+ D   L++IL A+P++
Sbjct: 82  AKVLSKFSLFTAVHKHYSLEQWKVFASQNSDCLKHLAASSGTSSSDFEQLEQILEAIPQV 141

Query: 133 EYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPG 192
           +YICLDVANGY++ FV+FV+ +R+ +P+H I+                            
Sbjct: 142 KYICLDVANGYSEHFVEFVKDVRKRFPEHTIM---------------------------- 173

Query: 193 SVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRL 252
                                    AGNVVTGEMVEELILSGAD+IKVGIGPGSVCTTR 
Sbjct: 174 -------------------------AGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRK 208

Query: 253 KTGVGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTL--- 309
           KTGVGYPQ SAV+ECADAAHGL GHI              I + FK +++      L   
Sbjct: 209 KTGVGYPQLSAVMECADAAHGLKGHI--------------ISVRFKGMVVYEAAKHLGFL 254

Query: 310 ---KSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHG-LFTTIHKYY 365
              ++  EVD                VP+       VG +++A+ L     LFT      
Sbjct: 255 LGMEALIEVDQD------------SWVPVSFE----VGHWDIAESLGNGCYLFT------ 292

Query: 366 TLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELTNI 425
                         V+  + DGGC  PGDVAKA GAGADFVMLGGM AGH +SGGEL   
Sbjct: 293 --------------VLLTLQDGGCRCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIKR 338

Query: 426 E----YMFFPLVGD--MNSYLGGVVD 445
           +     +F+ +  +  M  Y GGV +
Sbjct: 339 DGKKYKLFYGMSSEMAMKKYAGGVAE 364




Source: Pteropus alecto

Species: Pteropus alecto

Genus: Pteropus

Family: Pteropodidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|148709072|gb|EDL41018.1| guanosine monophosphate reductase [Mus musculus] Back     alignment and taxonomy information
>gi|383858337|ref|XP_003704658.1| PREDICTED: GMP reductase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|387540104|gb|AFJ70679.1| GMP reductase 2 isoform 1 [Macaca mulatta] Back     alignment and taxonomy information
>gi|156547587|ref|XP_001603068.1| PREDICTED: GMP reductase 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|109083144|ref|XP_001113269.1| PREDICTED: GMP reductase 2 isoform 7 [Macaca mulatta] gi|109083146|ref|XP_001113297.1| PREDICTED: GMP reductase 2 isoform 8 [Macaca mulatta] gi|109083148|ref|XP_001113331.1| PREDICTED: GMP reductase 2 isoform 9 [Macaca mulatta] Back     alignment and taxonomy information
>gi|380786083|gb|AFE64917.1| GMP reductase 2 isoform 1 [Macaca mulatta] Back     alignment and taxonomy information
>gi|410961992|ref|XP_003987562.1| PREDICTED: GMP reductase 2 [Felis catus] Back     alignment and taxonomy information
>gi|332373366|gb|AEE61824.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|355748251|gb|EHH52734.1| GMP reductase 1 [Macaca fascicularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query671
UNIPROTKB|P60560347 guaC "GuaC" [Escherichia coli 0.280 0.541 0.607 9.1e-109
UNIPROTKB|H0YNJ6427 GMPR2 "GMP reductase" [Homo sa 0.354 0.557 0.599 6.4e-108
UNIPROTKB|Q6PKC0409 GMPR2 "GMP reductase" [Homo sa 0.345 0.567 0.604 1.7e-107
UNIPROTKB|H0YLV5333 GMPR2 "GMP reductase 2" [Homo 0.287 0.579 0.55 2.3e-93
UNIPROTKB|H0YMB3315 GMPR2 "GMP reductase 2" [Homo 0.287 0.612 0.55 6.2e-93
ZFIN|ZDB-GENE-050522-48345 gmpr "guanosine monophosphate 0.275 0.536 0.718 2.4e-91
UNIPROTKB|Q9P2T1348 GMPR2 "GMP reductase 2" [Homo 0.345 0.666 0.604 3.8e-91
UNIPROTKB|E2RBW1348 GMPR2 "GMP reductase" [Canis l 0.345 0.666 0.6 6.2e-91
UNIPROTKB|F1SGN8348 GMPR2 "Uncharacterized protein 0.345 0.666 0.604 1.3e-90
UNIPROTKB|Q32L93348 GMPR2 "GMP reductase 2" [Bos t 0.345 0.666 0.6 9e-90
UNIPROTKB|P60560 guaC "GuaC" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 607 (218.7 bits), Expect = 9.1e-109, Sum P(2) = 9.1e-109
 Identities = 116/191 (60%), Positives = 149/191 (78%)

Query:    12 KIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFE 71
             +I  D+KL FKDV++RPKRSTLKSRS+V++ R FTF++SG+++ GVPIIAANMDTVGTF 
Sbjct:     2 RIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWSGVPIIAANMDTVGTFS 61

Query:    72 MAKHLAKHGLFTTIHKYYTLEEWKAFAVQNP--DVIKHVAVSSGISAKDLAGLKEILAAL 129
             MA  LA   + T +HK+Y++EEW+AF + N   DV+KHV VS+G S  D    K+IL   
Sbjct:    62 MASALASFDILTAVHKHYSVEEWQAF-INNSSADVLKHVMVSTGTSDADFEKTKQILDLN 120

Query:   130 PEIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGI 189
             P + ++C+DVANGY++ FV FV + RE +P   I AGNVVTGEM EELILSGAD++KVGI
Sbjct:   121 PALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGEMCEELILSGADIVKVGI 180

Query:   190 GPGSVCTTRLK 200
             GPGSVCTTR+K
Sbjct:   181 GPGSVCTTRVK 191


GO:0042802 "identical protein binding" evidence=IDA
GO:0015951 "purine ribonucleotide interconversion" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0003920 "GMP reductase activity" evidence=IEA;IDA
GO:0005737 "cytoplasm" evidence=IC
UNIPROTKB|H0YNJ6 GMPR2 "GMP reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PKC0 GMPR2 "GMP reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLV5 GMPR2 "GMP reductase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YMB3 GMPR2 "GMP reductase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-48 gmpr "guanosine monophosphate reductase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2T1 GMPR2 "GMP reductase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBW1 GMPR2 "GMP reductase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGN8 GMPR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L93 GMPR2 "GMP reductase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8ZBI2GUAC_YERPE1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B5BLD7GUAC_SALPK1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B2K4G3GUAC_YERPB1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B5F7X8GUAC_SALA41, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
A1JJK8GUAC_YERE81, ., 7, ., 1, ., 70.51480.32190.6224yesN/A
Q1C3T0GUAC_YERPA1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B4TJA0GUAC_SALHS1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
A8HAF6GUAC_SHEPA1, ., 7, ., 1, ., 70.50920.32040.6195yesN/A
Q8ZRT5GUAC_SALTY1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B7LWQ6GUAC_ESCF31, ., 7, ., 1, ., 70.51480.32190.6224yesN/A
B1JK64GUAC_YERPY1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B5Y1T3GUAC_KLEP31, ., 7, ., 1, ., 70.53500.32040.6195yesN/A
B5YZD9GUAC_ECO5E1, ., 7, ., 1, ., 70.51480.32190.6224yesN/A
Q9P2T1GMPR2_HUMAN1, ., 7, ., 1, ., 70.58200.32040.6178yesN/A
A0KN65GUAC_AERHH1, ., 7, ., 1, ., 70.50180.32040.6195yesN/A
A8ALJ2GUAC_CITK81, ., 7, ., 1, ., 70.51110.32190.6224yesN/A
A4SJY8GUAC_AERS41, ., 7, ., 1, ., 70.50550.32040.6195yesN/A
A9MZN3GUAC_SALPB1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
Q66EJ0GUAC_YERPS1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
C0Q5K1GUAC_SALPC1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
Q99L27GMPR2_MOUSE1, ., 7, ., 1, ., 70.55970.32040.6178yesN/A
B5FI86GUAC_SALDC1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
A6T4P6GUAC_KLEP71, ., 7, ., 1, ., 70.52960.32190.6224yesN/A
B1LG40GUAC_ECOSM1, ., 7, ., 1, ., 70.51110.32190.6224yesN/A
B4TXJ0GUAC_SALSV1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B6HZ81GUAC_ECOSE1, ., 7, ., 1, ., 70.51110.32190.6224yesN/A
Q1CLY8GUAC_YERPN1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
Q32L93GMPR2_BOVIN1, ., 7, ., 1, ., 70.57830.32040.6178yesN/A
A7FM52GUAC_YERP31, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B0TQE1GUAC_SHEHH1, ., 7, ., 1, ., 70.51670.32040.6195yesN/A
Q5PDH8GUAC_SALPA1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B5R2N9GUAC_SALEP1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
B5RH79GUAC_SALG21, ., 7, ., 1, ., 70.51850.32190.6224yesN/A
B4SU63GUAC_SALNS1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
Q1RG92GUAC_ECOUT1, ., 7, ., 1, ., 70.51110.32190.6224yesN/A
A9R1J4GUAC_YERPG1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
A4W6K6GUAC_ENT381, ., 7, ., 1, ., 70.52590.32190.6224yesN/A
Q3Z5Q5GUAC_SHISS1, ., 7, ., 1, ., 70.51110.32190.6224yesN/A
A8G9U1GUAC_SERP51, ., 7, ., 1, ., 70.52220.32190.6224yesN/A
O16294GMPR_CAEEL1, ., 7, ., 1, ., 70.54440.32190.6033yesN/A
A4TPS6GUAC_YERPP1, ., 7, ., 1, ., 70.52220.32190.6224yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.7.1.70.824
3rd Layer1.7.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxi 1e-123
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate r 1e-110
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxi 3e-82
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate r 7e-71
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 1e-54
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 3e-49
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxi 5e-48
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate r 4e-44
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 1e-41
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 8e-41
PRK05458326 PRK05458, PRK05458, guanosine 5'-monophosphate oxi 2e-30
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxi 6e-28
TIGR01306321 TIGR01306, GMP_reduct_2, guanosine monophosphate r 2e-26
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 1e-25
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate r 2e-24
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 2e-24
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydr 7e-22
TIGR01306321 TIGR01306, GMP_reduct_2, guanosine monophosphate r 8e-22
TIGR01303475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family 3e-21
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 4e-21
PRK05458326 PRK05458, PRK05458, guanosine 5'-monophosphate oxi 1e-20
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 5e-20
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 5e-20
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 5e-20
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 9e-20
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 4e-19
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 6e-18
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 1e-17
TIGR01303475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family 7e-17
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydr 1e-16
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 4e-16
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 7e-15
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 1e-13
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 1e-13
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 1e-11
PRK07107502 PRK07107, PRK07107, inosine 5-monophosphate dehydr 2e-11
PLN02274505 PLN02274, PLN02274, inosine-5'-monophosphate dehyd 2e-09
PLN02274505 PLN02274, PLN02274, inosine-5'-monophosphate dehyd 7e-09
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 8e-09
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 2e-08
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydr 4e-08
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 5e-08
PLN02274505 PLN02274, PLN02274, inosine-5'-monophosphate dehyd 5e-08
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 7e-08
PRK05458326 PRK05458, PRK05458, guanosine 5'-monophosphate oxi 1e-07
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 2e-07
PRK07107502 PRK07107, PRK07107, inosine 5-monophosphate dehydr 3e-07
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 6e-07
PRK05458326 PRK05458, PRK05458, guanosine 5'-monophosphate oxi 8e-07
PTZ00314 495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 8e-07
TIGR01304369 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family 1e-05
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 3e-05
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 5e-05
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydr 5e-05
TIGR01303475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family 2e-04
TIGR01303475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family 2e-04
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 4e-04
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 4e-04
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 4e-04
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 4e-04
PLN02274505 PLN02274, PLN02274, inosine-5'-monophosphate dehyd 6e-04
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydr 6e-04
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydr 7e-04
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 0.001
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 0.001
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydr 0.001
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 0.001
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 0.001
TIGR01304369 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family 0.002
cd02808392 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-b 0.003
>gnl|CDD|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
 Score =  370 bits (952), Expect = e-123
 Identities = 143/270 (52%), Positives = 176/270 (65%), Gaps = 54/270 (20%)

