Psyllid ID: psy3942
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| 157132312 | 305 | 3-hydroxyacyl-coa dehyrogenase [Aedes ae | 0.987 | 0.518 | 0.560 | 2e-46 | |
| 215259689 | 270 | 3-hydroxyacyl-CoA dehyrogenase [Culex ta | 0.812 | 0.481 | 0.653 | 1e-45 | |
| 307095136 | 310 | L3-hydroxyacylcoenzyme A dehydrogenase [ | 0.987 | 0.509 | 0.543 | 3e-45 | |
| 391339439 | 310 | PREDICTED: hydroxyacyl-coenzyme A dehydr | 0.806 | 0.416 | 0.697 | 5e-45 | |
| 253560551 | 198 | putative 3-hydroxyacyl-CoA dehyrogenase | 0.812 | 0.656 | 0.638 | 7e-45 | |
| 242011974 | 424 | Short chain 3-hydroxyacyl-CoA dehydrogen | 0.812 | 0.306 | 0.653 | 2e-44 | |
| 170041182 | 305 | 3-hydroxyacyl-coa dehyrogenase [Culex qu | 0.987 | 0.518 | 0.531 | 2e-44 | |
| 239799193 | 332 | ACYPI010176 [Acyrthosiphon pisum] | 0.987 | 0.475 | 0.543 | 2e-44 | |
| 241896891 | 309 | L-3-hydroxyacyl-Coenzyme A dehydrogenase | 0.987 | 0.511 | 0.543 | 2e-44 | |
| 91088569 | 309 | PREDICTED: similar to 3-hydroxyacyl-coa | 0.818 | 0.423 | 0.618 | 8e-44 |
| >gi|157132312|ref|XP_001655993.1| 3-hydroxyacyl-coa dehyrogenase [Aedes aegypti] gi|108881688|gb|EAT45913.1| AAEL002841-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 190 bits (483), Expect = 2e-46, Method: Compositional matrix adjust.
Identities = 97/173 (56%), Positives = 123/173 (71%), Gaps = 15/173 (8%)
Query: 1 VAAQAGNQ----EEGEKLIDSTLSRIKGSSKE-----------EGEKLIDLTLSRIKGSS 45
VAA G++ E ++L+D + IK S + +G++ +D TL+ +KGS+
Sbjct: 35 VAAATGHKVTLVEVNDQLVDKAIGSIKKSLERVAKKQFKDDASKGQQFMDGTLANLKGST 94
Query: 46 KVEDSVSQSDLVIEAIVENMDIKHKLFTSVDKIAPASAILASNTSSLSITEIASVTNRKD 105
K+EDSV+ SDLVIEAIVE M+IKH+LF +D +AP S I ASNTSSLSI EI SVT R+D
Sbjct: 95 KLEDSVASSDLVIEAIVEKMNIKHELFGKIDAVAPPSTIFASNTSSLSIGEIGSVTKRED 154
Query: 106 KFVGLHFFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIGKTTIVCKDTPGF 158
+F GLHFFNPVPMMKLLEVIRT TS+ TY + E+GK +GKT I CKDTPGF
Sbjct: 155 RFGGLHFFNPVPMMKLLEVIRTEKTSEETYQQLMEFGKRMGKTCITCKDTPGF 207
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|215259689|gb|ACJ64336.1| 3-hydroxyacyl-CoA dehyrogenase [Culex tarsalis] | Back alignment and taxonomy information |
|---|
| >gi|307095136|gb|ADN29874.1| L3-hydroxyacylcoenzyme A dehydrogenase [Triatoma matogrossensis] | Back alignment and taxonomy information |
|---|
| >gi|391339439|ref|XP_003744057.1| PREDICTED: hydroxyacyl-coenzyme A dehydrogenase, mitochondrial-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|253560551|gb|ACT32986.1| putative 3-hydroxyacyl-CoA dehyrogenase [Culex pipiens pipiens] | Back alignment and taxonomy information |
|---|
| >gi|242011974|ref|XP_002426718.1| Short chain 3-hydroxyacyl-CoA dehydrogenase, putative [Pediculus humanus corporis] gi|212510889|gb|EEB13980.1| Short chain 3-hydroxyacyl-CoA dehydrogenase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|170041182|ref|XP_001848352.1| 3-hydroxyacyl-coa dehyrogenase [Culex quinquefasciatus] gi|167864717|gb|EDS28100.1| 3-hydroxyacyl-coa dehyrogenase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|239799193|dbj|BAH70529.1| ACYPI010176 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|241896891|ref|NP_001155916.1| L-3-hydroxyacyl-Coenzyme A dehydrogenase [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91088569|ref|XP_973042.1| PREDICTED: similar to 3-hydroxyacyl-coa dehyrogenase [Tribolium castaneum] gi|270011703|gb|EFA08151.1| hypothetical protein TcasGA2_TC005769 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| WB|WBGene00007129 | 309 | B0272.3 [Caenorhabditis elegan | 0.937 | 0.485 | 0.5 | 4e-35 | |
| ZFIN|ZDB-GENE-040801-261 | 309 | hadh "hydroxyacyl-Coenzyme A d | 0.912 | 0.472 | 0.506 | 1.5e-33 | |
| UNIPROTKB|E1BZH9 | 315 | HADH "Uncharacterized protein" | 0.937 | 0.476 | 0.487 | 2.5e-33 | |
| WB|WBGene00010035 | 298 | F54C8.1 [Caenorhabditis elegan | 0.843 | 0.453 | 0.477 | 2.3e-32 | |
| UNIPROTKB|E2QVA4 | 312 | HADH "Uncharacterized protein" | 0.931 | 0.477 | 0.470 | 2.9e-32 | |
| UNIPROTKB|F6XHT8 | 287 | HADH "Uncharacterized protein" | 0.931 | 0.519 | 0.470 | 2.9e-32 | |
| UNIPROTKB|E9PF18 | 318 | HADH "Hydroxyacyl-coenzyme A d | 0.931 | 0.468 | 0.464 | 2.9e-32 | |
| UNIPROTKB|J3KQ17 | 331 | HADH "Hydroxyacyl-coenzyme A d | 0.931 | 0.450 | 0.464 | 2.9e-32 | |
| UNIPROTKB|Q16836 | 314 | HADH "Hydroxyacyl-coenzyme A d | 0.931 | 0.474 | 0.464 | 2.9e-32 | |