Query: 12  KIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFE 71
           +I  D+KL FKDV++RPKRSTLKSRS+V++ R FTF++SG+++ GVPIIAANMDTVGTFE
Sbjct: 2   RIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWSGVPIIAANMDTVGTFE 61

Query: 72  MAKHLAKHGLFTTIHKYYTLEEWKAF-AVQNPDVIKHVAVSSGISAKDLAGLKEILAALP 130
           MAK LA   + T +HK+Y++EEW AF    + DV+KHV VS+G S  D    K+ILA  P
Sbjct: 62  MAKALASFDILTAVHKHYSVEEWAAFVNNSSADVLKHVMVSTGTSDADFEKTKQILALSP 121

Query: 131 EIEYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIG 190
            + +IC+DVANGY++ FV FV + RE +P   I AGNVVTGEMVEELILSGAD++KVGIG
Sbjct: 122 ALNFICIDVANGYSEHFVQFVAKAREAWPDKTICAGNVVTGEMVEELILSGADIVKVGIG 181

Query: 191 PGSVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTT 250
           PGSVCTTR+K                                                  
Sbjct: 182 PGSVCTTRVK-------------------------------------------------- 191

Query: 251 RLKTGVGYPQFSAVLECADAAHGLGGHIIS 280
              TGVGYPQ SAV+ECADAAHGLGG I+S
Sbjct: 192 ---TGVGYPQLSAVIECADAAHGLGGQIVS 218


Length = 346

>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233351 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|233351 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|239202 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 671
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 100.0
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 100.0
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 100.0
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 100.0
KOG2550|consensus503 100.0
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 100.0
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 100.0
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 100.0
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 100.0
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 100.0
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 100.0
KOG2550|consensus503 100.0
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 100.0
PLN02274505 inosine-5'-monophosphate dehydrogenase 100.0
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 100.0
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 100.0
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 100.0
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 100.0
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 100.0
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 100.0
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 100.0
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 100.0
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 100.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 100.0
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 100.0
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 100.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 100.0
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 100.0
PLN02274505 inosine-5'-monophosphate dehydrogenase 100.0
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 100.0
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 100.0
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 100.0
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 100.0
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.94
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide t 99.81
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 99.62
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 99.61
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 99.6
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 99.6
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.58
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 99.55
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 99.47
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide t 99.43
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.37
cd04742418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 99.36
TIGR02814444 pfaD_fam PfaD family protein. The protein PfaD is 99.29
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 99.12
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 98.92
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 98.84
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 98.79
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.74
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 98.72
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.67
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 98.61
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 98.59
PLN02535364 glycolate oxidase 98.57
PRK11197381 lldD L-lactate dehydrogenase; Provisional 98.52
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 98.49
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 98.48
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 98.47
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 98.43
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 98.38
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 98.33
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 98.32
PLN02979366 glycolate oxidase 98.31
PLN02535364 glycolate oxidase 98.3
PF01645368 Glu_synthase: Conserved region in glutamate syntha 98.28
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 98.26
PRK11197381 lldD L-lactate dehydrogenase; Provisional 98.26
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 98.26
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 98.24
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.21
PLN02979366 glycolate oxidase 98.14
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.02
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 97.96
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 97.94
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 97.94
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 97.88
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.87
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.74
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 97.74
cd04742418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 97.72
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 97.71
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 97.66
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.63
TIGR02814444 pfaD_fam PfaD family protein. The protein PfaD is 97.6
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.58
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.57
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.57
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 97.55
PRK117501485 gltB glutamate synthase subunit alpha; Provisional 97.51
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 97.5
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 97.48
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 97.47
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 97.39
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 97.38
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.37
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 97.36
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 97.3
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.29
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.29
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 97.2
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 97.18
KOG0538|consensus363 97.18
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 97.13
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 97.06
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 97.06
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 97.04
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 97.01
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 96.86
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.75
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 96.74
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.73
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 96.71
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 96.7
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 96.6
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 96.6
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.49
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.46
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.43
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 96.4
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.33
PLN02826409 dihydroorotate dehydrogenase 96.32
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 96.3
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.21
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 96.19
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 96.14
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 96.13
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 96.09
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.08
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.03
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 96.03
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 96.03
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.02
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 95.95
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 95.94
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 95.84
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 95.83
KOG0538|consensus363 95.69
PF01645368 Glu_synthase: Conserved region in glutamate syntha 95.65
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 95.65
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.62
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.6
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 95.59
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.58
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 95.53
KOG3111|consensus224 95.47
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.42
PRK02227238 hypothetical protein; Provisional 95.41
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 95.37
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 95.29
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 95.18
PLN02746347 hydroxymethylglutaryl-CoA lyase 95.18
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 95.15
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.15
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 95.08
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.03
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.0
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 94.99
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 94.97
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 94.88
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 94.83
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 94.79
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 94.75
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 94.75
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 94.6
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 94.49
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 94.48
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 94.43
PLN02424332 ketopantoate hydroxymethyltransferase 94.43
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 94.24
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 94.23
PRK00208250 thiG thiazole synthase; Reviewed 94.06
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 93.98
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 93.92
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.7
PRK14024241 phosphoribosyl isomerase A; Provisional 93.52
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 93.44
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 93.36
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 93.31
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 93.24
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 93.21
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 93.06
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 93.02
PLN02591250 tryptophan synthase 92.95
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 92.86
COG0826347 Collagenase and related proteases [Posttranslation 92.84
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 92.75
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 92.62
PRK07695201 transcriptional regulator TenI; Provisional 92.6
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 92.59
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 92.57
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 92.56
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 92.55
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 92.49
PRK14024241 phosphoribosyl isomerase A; Provisional 92.45
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 92.43
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 92.42
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 92.41
PRK00208250 thiG thiazole synthase; Reviewed 92.27
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 92.17
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 92.16
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 92.1
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 92.01
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 91.94
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 91.88
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 91.82
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 91.79
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 91.76
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 91.76
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 91.67
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 91.48
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 91.27
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 91.25
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 91.18
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 91.12
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 91.12
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 91.09
PLN02334229 ribulose-phosphate 3-epimerase 91.04
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 91.01
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 90.88
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 90.78
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 90.54
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 90.52
PRK00507221 deoxyribose-phosphate aldolase; Provisional 90.32
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 90.2
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 90.17
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 90.13
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 90.12
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 90.12
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 90.06
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 89.97
PRK05581220 ribulose-phosphate 3-epimerase; Validated 89.9
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 89.84
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 89.81
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 89.74
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 89.71
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 89.69
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 89.55
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 89.39
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 89.34
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 89.29
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 89.18
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 89.16
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 89.14
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 88.91
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 88.9
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 88.84
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 88.75
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 88.65
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 88.65
PRK08227264 autoinducer 2 aldolase; Validated 88.49
PRK04302223 triosephosphate isomerase; Provisional 88.32
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 87.99
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 87.93
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 87.91
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 87.77
TIGR01334277 modD putative molybdenum utilization protein ModD. 87.67
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 87.65
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 87.39
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 87.39
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 87.36
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 87.35
PRK14041467 oxaloacetate decarboxylase; Provisional 87.31
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 87.27
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 87.26
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 87.09
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 87.07
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 86.88
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 86.88
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 86.87
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 86.82
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 86.74
PLN02617538 imidazole glycerol phosphate synthase hisHF 86.71
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 86.6
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 86.54
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 86.46
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 86.22
PRK06096284 molybdenum transport protein ModD; Provisional 86.15
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 85.82
CHL00162267 thiG thiamin biosynthesis protein G; Validated 85.75
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 85.67
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 85.67
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 85.13
PRK08508279 biotin synthase; Provisional 85.08
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 85.03
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 84.96
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 84.27
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 84.23
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 83.99
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 83.99
PRK06852304 aldolase; Validated 83.95
PRK09016296 quinolinate phosphoribosyltransferase; Validated 83.9
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 83.86
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 83.77
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 83.69
PRK08005210 epimerase; Validated 83.61
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 83.61
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 83.55
PRK04302223 triosephosphate isomerase; Provisional 83.5
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 83.37
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 83.36
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 83.3
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 83.25
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 83.13
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 83.1
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 82.99
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 82.55
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 82.32
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 82.26
PRK15452443 putative protease; Provisional 82.24
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 82.21
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 82.17
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 81.88
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 81.74
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 81.32
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 81.16
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 81.13
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 81.03
PRK12331448 oxaloacetate decarboxylase; Provisional 80.96
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 80.63
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 80.54
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 80.5
TIGR01334277 modD putative molybdenum utilization protein ModD. 80.09
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-90  Score=724.49  Aligned_cols=328  Identities=39%  Similarity=0.608  Sum_probs=300.2

Q ss_pred             ceeeccccCCCceeeeecCCCccCCCCcccceeeeeeccCCceeeCcceEecCCCCCCCHHHHHHHHHcCCeEEEccCCC
Q psy3862         287 QKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYT  366 (671)
Q Consensus       287 ~~i~~~~~l~fdDVll~P~rst~~sr~eVdl~~~l~~~~s~~~~~~iPiIaa~MDtV~~~~mA~~la~~Gglgvihr~~~  366 (671)
                      |||++|.+||||||||+|+||+++||+||||+++|+|+||++.|+++||||||||||++++||++|+++|+|++||||++
T Consensus         1 ~~i~~~~~l~f~DVll~P~~s~v~sRsevdl~~~~~~~~~~~~~~giPii~AnMdTV~~~~mA~~la~~g~~~~iHk~~~   80 (346)
T PRK05096          1 MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWSGVPIIAANMDTVGTFEMAKALASFDILTAVHKHYS   80 (346)
T ss_pred             CcccccCCCCceeEEEecCcCccccHHHceecceeeeecccccccCCceEecCCCccccHHHHHHHHHCCCeEEEecCCC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCc-ccccceeeecccChhhH---HHHHH--cCCcEEEEcccccccccccccccccccccccccccccccc
Q psy3862         367 LEEWKAFAVQNP-DVIKHVADGGCTSPGDV---AKAMG--AGADFVMLGGMFAGHDQSGGELTNIEYMFFPLVGDMNSYL  440 (671)
Q Consensus       367 ~e~~~~~v~~~~-~~~~~v~~~~~~~~~~~---~~l~~--aG~d~i~id~~a~gh~~~~~~~~~~~~~~~~~~~~~~~~~  440 (671)
                      +|+|++|+++.+ +...++..+.+++++|+   ++|++  +|+|+|||| +|||||++++++++.++..||.++      
T Consensus        81 ~e~~~~fv~~~~~~~~~~~~vavG~~~~d~er~~~L~~~~~g~D~iviD-~AhGhs~~~i~~ik~ik~~~P~~~------  153 (346)
T PRK05096         81 VEEWAAFVNNSSADVLKHVMVSTGTSDADFEKTKQILALSPALNFICID-VANGYSEHFVQFVAKAREAWPDKT------  153 (346)
T ss_pred             HHHHHHHHHhccccccceEEEEecCCHHHHHHHHHHHhcCCCCCEEEEE-CCCCcHHHHHHHHHHHHHhCCCCc------
Confidence            999999998865 55677777888887655   44577  599999999 999999999999999999999884      


Q ss_pred             CceeeccccCchhHHH-HHHcCCcEEEECccccCCccCCCcEEEeCCeEEEEeeCcccHHHHHhhccccccc---cccCC
Q psy3862         441 GGVVDGGCTSPGDVAK-AMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEY---RAAEG  516 (671)
Q Consensus       441 ~~~i~gG~v~t~~~a~-~l~aGAd~V~vG~~g~G~s~ctt~~v~~~g~~~k~g~G~~q~tAi~~~a~~~~~y---~~~~G  516 (671)
                         |++|||+|+++++ ++++|||+||||+ ||| |+||||++        +|+|+||+||+++|+.++++|   .++||
T Consensus       154 ---vIaGNV~T~e~a~~Li~aGAD~vKVGI-GpG-SiCtTr~v--------tGvG~PQltAV~~~a~~a~~~gvpiIADG  220 (346)
T PRK05096        154 ---ICAGNVVTGEMVEELILSGADIVKVGI-GPG-SVCTTRVK--------TGVGYPQLSAVIECADAAHGLGGQIVSDG  220 (346)
T ss_pred             ---EEEecccCHHHHHHHHHcCCCEEEEcc-cCC-ccccCccc--------cccChhHHHHHHHHHHHHHHcCCCEEecC
Confidence               6899999999999 5699999999996 999 99999875        689999999999999988877   36777


Q ss_pred             ceEeeecCCCHHHHHH-----HHHhhHhHhccccCcccccccCCcceEEEecccccccccchhhhcccccccceeecccc
Q psy3862         517 KTVQVPYRGDVNDTVQ-----DILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVGASK  591 (671)
Q Consensus       517 ~~v~i~~~Gdi~kAia-----vMlG~~~ag~~e~~g~~i~e~~~~a~fv~~~~~~~~~~~~~~~~~~G~~~~k~y~Gm~s  591 (671)
                      +   |+++|||+|||+     ||||+||||++|+||+++.                         .+| +++|.||||+|
T Consensus       221 G---i~~sGDI~KAlaaGAd~VMlGsllAGt~EsPGe~~~-------------------------~~G-~~~K~yrGMgS  271 (346)
T PRK05096        221 G---CTVPGDVAKAFGGGADFVMLGGMLAGHEESGGEIVE-------------------------ENG-EKFMLFYGMSS  271 (346)
T ss_pred             C---cccccHHHHHHHcCCCEEEeChhhcCcccCCCcEEE-------------------------ECC-EEEEEEecccc
Confidence            5   799999999999     9999999999999999522                         235 57899999999


Q ss_pred             ccccccc-cccchhccccccccCCCceEecccccCHHHHHHHHHHHHhhhccccCcccccccccccEEEEeccccccee
Q psy3862         592 LKELPRR-ATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNMY  669 (671)
Q Consensus       592 ~~a~~~~-~~~~r~~~~~~~~~~eG~~~~v~~kG~v~~~l~~l~gGLrs~m~y~Ga~~l~el~~~a~Fvrvt~q~n~~~  669 (671)
                      ..||+++ ++.+||      ++|||++.+||||||++++|++|+|||||+|+|+|+++|+|||+|++|||||+|+|+||
T Consensus       272 ~~Am~~~~g~~~ry------~~~EG~~~~Vp~kG~v~~~i~~l~gGlrs~m~Y~Ga~~i~el~~~a~fv~vt~q~n~~~  344 (346)
T PRK05096        272 ESAMKRHVGGVAEY------RAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQENRVF  344 (346)
T ss_pred             HHHHhhccCccccc------ccccCceEEeccCCcHHHHHHHHHHHHHHHHcccCcCcHHHHHhCCeEEEEChhhcccc
Confidence            9999853 444455      57999999999999999999999999999999999999999999999999999999998