| MGI|MGI:96009 | 314 | Hadh "hydroxyacyl-Coenzyme A d | 0.931 | 0.474 | 0.470 | 3.7e-32 |
| WB|WBGene00007129 B0272.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 380 (138.8 bits), Expect = 4.0e-35, P = 4.0e-35
Identities = 77/154 (50%), Positives = 107/154 (69%)
Query: 9 EEGEKLIDSTLSRI--KGSSKEEGEK--LIDLTLSRIKGSSKVEDSVSQSDLVIEAIVEN 64
E+ ++ I ++L R+ K + + + L+ L RIK S+ V DSV +DLVIEAIVEN
Sbjct: 59 EKAQQGIANSLKRVAKKKHADDAAAQTALVSSVLDRIKMSTNVSDSVKDADLVIEAIVEN 118
Query: 65 MDIKHKLFTSVDKIAPASAILASNTSSLSITEIASVTNRKDKFVGLHFFNPVPMMKLLEV 124
+DIK KLF V+ A + ++ +NTSSL + +I K +F GLHFFNPVPMMKLLEV
Sbjct: 119 IDIKRKLFAEVEVAAKPTTLITTNTSSLRLADIGLNLKDKSRFGGLHFFNPVPMMKLLEV 178
Query: 125 IRTNDTSDATYNAVTEWGKSIGKTTIVCKDTPGF 158
+R +TSDAT+N + ++GK++GKTT+ CKDTPGF
Sbjct: 179 VRHTETSDATFNQLVDYGKTVGKTTVACKDTPGF 212
|
|
| ZFIN|ZDB-GENE-040801-261 hadh "hydroxyacyl-Coenzyme A dehydrogenase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZH9 HADH "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00010035 F54C8.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QVA4 HADH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XHT8 HADH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PF18 HADH "Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KQ17 HADH "Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16836 HADH "Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96009 Hadh "hydroxyacyl-Coenzyme A dehydrogenase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| pfam02737 | 180 | pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenas | 7e-59 | |
| PRK05808 | 282 | PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydroge | 1e-57 | |
| PLN02545 | 295 | PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydroge | 1e-54 | |
| COG1250 | 307 | COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Li | 2e-54 | |
| PRK08268 | 507 | PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogena | 5e-47 | |
| PRK07530 | 292 | PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydroge | 1e-43 | |
| PRK09260 | 288 | PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydroge | 2e-39 | |
| PRK11730 | 715 | PRK11730, fadB, multifunctional fatty acid oxidati | 2e-39 | |
| PRK07819 | 286 | PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydroge | 1e-37 | |
| PRK06035 | 291 | PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenas | 5e-37 | |
| PRK06130 | 311 | PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydroge | 1e-31 | |
| TIGR02279 | 503 | TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehy | 2e-30 | |
| TIGR02437 | 714 | TIGR02437, FadB, fatty oxidation complex, alpha su | 7e-30 | |
| PRK11154 | 708 | PRK11154, fadJ, multifunctional fatty acid oxidati | 4e-29 | |
| PRK08293 | 287 | PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydroge | 2e-28 | |
| TIGR02441 | 737 | TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c | 4e-27 | |
| TIGR02440 | 699 | TIGR02440, FadJ, fatty oxidation complex, alpha su | 6e-24 | |
| PRK08269 | 314 | PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydroge | 2e-18 | |
| PRK07531 | 495 | PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA | 2e-14 | |
| PRK06129 | 308 | PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenas | 5e-12 | |
| PRK07066 | 321 | PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydroge | 3e-11 |
| >gnl|CDD|202367 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
Score = 180 bits (460), Expect = 7e-59
Identities = 74/166 (44%), Positives = 102/166 (61%), Gaps = 13/166 (7%)
Query: 1 VAAQAGNQ-----------EEGEKLIDSTLSRIKGSSKEEGEKLIDLTLSRIKGSSKVED 49
V A+AG + E+ I+ +L+R+ + E D L+RI ++ + D
Sbjct: 17 VFARAGLEVVLVDISEEALEKARARIEKSLARLVEKGRITEED-ADAVLARISFTTDLAD 75
Query: 50 SVSQSDLVIEAIVENMDIKHKLFTSVDKIAPASAILASNTSSLSITEIASVTNRKDKFVG 109
+V +DLVIEA+ EN+D+K +LF +D IAP AILASNTSSLSITE+A+ T R ++F+G
Sbjct: 76 AVD-ADLVIEAVPENLDLKRELFAELDAIAPPDAILASNTSSLSITELAAATKRPERFIG 134
Query: 110 LHFFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIGKTTIVCKDT 155
LHFFNP P+M L+EV+R TS T V K IGKT +V KD
Sbjct: 135 LHFFNPPPLMPLVEVVRGEKTSPETVATVVALAKKIGKTPVVVKDV 180
|
This family also includes lambda crystallin. Length = 180 |