>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>KOG0538|consensus Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>KOG0538|consensus Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>KOG3111|consensus Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
2a7r_A366 Crystal Structure Of Human Guanosine Monophosphate 1e-86
2a7r_A366 Crystal Structure Of Human Guanosine Monophosphate 1e-52
2a7r_A366 Crystal Structure Of Human Guanosine Monophosphate 5e-18
2bzn_A351 Crystal Structure Of Human Guanosine Monophosphate 4e-84
2bzn_A351 Crystal Structure Of Human Guanosine Monophosphate 1e-52
2bzn_A351 Crystal Structure Of Human Guanosine Monophosphate 1e-17
2ble_A367 Structure Of Human Guanosine Monophosphate Reductas 6e-82
2ble_A367 Structure Of Human Guanosine Monophosphate Reductas 4e-54
2ble_A367 Structure Of Human Guanosine Monophosphate Reductas 5e-19
3r2g_A361 Crystal Structure Of Inosine 5' Monophosphate Dehyd 3e-30
3r2g_A361 Crystal Structure Of Inosine 5' Monophosphate Dehyd 4e-05
1ypf_A336 Crystal Structure Of Guac (Ba5705) From Bacillus An 2e-23
1ypf_A336 Crystal Structure Of Guac (Ba5705) From Bacillus An 2e-18
1vrd_A494 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 2e-20
1vrd_A494 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 4e-07
4fo4_A366 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 3e-19
4fo4_A366 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 2e-14
3khj_A361 C. Parvum Inosine Monophosphate Dehydrogenase Bound 1e-18
3khj_A361 C. Parvum Inosine Monophosphate Dehydrogenase Bound 4e-08
4fez_A388 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 2e-17
4fez_A388 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 2e-14
1eep_A404 2.4 A Resolution Crystal Structure Of Borrelia Burg 2e-17
1eep_A404 2.4 A Resolution Crystal Structure Of Borrelia Burg 4e-15
3ffs_A400 The Crystal Structure Of Cryptosporidium Parvum Ino 3e-17
3ffs_A400 The Crystal Structure Of Cryptosporidium Parvum Ino 3e-12
3ffs_A400 The Crystal Structure Of Cryptosporidium Parvum Ino 7e-04
3tsb_A511 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 3e-17
3tsb_A511 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 8e-05
2cu0_A486 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 1e-16
2cu0_A486 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 6e-04
4avf_A490 Crystal Structure Of Pseudomonas Aeruginosa Inosine 1e-15
4avf_A490 Crystal Structure Of Pseudomonas Aeruginosa Inosine 3e-04
3zfh_A510 Crystal Structure Of Pseudomonas Aeruginosa Inosine 1e-15
3zfh_A510 Crystal Structure Of Pseudomonas Aeruginosa Inosine 2e-04
3usb_A511 Crystal Structure Of Bacillus Anthracis Inosine Mon 1e-15
3usb_A511 Crystal Structure Of Bacillus Anthracis Inosine Mon 8e-14
3usb_A511 Crystal Structure Of Bacillus Anthracis Inosine Mon 1e-04
1zfj_A491 Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1. 1e-13
1zfj_A491 Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1. 6e-04
1jr1_A514 Crystal Structure Of Inosine Monophosphate Dehydrog 2e-11
1b3o_A514 Ternary Complex Of Human Type-Ii Inosine Monophosph 2e-11
4fxs_A496 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 4e-11
4af0_A556 Crystal Structure Of Cryptococcal Inosine Monophosp 8e-11
4af0_A556 Crystal Structure Of Cryptococcal Inosine Monophosp 4e-08
4af0_B556 Crystal Structure Of Cryptococcal Inosine Monophosp 8e-11
4af0_B556 Crystal Structure Of Cryptococcal Inosine Monophosp 1e-08
1jcn_A514 Binary Complex Of Human Type-I Inosine Monophosphat 6e-09
1me8_A503 Inosine Monophosphate Dehydrogenase (Impdh) From Tr 5e-07
1me7_A503 Inosine Monophosphate Dehydrogenase (Impdh) From Tr 5e-07
1pvn_A376 The Crystal Structure Of The Complex Between Imp De 1e-06
1lrt_A376 Crystal Structure Of Ternary Complex Of Tritrichomo 1e-06
>pdb|2A7R|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 (Gmpr2) Length = 366 Back     alignment and structure

Iteration: 1

Score = 317 bits (812), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 156/268 (58%), Positives = 188/268 (70%), Gaps = 53/268 (19%) Query: 13 IINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEM 72 I ND+KLDFKDV+LRPKRSTLKSRSEVD+TR+F+FRNS +TY GVPIIAANMDTVGTFEM Sbjct: 22 IDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEM 81 Query: 73 AKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEI 132 AK L K LFT +HK+Y+L +W+ FA QNPD ++H+A SSG + D L++IL A+P++ Sbjct: 82 AKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQV 141 Query: 133 EYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPG 192 +YICLDVANGY++ FV+FV+ +R+ +P+H I+AGNVVTGEMVEELILSGAD+IKVGIGPG Sbjct: 142 KYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPG 201 Query: 193 SVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRL 252 SVCTTR K Sbjct: 202 SVCTTRKK---------------------------------------------------- 209 Query: 253 KTGVGYPQFSAVLECADAAHGLGGHIIS 280 TGVGYPQ SAV+ECADAAHGL GHIIS Sbjct: 210 -TGVGYPQLSAVMECADAAHGLKGHIIS 236
>pdb|2A7R|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 (Gmpr2) Length = 366 Back     alignment and structure
>pdb|2A7R|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 (Gmpr2) Length = 366 Back     alignment and structure
>pdb|2BZN|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 Gmpr2 In Complex With Imp Length = 351 Back     alignment and structure
>pdb|2BZN|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 Gmpr2 In Complex With Imp Length = 351 Back     alignment and structure
>pdb|2BZN|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 Gmpr2 In Complex With Imp Length = 351 Back     alignment and structure
>pdb|2BLE|A Chain A, Structure Of Human Guanosine Monophosphate Reductase Gmpr1 In Complex With Gmp Length = 367 Back     alignment and structure
>pdb|2BLE|A Chain A, Structure Of Human Guanosine Monophosphate Reductase Gmpr1 In Complex With Gmp Length = 367 Back     alignment and structure
>pdb|2BLE|A Chain A, Structure Of Human Guanosine Monophosphate Reductase Gmpr1 In Complex With Gmp Length = 367 Back     alignment and structure
>pdb|3R2G|A Chain A, Crystal Structure Of Inosine 5' Monophosphate Dehydrogenase From Legionella Pneumophila Length = 361 Back     alignment and structure
>pdb|3R2G|A Chain A, Crystal Structure Of Inosine 5' Monophosphate Dehydrogenase From Legionella Pneumophila Length = 361 Back     alignment and structure
>pdb|1YPF|A Chain A, Crystal Structure Of Guac (Ba5705) From Bacillus Anthracis At 1.8 A Resolution Length = 336 Back     alignment and structure
>pdb|1YPF|A Chain A, Crystal Structure Of Guac (Ba5705) From Bacillus Anthracis At 1.8 A Resolution Length = 336 Back     alignment and structure
>pdb|1VRD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase (Tm1347) From Thermotoga Maritima At 2.18 A Resolution Length = 494 Back     alignment and structure
>pdb|1VRD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase (Tm1347) From Thermotoga Maritima At 2.18 A Resolution Length = 494 Back     alignment and structure
>pdb|4FO4|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae, Deletion Mutant, Complexed With Imp And Mycophenolic Acid Length = 366 Back     alignment and structure
>pdb|4FO4|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae, Deletion Mutant, Complexed With Imp And Mycophenolic Acid Length = 366 Back     alignment and structure
>pdb|3KHJ|A Chain A, C. Parvum Inosine Monophosphate Dehydrogenase Bound By Inhibitor C64 Length = 361 Back     alignment and structure
>pdb|3KHJ|A Chain A, C. Parvum Inosine Monophosphate Dehydrogenase Bound By Inhibitor C64 Length = 361 Back     alignment and structure
>pdb|4FEZ|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae, Deletion Mutant Length = 388 Back     alignment and structure
>pdb|4FEZ|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae, Deletion Mutant Length = 388 Back     alignment and structure
>pdb|1EEP|A Chain A, 2.4 A Resolution Crystal Structure Of Borrelia Burgdorferi Inosine 5'- Monphosphate Dehydrogenase In Complex With A Sulfate Ion Length = 404 Back     alignment and structure
>pdb|1EEP|A Chain A, 2.4 A Resolution Crystal Structure Of Borrelia Burgdorferi Inosine 5'- Monphosphate Dehydrogenase In Complex With A Sulfate Ion Length = 404 Back     alignment and structure
>pdb|3FFS|A Chain A, The Crystal Structure Of Cryptosporidium Parvum Inosine-5'- Monophosphate Dehydrogenase Length = 400 Back     alignment and structure
>pdb|3FFS|A Chain A, The Crystal Structure Of Cryptosporidium Parvum Inosine-5'- Monophosphate Dehydrogenase Length = 400 Back     alignment and structure
>pdb|3FFS|A Chain A, The Crystal Structure Of Cryptosporidium Parvum Inosine-5'- Monophosphate Dehydrogenase Length = 400 Back     alignment and structure
>pdb|3TSB|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Bacillus Anthracis Str. Ames Length = 511 Back     alignment and structure
>pdb|3TSB|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Bacillus Anthracis Str. Ames Length = 511 Back     alignment and structure
>pdb|2CU0|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 486 Back     alignment and structure
>pdb|2CU0|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 486 Back     alignment and structure
>pdb|4AVF|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Inosine 5'- Monophosphate Dehydrogenase Length = 490 Back     alignment and structure
>pdb|4AVF|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Inosine 5'- Monophosphate Dehydrogenase Length = 490 Back     alignment and structure
>pdb|3ZFH|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Inosine 5'-monophosphate Dehydrogenase Length = 510 Back     alignment and structure
>pdb|3ZFH|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Inosine 5'-monophosphate Dehydrogenase Length = 510 Back     alignment and structure
>pdb|3USB|A Chain A, Crystal Structure Of Bacillus Anthracis Inosine Monophosphate Dehydrogenase In The Complex With Imp Length = 511 Back     alignment and structure
>pdb|3USB|A Chain A, Crystal Structure Of Bacillus Anthracis Inosine Monophosphate Dehydrogenase In The Complex With Imp Length = 511 Back     alignment and structure
>pdb|3USB|A Chain A, Crystal Structure Of Bacillus Anthracis Inosine Monophosphate Dehydrogenase In The Complex With Imp Length = 511 Back     alignment and structure
>pdb|1ZFJ|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1.1.205) From Streptococcus Pyogenes Length = 491 Back     alignment and structure
>pdb|1ZFJ|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1.1.205) From Streptococcus Pyogenes Length = 491 Back     alignment and structure
>pdb|1JR1|A Chain A, Crystal Structure Of Inosine Monophosphate Dehydrogenase In Complex With Mycophenolic Acid Length = 514 Back     alignment and structure
>pdb|1B3O|A Chain A, Ternary Complex Of Human Type-Ii Inosine Monophosphate Dehydrogenase With 6-Cl-Imp And Selenazole Adenine Dinucleotide Length = 514 Back     alignment and structure
>pdb|4FXS|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae Complexed With Imp And Mycophenolic Acid Length = 496 Back     alignment and structure
>pdb|4AF0|A Chain A, Crystal Structure Of Cryptococcal Inosine Monophosphate Dehydrogenase Length = 556 Back     alignment and structure
>pdb|4AF0|A Chain A, Crystal Structure Of Cryptococcal Inosine Monophosphate Dehydrogenase Length = 556 Back     alignment and structure
>pdb|4AF0|B Chain B, Crystal Structure Of Cryptococcal Inosine Monophosphate Dehydrogenase Length = 556 Back     alignment and structure
>pdb|4AF0|B Chain B, Crystal Structure Of Cryptococcal Inosine Monophosphate Dehydrogenase Length = 556 Back     alignment and structure
>pdb|1JCN|A Chain A, Binary Complex Of Human Type-I Inosine Monophosphate Dehydrogenase With 6-Cl-Imp Length = 514 Back     alignment and structure
>pdb|1ME8|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh) From Tritrichomonas Foetus With Rvp Bound Length = 503 Back     alignment and structure
>pdb|1ME7|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh) From Tritrichomonas Foetus With Rvp And Moa Bound Length = 503 Back     alignment and structure
>pdb|1PVN|A Chain A, The Crystal Structure Of The Complex Between Imp Dehydrogenase Catalytic Domain And A Transition State Analogue Mzp Length = 376 Back     alignment and structure
>pdb|1LRT|A Chain A, Crystal Structure Of Ternary Complex Of Tritrichomonas Foetus Inosine-5'-Monophosphate Dehydrogenase: Structural Characterization Of Nad+ Site In Microbial Enzyme Length = 376 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 1e-105
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 2e-67
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 5e-39
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 3e-21
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 5e-18
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 2e-82
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 5e-51
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 4e-29
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 3e-16
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 7e-16
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 6e-73
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 2e-58
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 2e-23
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 5e-18
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 2e-16
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 1e-30
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 6e-27
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 5e-08
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 2e-28
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 2e-27
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 4e-08
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 2e-27
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 1e-25
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 7e-09
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 6e-08
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 7e-27
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 2e-21
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 1e-08
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 2e-06
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 3e-04
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 3e-04
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 1e-26
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 2e-22
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 2e-09
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 8e-08
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 6e-06
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 6e-06
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 3e-26
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 7e-26
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 6e-09
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 6e-08
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 1e-25
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 3e-23
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 5e-09
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 6e-08
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 2e-25
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 4e-21
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 6e-09
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 5e-08
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 5e-04
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 5e-04
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 2e-25
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 3e-23
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 5e-09
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 6e-08
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 2e-04
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 7e-04
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 2e-25
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 3e-23
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 5e-09
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 5e-08
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 3e-04
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 3e-04
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 4e-25
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 1e-22
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 5e-09
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 9e-08
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 2e-24
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 2e-22
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 2e-06
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 2e-05
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 2e-04
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 2e-05
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 8e-05
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 2e-04
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 8e-04
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
 Score =  323 bits (829), Expect = e-105
 Identities = 152/268 (56%), Positives = 185/268 (69%), Gaps = 53/268 (19%)

Query: 13  IINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEM 72
           ++    LDFKDV+LRPKRSTLKSRSEVD+TR+F+FRNS +TY GVPIIAANMDTVGTFEM
Sbjct: 14  LVPRGSLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEM 73

Query: 73  AKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVAVSSGISAKDLAGLKEILAALPEI 132
           AK L K  LFT +HK+Y+L +W+ FA QNPD ++H+A SSG  + D   L++IL A+P++
Sbjct: 74  AKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQV 133

Query: 133 EYICLDVANGYTQTFVDFVRRIREMYPKHVIIAGNVVTGEMVEELILSGADVIKVGIGPG 192
           +YICLDVANGY++ FV+FV+ +R+ +P+H I+AGNVVTGEMVEELILSGAD+IKVGIGPG
Sbjct: 134 KYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPG 193

Query: 193 SVCTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRL 252
           SV                                                     CTTR 
Sbjct: 194 SV-----------------------------------------------------CTTRK 200

Query: 253 KTGVGYPQFSAVLECADAAHGLGGHIIS 280
           KTGVGYPQ SAV+ECADAAHGL GHIIS
Sbjct: 201 KTGVGYPQLSAVMECADAAHGLKGHIIS 228


>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4fez_A Length = 366 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4fez_A Length = 366 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4fez_A Length = 366 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Length = 361 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Length = 361 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Length = 361 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Length = 393 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Length = 393 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Length = 393 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Length = 393 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Length = 223 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Length = 223 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Length = 332 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Length = 234 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Length = 232 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query671
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 100.0
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 100.0
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 100.0
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 100.0
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 100.0
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 100.0
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 100.0
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 100.0
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 100.0
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 100.0
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 100.0
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 100.0
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 100.0
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 100.0
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 100.0
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 100.0
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 100.0
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 100.0
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 100.0
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 100.0
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 100.0
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 99.98
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.97
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.97
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 99.97
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 99.97
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 99.95
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.92
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.9
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.89
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.89
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 99.81
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.81
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.8
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 99.59
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.56
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.41
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 99.35
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.28
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.25
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.22
1ea0_A1479 Glutamate synthase [NADPH] large chain; oxidoreduc 99.2
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.16
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.12
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.11
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.1
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.03
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.01
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 98.98
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 98.98
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 98.96
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 98.93
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 98.92
1ofd_A1520 Ferredoxin-dependent glutamate synthase 2; oxidore 98.85
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 98.81
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.7
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 98.69
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 98.68
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 98.66
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 98.64
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 98.61
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 98.59
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 98.43
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 98.37
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 98.29
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 98.28
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 98.2
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.18
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 98.09
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 98.09
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 98.04
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 98.03
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.97
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 97.88
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 97.81
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 97.57
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 97.55
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 97.54
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.49
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 97.27
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 97.24
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 97.23
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.19
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.19
1ofd_A1520 Ferredoxin-dependent glutamate synthase 2; oxidore 97.16
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.11
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.1
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.08
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.08
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 97.06
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 97.06
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.04
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 97.04
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 97.0
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 97.0
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 96.92
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.88
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 96.79
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 96.74
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 96.72
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 96.69
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 96.65
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 96.64
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.62
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 96.6
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 96.52
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 96.52
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 96.43
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 96.3
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 96.22
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 96.2
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.18
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.08
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.95
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 95.95
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 95.81
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 95.55
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.55
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 95.53
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 95.48
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 95.26
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 95.17
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 95.09
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 95.02
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 94.9
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 94.89
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.87
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 94.81
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 94.78
3tha_A252 Tryptophan synthase alpha chain; structural genomi 94.75
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 94.62
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 94.59
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.57
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 94.45
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 94.44
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 94.23
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 94.18
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 94.08
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 94.01
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 93.81
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 93.65
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 93.64
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 93.59
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 93.5
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 93.46
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 93.43
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 93.41
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 93.33
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 93.11
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 93.09
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 93.0
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 92.97
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 92.95
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 92.8
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 92.74
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 92.59
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 92.58
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 92.56
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 92.53
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 92.52
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 92.47
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 92.4
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 92.4
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 92.23
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 92.07
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 92.05
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 92.03
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 91.98
3oa3_A288 Aldolase; structural genomics, seattle structural 91.95
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 91.32
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 91.26
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 91.2
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 91.12
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 91.05
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 90.77
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 90.73
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 90.71
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 90.59
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 90.57
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 90.53
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 90.5
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 90.34
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 90.29
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 90.22
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 90.18
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 89.92
1ujp_A271 Tryptophan synthase alpha chain; riken structural 89.89
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 89.84
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 89.83
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 89.66
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 89.57
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 88.86
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 88.65
1viz_A240 PCRB protein homolog; structural genomics, unknown 88.52
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 88.06
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 87.96
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 87.88
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 87.57
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 87.24
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 87.21
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 87.06
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 86.77
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 86.66
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 86.63
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 86.61
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 86.61
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 86.37
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 85.89
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 85.89
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 85.84
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 85.75
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 85.42
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 84.99
1ujp_A271 Tryptophan synthase alpha chain; riken structural 84.99
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 84.57
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 84.57
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 84.51
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 84.1
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 84.09
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 83.99
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 83.87
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 83.74
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 83.72
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 83.66
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 83.62
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 83.53
3ble_A337 Citramalate synthase from leptospira interrogans; 83.52
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 83.39
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 83.32
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 82.79
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 82.55
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 82.32
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 82.06
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 81.09
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 80.89
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 80.55
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 80.45
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 80.39
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 80.38
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
Probab=100.00  E-value=1.5e-75  Score=645.82  Aligned_cols=393  Identities=30%  Similarity=0.437  Sum_probs=289.6