| >gnl|CDD|180269 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215300 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|224170 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236211 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181018 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236434 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181133 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180361 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235707 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|188207 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181359 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >gnl|CDD|181340 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236044 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235706 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168796 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 100.0 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 100.0 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 100.0 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 100.0 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 100.0 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 100.0 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 100.0 | |
| KOG2304|consensus | 298 | 100.0 | ||
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| PRK08269 | 314 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 100.0 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 100.0 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 100.0 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 100.0 | |
| KOG2305|consensus | 313 | 100.0 | ||
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 100.0 | |
| KOG1683|consensus | 380 | 99.97 | ||
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 99.97 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 99.96 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 99.94 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 99.74 | |
| cd05297 | 423 | GH4_alpha_glucosidase_galactosidase Glycoside Hydr | 99.42 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 99.16 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 98.99 | |
| PRK12557 | 342 | H(2)-dependent methylenetetrahydromethanopterin de | 98.65 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 98.63 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 98.61 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 98.53 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 98.52 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 98.51 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 98.5 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 98.4 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 98.38 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 98.37 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 98.34 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 98.31 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 98.04 | |
| PLN02256 | 304 | arogenate dehydrogenase | 98.02 | |
| PRK14806 | 735 | bifunctional cyclohexadienyl dehydrogenase/ 3-phos | 97.85 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 97.74 | |
| PF02153 | 258 | PDH: Prephenate dehydrogenase; InterPro: IPR003099 | 97.72 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 97.66 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 97.61 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 97.45 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 97.2 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 97.12 | |
| TIGR01724 | 341 | hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome | 97.11 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 97.05 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 96.75 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 96.72 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 96.71 | |
| PLN02712 | 667 | arogenate dehydrogenase | 96.68 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 96.62 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 96.56 | |
| TIGR00112 | 245 | proC pyrroline-5-carboxylate reductase. This enzym | 96.54 | |
| TIGR01723 | 340 | hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr | 96.5 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 96.42 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 96.19 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 95.91 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 95.88 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 95.64 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.47 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 95.4 | |