Q ss_pred             cCCCCCceEEecCCcCCCCCCcceeeeeeecccCCCcccCceEEecCCCccccHHHHHHHHHcCCeEEeecCCCHHHHHH
Q psy3862          17 IKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKA   96 (671)
Q Consensus        17 ~~l~fdDv~lvP~~~~~~~~~~Vdlst~lt~r~~~~~~l~~Piv~a~M~~vt~~~lA~Ala~~gglgvIh~n~~~Eeq~~   96 (671)
                      .+||||||+|+|++++++| ++|||+|+||    ++++|++||++++||+||+.+||+|||++||||+||+||++|+|++
T Consensus        58 ~GLTfDDVlLvP~~s~v~p-~~Vdl~t~lt----~~i~L~iPlvSA~MDTVTe~~MAIamAr~GGiGvIH~n~sie~Qa~  132 (556)
T 4af0_A           58 GGLTYNDFLVLPGHINFPA-SDVSLQSKAT----KNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNCSAEEQAA  132 (556)
T ss_dssp             CSCCGGGEEECCCCCCSCG-GGCCCCEEEE----TTEEESSCEEECCCTTTCSHHHHHHHHHTTCEEEECCSSCHHHHHH
T ss_pred             CCCChhhEEEccCCCCCCc-ccceeeeecc----CCcEeCCCEEecCcccccCHHHHHHHHHCCCeEEEcCCCCHHHHHH
Confidence            5899999999999999987 5999999999    7999999999999999999999999999999999999999999988


Q ss_pred             hhhc----------Ccccccc------e-------EEe--------------cC-CChhhH------HHHHHHHHhCCC-
Q psy3862          97 FAVQ----------NPDVIKH------V-------AVS--------------SG-ISAKDL------AGLKEILAALPE-  131 (671)
Q Consensus        97 ~i~~----------~p~~~~~------~-------~v~--------------~G-~~~~d~------~rl~~l~~a~~~-  131 (671)
                      ++++          +|.++.|      +       .++              .| ++.+|+      ..+.++|+.... 
T Consensus       133 ~V~~VKr~e~g~i~dPvtl~P~~Tv~da~~l~~~~~isgvpVvd~g~~~~kLvGIvT~RD~rf~d~~~~V~evMT~~lvt  212 (556)
T 4af0_A          133 MVRRVKKYENGFITDPLCLGPDATVGDVLEIKAKFGFCGVPITETGEPDSKLLGIVTGRDVQFQDAETPIKSVMTTEVVT  212 (556)
T ss_dssp             HHHHHHHCCC----------------------------------------------------------------------
T ss_pred             HHHHHHhcccCccCCCeEcCCCCCHHHHHHHHHHhCCCccccccccCcCCEEEEEEecccccccccceEhhhhcccceEE
Confidence            8742          2222111      0       000              11 111121      123333332000 


Q ss_pred             -ceEEEeeccCCCC--------------hHHHH--HHHHHH--HhCCCce--------EEEEEec----cHHHHHHHHHC
Q psy3862         132 -IEYICLDVANGYT--------------QTFVD--FVRRIR--EMYPKHV--------IIAGNVV----TGEMVEELILS  180 (671)
Q Consensus       132 -~d~Ivld~a~G~~--------------~~~~~--~ik~lr--~~~P~~~--------li~g~v~----t~e~a~~Li~A  180 (671)
                       ..-+.++.++...              .+++-  .++++.  +.||++.        .+++++.    +.+++++|++|
T Consensus       213 ~~~~~~leeA~~iL~~~kieklpVVd~~g~LvGlIT~kDi~k~~~~p~A~k~d~~grL~VgAAVgv~~d~~eR~~aLv~A  292 (556)
T 4af0_A          213 GSSPITLEKANSLLRETKKGKLPIVDSNGHLVSLVARSDLLKNQNYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEA  292 (556)
T ss_dssp             ---------------------------------------------CTTCCBCTTTCCBCCEEEECSSHHHHHHHHHHHHT
T ss_pred             ecCCCCHHHHHHHHHHccccceeEEccCCcEEEEEEechhhhhhhCCcchhcchhhceeeEEEeccCccHHHHHHHHHhc
Confidence             0001122221110              01111  124442  3588764        3566665    36899999999


Q ss_pred             CCcEEEECcCCCce-----EEEEecccCCcchhhhhccccCCccccccHHHHHHHHHcCCCEEEEcccCCCccccceecc
Q psy3862         181 GADVIKVGIGPGSV-----CTTRLKNKTSDFFLIQFYSCIPQAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRLKTG  255 (671)
Q Consensus       181 GaD~IvVdga~G~~-----~~t~v~~~~~~~~~i~~i~~~p~aGnV~t~~~a~~li~aGAdgvkVG~~~~~~~~Tr~V~g  255 (671)
                      |+|+|++|++|||+     .++.+++.+|++++        +||||+|++++++|+++|||+|||||||||+||||+|+|
T Consensus       293 GvD~iviD~ahGhs~~v~~~i~~ik~~~p~~~v--------iaGNVaT~e~a~~Li~aGAD~vkVGiGpGSiCtTr~v~G  364 (556)
T 4af0_A          293 GLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDV--------IAGNVVTREQAAQLIAAGADGLRIGMGSGSICITQEVMA  364 (556)
T ss_dssp             TCCEEEECCSCCCSHHHHHHHHHHHHHCTTSEE--------EEEEECSHHHHHHHHHHTCSEEEECSSCSTTBCCTTTCC
T ss_pred             CCcEEEEeccccccHHHHHHHHHHHhhCCcceE--------EeccccCHHHHHHHHHcCCCEEeecCCCCcccccccccC
Confidence            99999999999996     23345555555433        699999999999999999999999999999999999999


Q ss_pred             cCcchhhhHHHHHHHhhhcCCcchhhhhhccceeeccccCCCceeeeecCCCccCCCCcccceeeeeeccCCceeeCcce
Q psy3862         256 VGYPQFSAVLECADAAHGLGGHIISFLTAMAQKIINDIKLDFKDVMLRPKRSTLKSRSEVDITRTFTFRNSGKTYQGVPI  335 (671)
Q Consensus       256 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~l~fdDVll~P~rst~~sr~eVdl~~~l~~~~s~~~~~~iPi  335 (671)
                      +|+||+|||+|||++|+++                                                         ++||
T Consensus       365 vG~PQ~tAi~~~a~~a~~~---------------------------------------------------------~vpv  387 (556)
T 4af0_A          365 VGRPQGTAVYAVAEFASRF---------------------------------------------------------GIPC  387 (556)
T ss_dssp             SCCCHHHHHHHHHHHHGGG---------------------------------------------------------TCCE
T ss_pred             CCCcHHHHHHHHHHHHHHc---------------------------------------------------------CCCE
Confidence            9999999999999999875                                                         4666


Q ss_pred             EecCCCCCCCHHHHHHHHHcCCeEEEccCCCHHHHHHHHhcCcccccceeeecccChhhHHHHHHcCCcEEEEccccccc
Q psy3862         336 IAANMDTVGTFEMAKHLAKHGLFTTIHKYYTLEEWKAFAVQNPDVIKHVADGGCTSPGDVAKAMGAGADFVMLGGMFAGH  415 (671)
Q Consensus       336 Iaa~MDtV~~~~mA~~la~~Gglgvihr~~~~e~~~~~v~~~~~~~~~v~~~~~~~~~~~~~l~~aG~d~i~id~~a~gh  415 (671)
                      ||                                                                              
T Consensus       388 IA------------------------------------------------------------------------------  389 (556)
T 4af0_A          388 IA------------------------------------------------------------------------------  389 (556)
T ss_dssp             EE------------------------------------------------------------------------------
T ss_pred             Ee------------------------------------------------------------------------------
Confidence            66                                                                              


Q ss_pred             cccccccccccccccccccccccccCceeeccccCchhHHHHHHcCCcEEEECccccCCccCCCcEEEeCCeEEEEeeCc
Q psy3862         416 DQSGGELTNIEYMFFPLVGDMNSYLGGVVDGGCTSPGDVAKAMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGM  495 (671)
Q Consensus       416 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~gG~v~t~~~a~~l~aGAd~V~vG~~g~G~s~ctt~~v~~~g~~~k~g~G~  495 (671)
                                                   +||+..+++++|++.+|||+||+|.+++|+.++|++.+..+|.++|.|+||
T Consensus       390 -----------------------------DGGI~~sGDi~KAlaaGAd~VMlGsllAGt~EsPGe~~~~~G~~~K~YrGM  440 (556)
T 4af0_A          390 -----------------------------DGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGM  440 (556)
T ss_dssp             -----------------------------ESCCCSHHHHHHHHHTTCSEEEESTTTTTBTTSSSCCEEETTEEEEEEECT
T ss_pred             -----------------------------cCCcCcchHHHHHhhcCCCEEEEchhhccccCCCCcEEEECCEEEEeeccc
Confidence                                         899999999999999999999999999999999999999999999999999


Q ss_pred             ccHHHHHhhccccccccccCCceEeeecCCCHHHHHHHHHhhHhHhccccCcccccccCCcceEEEecccccccccchhh
Q psy3862         496 SSTTAMDKHAGGVAEYRAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQD  575 (671)
Q Consensus       496 ~q~tAi~~~a~~~~~y~~~~G~~v~i~~~Gdi~kAiavMlG~~~ag~~e~~g~~i~e~~~~a~fv~~~~~~~~~~~~~~~  575 (671)
                      +|+.||.+.....     .+|..                                                         
T Consensus       441 gS~~Am~~~~~~~-----~~~~~---------------------------------------------------------  458 (556)
T 4af0_A          441 GSIEAMEHTQRGS-----ASGKR---------------------------------------------------------  458 (556)
T ss_dssp             TSHHHHTTC-----------------------------------------------------------------------
T ss_pred             ccHHHHHhcccCC-----ccccc---------------------------------------------------------
Confidence            9999997521100     00000                                                         


Q ss_pred             hcccccccceeeccccccccccccccchhcccc-ccccCCCceEecccccCHHHHHHHHHHHHhhhccccCccccccccc
Q psy3862         576 ILGGLRSACTYVGASKLKELPRRATFIRCTAQL-NNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPR  654 (671)
Q Consensus       576 ~~~G~~~~k~y~Gm~s~~a~~~~~~~~r~~~~~-~~~~~eG~~~~v~~kG~v~~~l~~l~gGLrs~m~y~Ga~~l~el~~  654 (671)
                               .+.+.       ...+.+|||.+. ++++|||++++|||||||+++|+||+|||||+|+|+|+++|+|||+
T Consensus       459 ---------~~~~~-------~~~s~dRyfq~~~~~~v~EGveg~VpykG~v~~~i~~l~gGlrs~m~y~Ga~~i~el~~  522 (556)
T 4af0_A          459 ---------SILGL-------DNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSLQDAAIKSVSELHS  522 (556)
T ss_dssp             ------------CC-------SCSSEEECCCBSSSSCBCCBCEEEEECCBCHHHHHHHHHHHHHHHHHHTTCSSHHHHHH
T ss_pred             ---------ccccc-------cccchhhhcccccccccCCccEEeccCCCcHHHHHHHHHHHHHHhhhccCCCcHHHHHH
Confidence                     00000       122356777654 5689999999999999999999999999999999999999999999


Q ss_pred             cc-----EEEEeccc
Q psy3862         655 RA-----TFIRCTAQ  664 (671)
Q Consensus       655 ~a-----~Fvrvt~q  664 (671)
                      ++     +|+|+|.+
T Consensus       523 ~a~~g~~rf~~iT~a  537 (556)
T 4af0_A          523 CARSGSLRFELRTAS  537 (556)
T ss_dssp             HHHHTCSCEEECCCC
T ss_pred             hhhccCceEEEEChh
Confidence            98     99999975



>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 671
d1pvna1362 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate d 5e-60
d1pvna1362 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate d 2e-37
d1zfja1365 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate d 2e-59
d1zfja1365 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate d 1e-39
d2cu0a1368 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate d 8e-57
d2cu0a1368 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate d 7e-33
d1vrda1330 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate d 1e-52
d1vrda1330 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate d 2e-41
d1jr1a1378 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate 3e-43
d1jr1a1378 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate 2e-41
d1eepa_388 c.1.5.1 (A:) Inosine monophosphate dehydrogenase ( 6e-43
d1eepa_388 c.1.5.1 (A:) Inosine monophosphate dehydrogenase ( 3e-34
d1p0ka_329 c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera 3e-11
d1p0ka_329 c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera 2e-09
d1vcfa1310 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i 3e-09
d1vcfa1310 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i 2e-05
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 1e-06
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 5e-05
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 0.001
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 1e-05
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 9e-05
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 2e-04
d1kbia1414 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal 7e-05
d1p4ca_353 c.1.4.1 (A:) Membrane-associated (S)-mandelate deh 1e-04
d1ea0a2771 c.1.4.1 (A:423-1193) Alpha subunit of glutamate sy 1e-04
d1ofda2809 c.1.4.1 (A:431-1239) Alpha subunit of glutamate sy 8e-04
d1tb3a1349 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus 0.002
d1djqa1340 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N- 0.004
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Length = 362 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Inosine monophosphate dehydrogenase (IMPDH)
family: Inosine monophosphate dehydrogenase (IMPDH)
domain: Inosine monophosphate dehydrogenase (IMPDH)
species: Tritrichomonas foetus [TaxId: 5724]
 Score =  203 bits (517), Expect = 5e-60
 Identities = 71/348 (20%), Positives = 115/348 (33%), Gaps = 72/348 (20%)

Query: 288 KIINDIKLDFKDVMLRPKRSTLKS-RSEVDITRTFT---FRNSGKTYQGVPIIAANMDTV 343
           K  N+    F + +L P  ST+    S V+++            +    +P+++A M +V
Sbjct: 2   KYYNEPCHTFNEYLLIPGLSTVDCIPSNVNLSTPLVKFQKGQQSEINLKIPLVSAIMQSV 61

Query: 344 GTFEMAKHLAKHGLFTTIHKYYTLEEW---------------------------KAFAVQ 376
              +MA  LA+ G  + I    ++E                              A    
Sbjct: 62  SGEKMAIALAREGGISFIFGSQSIESQAAMVHAVKNFRYLVGAGINTRDFRERVPALVEA 121

Query: 377 NPDVIK--------------------------HVADGGCTSPGDVAKAMGAGADFVMLGG 410
             DV+                            V  G             AGADF+ +G 
Sbjct: 122 GADVLCIDSSDGFSEWQKITIGWIREKYGDKVKVGAGNIVDGEGFRYLADAGADFIKIGI 181

Query: 411 MFAGHDQSGGELTNIEYMFFPLVGD-----------MNSYLGGVVDGGCTSPGDVAKAMG 459
                     E   I       V D              Y+    DGG      +  A+ 
Sbjct: 182 GGGSI-CITREQKGIGRGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVYDYHMTLALA 240

Query: 460 AGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKH---AGGVAEYRAAEG 516
            GADF+MLG  FA  ++S    +  +G  +K ++G  S+ A +      GG  +    EG
Sbjct: 241 MGADFIMLGRYFARFEESPTRKVTINGSVMKEYWGEGSSRARNWQRYDLGGKQKLSFEEG 300

Query: 517 KTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTA 564
               VPY G + D V+  L  ++S     GA  + +L  +A     ++
Sbjct: 301 VDSYVPYAGKLKDNVEASLNKVKSTMCNCGALTIPQLQSKAKITLVSS 348