| PLN02712 | 667 | arogenate dehydrogenase | 95.29 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 95.03 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.01 | |
| PRK00961 | 342 | H(2)-dependent methylenetetrahydromethanopterin de | 95.0 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.21 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 93.88 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 93.6 | |
| cd05197 | 425 | GH4_glycoside_hydrolases Glycoside Hydrases Family | 93.49 | |
| COG4007 | 340 | Predicted dehydrogenase related to H2-forming N5,N | 93.42 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 93.41 | |
| PRK11861 | 673 | bifunctional prephenate dehydrogenase/3-phosphoshi | 93.26 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 93.11 | |
| PRK06444 | 197 | prephenate dehydrogenase; Provisional | 92.98 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 91.88 | |
| PF02056 | 183 | Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP | 91.83 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 91.79 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 90.66 | |
| PRK15076 | 431 | alpha-galactosidase; Provisional | 90.34 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 90.18 | |
| COG0345 | 266 | ProC Pyrroline-5-carboxylate reductase [Amino acid | 89.59 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 88.56 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 88.37 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 88.2 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 87.49 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 87.22 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 86.57 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 85.48 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 85.34 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 85.16 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 84.94 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 84.7 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 84.44 | |
| PLN00135 | 309 | malate dehydrogenase | 84.43 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 84.36 | |
| COG4074 | 343 | Mth H2-forming N5,N10-methylenetetrahydromethanopt | 82.69 | |
| TIGR03376 | 342 | glycerol3P_DH glycerol-3-phosphate dehydrogenase ( | 82.26 | |
| TIGR01756 | 313 | LDH_protist lactate dehydrogenase. This model repr | 82.18 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 80.76 |
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-49 Score=326.90 Aligned_cols=157 Identities=46% Similarity=0.730 Sum_probs=148.2
Q ss_pred hhhCCcc-----------HHHHHHHHHHHHHHhcCCchhhhhhHHHHhcCceecCChhhhcCCCcEEEEeccCChHHHHH
Q psy3942 2 AAQAGNQ-----------EEGEKLIDSTLSRIKGSSKEEGEKLIDLTLSRIKGSSKVEDSVSQSDLVIEAIVENMDIKHK 70 (160)
Q Consensus 2 ~a~~G~~-----------~~a~~~i~~~l~~~~~~~~~~~~~~~~~~l~~i~~~~~~~~al~~adlViEav~E~l~~K~~ 70 (160)
||.+||+ ++++..|.+.++++++++.....+ .+..+++|++++++. ++++||||||||+||+++|++
T Consensus 22 ~A~~G~~V~l~D~~~~~~~~~~~~i~~~l~k~~~~g~l~~~~-~~~~l~~i~~~~~~~-~l~~~DlVIEAv~E~levK~~ 99 (307)
T COG1250 22 FALAGYDVVLKDISPEALERALAYIEKNLEKLVEKGKLTEEE-ADAALARITPTTDLA-ALKDADLVIEAVVEDLELKKQ 99 (307)
T ss_pred HhhcCCceEEEeCCHHHHHHHHHHHHHHHHHHHhcCCCChhh-HHHHHhhccccCchh-HhccCCEEEEeccccHHHHHH
Confidence 6777888 889999999999998886655443 789999999999995 899999999999999999999
Q ss_pred HHHHHhhhCCCCcEEeecCCCCCHHHHhcccCCCCcEEEeecCCCCCCCceEEEecCCCCCHHHHHHHHHHHHHcCCeEE
Q psy3942 71 LFTSVDKIAPASAILASNTSSLSITEIASVTNRKDKFVGLHFFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIGKTTI 150 (160)
Q Consensus 71 v~~~l~~~~~~~~iiasnTS~l~i~~la~~~~~p~r~ig~Hf~~P~~~~~lVEvv~~~~T~~~~~~~~~~~~~~lgk~pv 150 (160)
+|++|+++++|+||||||||+|||++|++.++||+||+|+||||||+.|||||||+|.+|++++++++.+|++++||+|+
T Consensus 100 vf~~l~~~~~~~aIlASNTSsl~it~ia~~~~rper~iG~HFfNP~~~m~LVEvI~g~~T~~e~~~~~~~~~~~igK~~v 179 (307)
T COG1250 100 VFAELEALAKPDAILASNTSSLSITELAEALKRPERFIGLHFFNPVPLMPLVEVIRGEKTSDETVERVVEFAKKIGKTPV 179 (307)
T ss_pred HHHHHHhhcCCCcEEeeccCCCCHHHHHHHhCCchhEEEEeccCCCCcceeEEEecCCCCCHHHHHHHHHHHHHcCCCCE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred EecCcCcccC
Q psy3942 151 VCKDTPGFTP 160 (160)
Q Consensus 151 ~v~d~pGfi~ 160 (160)
+++|+||||.
T Consensus 180 v~~D~pGFi~ 189 (307)
T COG1250 180 VVKDVPGFIV 189 (307)
T ss_pred eecCCCceeh
Confidence 8899999984
|
|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG2304|consensus | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2305|consensus | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >KOG1683|consensus | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00112 proC pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 | Back alignment and domain information |
|---|
| >COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06444 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15076 alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00135 malate dehydrogenase | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) | Back alignment and domain information |
|---|
| >TIGR01756 LDH_protist lactate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 160 | ||||
| 1m75_A | 302 | Crystal Structure Of The N208s Mutant Of L-3-Hydrox | 5e-35 | ||
| 1f0y_A | 302 | L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Ac | 5e-35 | ||
| 1f12_A | 310 | L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- | 9e-35 | ||
| 1lso_A | 302 | Crystal Structure Of The S137a Mutant Of L-3-Hydrox | 1e-34 | ||
| 1lsj_A | 302 | Crystal Structure Of The E110q Mutant Of L-3-hydrox | 1e-34 | ||
| 1il0_A | 302 | X-Ray Crystal Structure Of The E170q Mutant Of Huma | 1e-34 | ||
| 3had_A | 308 | Biochemical Characterization And Structure Determin | 1e-34 | ||
| 3rqs_A | 324 | Crystal Structure Of Human L-3- Hydroxyacyl-Coa Deh | 2e-34 | ||
| 1m76_A | 302 | Crystal Structure Of The S137c Mutant Of L-3-Hydrox | 2e-34 | ||
| 3hdh_A | 302 | Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydroge | 5e-34 | ||
| 2hdh_A | 293 | Biochemical Characterization And Structure Determin | 1e-33 | ||
| 2wtb_A | 725 | Arabidopsis Thaliana Multifuctional Protein, Mfp2 L | 7e-24 | ||
| 1wdk_A | 715 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 2e-21 | ||
| 3mog_A | 483 | Crystal Structure Of 3-Hydroxybutyryl-Coa Dehydroge | 2e-19 | ||
| 3zwb_A | 742 | Crystal Structure Of Rat Peroxisomal Multifunctiona | 5e-19 | ||
| 3zw8_A | 742 | Crystal Structure Of Rat Peroxisomal Multifunctiona | 5e-19 | ||
| 2x58_A | 727 | The Crystal Structure Of Mfe1 Liganded With Coa Len | 6e-19 | ||
| 1zcj_A | 463 | Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenas | 3e-18 | ||
| 4dyd_A | 283 | Substrate-Directed Dual Catalysis Of Dicarbonyl Com | 7e-17 | ||
| 3k6j_A | 460 | Crystal Structure Of The Dehydrogenase Part Of Mult | 2e-15 | ||
| 1zej_A | 293 | Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrog | 5e-11 | ||
| 3f3s_A | 313 | The Crystal Structure Of Human Lambda-Crystallin, C | 6e-07 |
| >pdb|1M75|A Chain A, Crystal Structure Of The N208s Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 | Back alignment and structure |
|
| >pdb|1F0Y|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa And Nad+ Length = 302 | Back alignment and structure |
| >pdb|1F12|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- Hydroxybutyryl-Coa Length = 310 | Back alignment and structure |
| >pdb|1LSO|A Chain A, Crystal Structure Of The S137a Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 | Back alignment and structure |
| >pdb|1LSJ|A Chain A, Crystal Structure Of The E110q Mutant Of L-3-hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 | Back alignment and structure |
| >pdb|1IL0|A Chain A, X-Ray Crystal Structure Of The E170q Mutant Of Human L-3- Hydroxyacyl-Coa Dehydrogenase Length = 302 | Back alignment and structure |
| >pdb|3HAD|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 308 | Back alignment and structure |
| >pdb|3RQS|A Chain A, Crystal Structure Of Human L-3- Hydroxyacyl-Coa Dehydrogenase (Ec1.1.1.35) From Mitochondria At The Resolution 2.0 A, Northeast Structural Genomics Consortium Target Hr487, Mitochondrial Protein Partnership Length = 324 | Back alignment and structure |
| >pdb|1M76|A Chain A, Crystal Structure Of The S137c Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 | Back alignment and structure |
| >pdb|3HDH|A Chain A, Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Revisited: Sequence Analysis And Crystal Structure Determination Length = 302 | Back alignment and structure |
| >pdb|2HDH|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 293 | Back alignment and structure |
| >pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2 Length = 725 | Back alignment and structure |
| >pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 | Back alignment and structure |
| >pdb|3MOG|A Chain A, Crystal Structure Of 3-Hydroxybutyryl-Coa Dehydrogenase From Escherichia Coli K12 Substr. Mg1655 Length = 483 | Back alignment and structure |
| >pdb|3ZWB|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) Complexed With 2trans-hexenoyl-coa Length = 742 | Back alignment and structure |
| >pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 | Back alignment and structure |
| >pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 | Back alignment and structure |
| >pdb|1ZCJ|A Chain A, Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenase Length = 463 | Back alignment and structure |
| >pdb|4DYD|A Chain A, Substrate-Directed Dual Catalysis Of Dicarbonyl Compounds By Diketoreductase Length = 283 | Back alignment and structure |
| >pdb|3K6J|A Chain A, Crystal Structure Of The Dehydrogenase Part Of Multifuctional Enzyme 1 From C.Elegans Length = 460 | Back alignment and structure |
| >pdb|1ZEJ|A Chain A, Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrogenase (Hbd-9, Af2017) From Archaeoglobus Fulgidus Dsm 4304 At 2.00 A Resolution Length = 293 | Back alignment and structure |
| >pdb|3F3S|A Chain A, The Crystal Structure Of Human Lambda-Crystallin, Cryl1 Length = 313 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 4e-76 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 3e-69 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 1e-25 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 4e-62 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 2e-56 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 4e-55 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 4e-55 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 1e-54 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 4e-54 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 8e-54 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 5e-04 |
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Length = 302 | Back alignment and structure |
|---|
Score = 227 bits (582), Expect = 4e-76
Identities = 75/173 (43%), Positives = 110/173 (63%), Gaps = 15/173 (8%)
Query: 1 VAAQAGNQ-----------EEGEKLIDSTLSRI--KGSSKEE--GEKLIDLTLSRIKGSS 45
VAA G+ + +K I+ +L ++ K ++ G++ ++ TLS I S+
Sbjct: 33 VAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATST 92
Query: 46 KVEDSVSQSDLVIEAIVENMDIKHKLFTSVDKIAPASAILASNTSSLSITEIASVTNRKD 105
V +DLV+EAIVEN+ +K++LF +DK A I ASNTSSL IT IA+ T R+D
Sbjct: 93 DAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQD 152
Query: 106 KFVGLHFFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIGKTTIVCKDTPGF 158
+F GLHFFNPVP+MKL+EVI+T TS T+ ++ ++ K++GK + CKDTPGF
Sbjct: 153 RFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGF 205
|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Length = 293 | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Length = 460 | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Length = 463 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 100.0 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 100.0 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 100.0 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 100.0 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 100.0 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 100.0 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 100.0 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 99.98 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 99.97 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 99.97 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 99.97 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 99.41 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 99.37 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 99.21 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 99.15 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 99.02 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 98.98 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 98.75 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 98.71 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 98.65 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 98.64 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 98.63 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 98.61 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 98.61 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 98.55 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 98.53 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 98.53 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 98.5 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 98.47 | |
| 2i76_A | 276 | Hypothetical protein; NADP, dehydrogenase, TM1727, | 98.45 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 98.44 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 98.43 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 98.33 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 98.33 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 98.32 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 98.32 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 98.2 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 98.15 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 98.15 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 98.14 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 98.13 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 98.1 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 98.1 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 98.08 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 98.05 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 98.0 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 97.97 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 97.96 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 97.96 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 97.94 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 97.93 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 97.89 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 97.89 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 97.81 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 97.81 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 97.81 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 97.8 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 97.61 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 97.6 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 97.55 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 97.53 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 97.5 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 97.46 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 97.41 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 97.34 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 97.32 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 97.3 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 97.26 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 97.24 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 97.11 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 97.05 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 97.04 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 97.02 | |
| 3c7a_A | 404 | Octopine dehydrogenase; L) stereospecific opine de | 96.98 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 96.88 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 96.86 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 96.84 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 96.66 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 96.6 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 96.58 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 96.48 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 96.42 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.38 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.32 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 96.32 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 96.21 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 96.19 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 96.04 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 95.99 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 95.94 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 95.73 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 95.68 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 95.52 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 95.52 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 95.48 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 95.32 | |
| 2b0j_A | 358 | 5,10-methenyltetrahydromethanopterin hydrogenase; | 95.31 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 95.27 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 95.19 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 95.15 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 94.82 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 94.79 | |
| 1up7_A | 417 | 6-phospho-beta-glucosidase; hydrolase, family4 hyd | 94.78 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 94.49 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 94.25 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.79 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 93.48 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 93.31 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 93.28 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 92.71 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 92.62 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 91.82 | |
| 3u95_A | 477 | Glycoside hydrolase, family 4; hydrolysis, cytosol | 90.25 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 90.07 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 89.73 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 88.57 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 87.17 | |
| 4fgw_A | 391 | Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi | 84.79 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 83.24 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 82.71 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 82.06 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 80.58 |
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-49 Score=330.49 Aligned_cols=160 Identities=23% Similarity=0.328 Sum_probs=149.0
Q ss_pred ChhhCCcc-----------HHHHHHHHHHHHHHhcCCchhhhhhHHHHhcCceecCChhhhcCCCcEEEEeccCChHHHH
Q psy3942 1 VAAQAGNQ-----------EEGEKLIDSTLSRIKGSSKEEGEKLIDLTLSRIKGSSKVEDSVSQSDLVIEAIVENMDIKH 69 (160)
Q Consensus 1 ~~a~~G~~-----------~~a~~~i~~~l~~~~~~~~~~~~~~~~~~l~~i~~~~~~~~al~~adlViEav~E~l~~K~ 69 (160)
+||++||+ ++++++|++.++++.+++........++.+++|++++|+++++++||||||||||++++|+
T Consensus 24 ~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~g~~~~~~~~~~~l~~i~~~~~l~~a~~~ad~ViEav~E~l~iK~ 103 (319)
T 3ado_A 24 LFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKR 103 (319)
T ss_dssp HHHHTTCCEEEECSCHHHHHHHHHHHHHHHHHHHHTTCCCSSSCHHHHHHTEEEECCHHHHTTTEEEEEECCCSCHHHHH
T ss_pred HHHhCCCeEEEEECCHHHHHHHHHHHHHHHHHHHHcCCCCCccCHHHHHhhcccccchHhHhccCcEEeeccccHHHHHH
Confidence 37889999 7889999999999888755443323678899999999998899999999999999999999
Q ss_pred HHHHHHhhhCCCCcEEeecCCCCCHHHHhcccCCCCcEEEeecCCCCCCCceEEEecCCCCCHHHHHHHHHHHHHcCCeE
Q psy3942 70 KLFTSVDKIAPASAILASNTSSLSITEIASVTNRKDKFVGLHFFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIGKTT 149 (160)
Q Consensus 70 ~v~~~l~~~~~~~~iiasnTS~l~i~~la~~~~~p~r~ig~Hf~~P~~~~~lVEvv~~~~T~~~~~~~~~~~~~~lgk~p 149 (160)
++|++|+++|+|+||||||||+|++++|++.+.||+||+|+|||||||.|||||||+|+.|++++++++.+|++++||+|
T Consensus 104 ~lf~~l~~~~~~~aIlaSNTSsl~is~ia~~~~~p~r~ig~HffNP~~~m~LVEiv~g~~Ts~~~~~~~~~~~~~~gk~p 183 (319)
T 3ado_A 104 KIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSP 183 (319)
T ss_dssp HHHHHHHTTCCSSSEEEECCSSCCHHHHHTTCTTGGGEEEEEECSSTTTCCEEEEEECTTCCHHHHHHHHHHHHHTTCEE
T ss_pred HHHHHHHHHhhhcceeehhhhhccchhhhhhccCCCcEEEecCCCCccccchHHhcCCCCCcHHHHHHHHHHHHHhCCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEe-cCcCcccC
Q psy3942 150 IVC-KDTPGFTP 160 (160)
Q Consensus 150 v~v-~d~pGfi~ 160 (160)
|++ +|+||||+
T Consensus 184 v~v~kd~pGFi~ 195 (319)
T 3ado_A 184 VRVLKEIDGFVL 195 (319)
T ss_dssp EECSSCCTTTTH
T ss_pred CCcCCCCCCEeH
Confidence 976 99999984
|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 160 | ||||
| d1wdka3 | 186 | c.2.1.6 (A:311-496) Fatty oxidation complex alpha | 6e-26 | |
| d1f0ya2 | 192 | c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA | 8e-25 | |
| d2b0ja2 | 242 | c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt | 9e-11 |
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: 6-phosphogluconate dehydrogenase-like, N-terminal domain domain: Fatty oxidation complex alpha subunit