>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Length = 362 Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 365 Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 365 Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Length = 368 Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Length = 368 Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Length = 330 Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Length = 330 Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 378 Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 378 Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Length = 388 Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Length = 388 Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 414 Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 353 Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Length = 771 Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Length = 809 Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 349 Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 340 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query671
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 100.0
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 99.77
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 99.73
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 99.43
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 98.77
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 98.76
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 98.74
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 98.61
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 98.49
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 98.42
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 98.24
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.19
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.07
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 97.96
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 97.95
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 97.72
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 97.57
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.43
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.01
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.56
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.47
d1ofda2809 Alpha subunit of glutamate synthase, central and F 96.17
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 96.09
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 95.95
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 95.75
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 95.67
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 95.65
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 95.42
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 95.34
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 95.13
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 95.09
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 94.23
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 94.2
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 94.18
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 94.16
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 93.68
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 93.27
d1ofda2809 Alpha subunit of glutamate synthase, central and F 92.31
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 92.3
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 91.83
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 90.89
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 90.1
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 89.04
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 88.71
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 88.45
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 88.29
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 88.07
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 87.89
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 87.24
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 87.03
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 86.53
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 86.2
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 86.05
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 85.57
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 85.38
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 85.33
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 84.67
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 84.27
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 83.75
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 82.61
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 82.2
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 82.12
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 82.04
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 80.92
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Inosine monophosphate dehydrogenase (IMPDH)
family: Inosine monophosphate dehydrogenase (IMPDH)
domain: Inosine monophosphate dehydrogenase (IMPDH)
species: Tritrichomonas foetus [TaxId: 5724]
Probab=100.00  E-value=4.5e-76  Score=632.81  Aligned_cols=329  Identities=20%  Similarity=0.206  Sum_probs=280.8

Q ss_pred             eeeccccCCCceeeeecCCCccCC-CCcccceeeeeec---cCCceeeCcceEecCCCCCCCHHHHHHHHHcCCeEEEcc
Q psy3862         288 KIINDIKLDFKDVMLRPKRSTLKS-RSEVDITRTFTFR---NSGKTYQGVPIIAANMDTVGTFEMAKHLAKHGLFTTIHK  363 (671)
Q Consensus       288 ~i~~~~~l~fdDVll~P~rst~~s-r~eVdl~~~l~~~---~s~~~~~~iPiIaa~MDtV~~~~mA~~la~~Gglgvihr  363 (671)
                      ||.++.+||||||||+|+|||++| |+||||+|+|+|.   +++.+++++|||||||||||+++||++|+++||||+|||
T Consensus         2 ~~~~e~~ltFdDVlLvP~~Sti~s~r~dVdl~~~l~~~~~~~~~~i~l~iPIIsAnMDTVt~~~mA~~la~~GglgvihR   81 (362)
T d1pvna1           2 KYYNEPCHTFNEYLLIPGLSTVDCIPSNVNLSTPLVKFQKGQQSEINLKIPLVSAIMQSVSGEKMAIALAREGGISFIFG   81 (362)
T ss_dssp             EECSSCBCCGGGEEECCCCBCTTCCGGGCBCCEECSCEETTSCCSCEESSSEEECSCTTTCSHHHHHHHHHTTCEEEECC
T ss_pred             ccccCCCCCccceEEeCCCCcCCCCccceeeeeEEEeeccccccccccCCcEEecCCCCcCCHHHHHHHHHCCCEEEEee
Confidence            678899999999999999999997 9999999998753   556789999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHhcCcccccceeeecccCh--hhHHHHHHcCCcEEEEccccccccccccccccccccccc-ccccccccc
Q psy3862         364 YYTLEEWKAFAVQNPDVIKHVADGGCTSP--GDVAKAMGAGADFVMLGGMFAGHDQSGGELTNIEYMFFP-LVGDMNSYL  440 (671)
Q Consensus       364 ~~~~e~~~~~v~~~~~~~~~v~~~~~~~~--~~~~~l~~aG~d~i~id~~a~gh~~~~~~~~~~~~~~~~-~~~~~~~~~  440 (671)
                      |+++|+|.+++.+.++....+...+...+  ++.+.++++|+|+|||| ++|||++++.++++.++..+| .+       
T Consensus        82 ~~~ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~ag~d~i~ID-vAhG~~~~v~~~i~~ir~~~~~~~-------  153 (362)
T d1pvna1          82 SQSIESQAAMVHAVKNFRYLVGAGINTRDFRERVPALVEAGADVLCID-SSDGFSEWQKITIGWIREKYGDKV-------  153 (362)
T ss_dssp             SSCHHHHHHHHHHHHTCCCCCEEEECSSSHHHHHHHHHHHTCSEEEEC-CSCCCBHHHHHHHHHHHHHHGGGS-------
T ss_pred             cCCHHHHHHHhhhhhhcccccccccchhhhHHHHHHHhhcCceEEeec-hhccchhHHHHHHHHHHHhhccce-------
Confidence            99999999999876543222333333322  44566789999999999 999999999998877765442 22       


Q ss_pred             CceeeccccCchhHHH-HHHcCCcEEEECccccCCccCCCcEEEeCCeEEEEeeCcccHHHHHhhccccccccccCCceE
Q psy3862         441 GGVVDGGCTSPGDVAK-AMGAGADFVMLGGMFAGHDQSGGELIEKDGKKVKLFYGMSSTTAMDKHAGGVAEYRAAEGKTV  519 (671)
Q Consensus       441 ~~~i~gG~v~t~~~a~-~l~aGAd~V~vG~~g~G~s~ctt~~v~~~g~~~k~g~G~~q~tAi~~~a~~~~~y~~~~G~~v  519 (671)
                        .|++|||+|+++++ ++++|||+|+||+ ||| |+||||.+        +|+|+||+||+.+|+.++.+|..+.|+++
T Consensus       154 --~IiAGNVaT~e~~~~L~~aGaD~vkVGI-G~G-s~CTTr~~--------tGvG~Pq~sAv~e~a~~~~~~~~~~~~~v  221 (362)
T d1pvna1         154 --KVGAGNIVDGEGFRYLADAGADFIKIGI-GGG-SICITREQ--------KGIGRGQATAVIDVVAERNKYFEETGIYI  221 (362)
T ss_dssp             --CEEEEEECSHHHHHHHHHHTCSEEEECS-SCS-TTBCHHHH--------TCBCCCHHHHHHHHHHHHHHHHHHHSEEC
T ss_pred             --eeecccccCHHHHHHHHHhCCcEEEecc-ccc-ccccchhh--------hccCCchHHHHHHHHHHHHHhhhhcccCC
Confidence              36899999999999 6799999999996 999 99999875        68999999999999998888866666666


Q ss_pred             e------eecCCCHHHHHH-----HHHhhHhHhccccCcccccccCCcceEEEecccccccccchhhhcccccccceeec
Q psy3862         520 Q------VPYRGDVNDTVQ-----DILGGLRSACTYVGASKLKELPRRATFIRCTAQLNNVNDTVQDILGGLRSACTYVG  588 (671)
Q Consensus       520 ~------i~~~Gdi~kAia-----vMlG~~~ag~~e~~g~~i~e~~~~a~fv~~~~~~~~~~~~~~~~~~G~~~~k~y~G  588 (671)
                      +      |+++|||+|||+     ||||++|||++|+||+.++.                         +| +.+|.|||
T Consensus       222 ~iiaDGGi~~~gdi~KAla~GAd~VM~G~~lAg~~Espg~~~~~-------------------------~g-~~~k~~~G  275 (362)
T d1pvna1         222 PVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESPTRKVTI-------------------------NG-SVMKEYWG  275 (362)
T ss_dssp             CEEEESCCCSHHHHHHHHHTTCSEEEESHHHHTBTTSSSCEEEE-------------------------TT-EEEEEEEC
T ss_pred             ceeeccccCcccceeEEEEEeccceeehhhhhcccccCCcceee-------------------------cc-ceeeeeec
Confidence            5      699999999999     99999999999999995331                         23 46789999


Q ss_pred             cccccccccccccchhccccccccCCCceEecccccCHHHHHHHHHHHHhhhccccCcccccccccccEEEEeccc
Q psy3862         589 ASKLKELPRRATFIRCTAQLNNVAAEGKTVQVPYRGDVNDTVQDILGGLRSACTYVGASKLKELPRRATFIRCTAQ  664 (671)
Q Consensus       589 m~s~~a~~~~~~~~r~~~~~~~~~~eG~~~~v~~kG~v~~~l~~l~gGLrs~m~y~Ga~~l~el~~~a~Fvrvt~q  664 (671)
                      |+|..||.+++....  ...++++|||+++.||||||++++|++|+|||||+|+|+|+++|+|||+|++|+|+|.+
T Consensus       276 m~S~~a~~~~~~~~~--~~~~~~~~eG~~~~v~~~g~~~~~~~~l~gglrs~~~y~G~~~l~~~~~~~~f~~~t~~  349 (362)
T d1pvna1         276 EGSSRARNWQRYDLG--GKQKLSFEEGVDSYVPYAGKLKDNVEASLNKVKSTMCNCGALTIPQLQSKAKITLVSSV  349 (362)
T ss_dssp             TTSTTTCCGGGGCSS--SCSSCSSCCBCEEEEECCBCHHHHHHHHHHHHHHHHHHTTCSBHHHHHHHCEEEEBCHH
T ss_pred             ccccccccccccccc--ccccccCCCCcEEEeccCCCHHHHHHHHHHHHHHHHhhcCcCcHHHHHhCCEEEEECcc
Confidence            999999875432111  23367899999999999999999999999999999999999999999999999999975



>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure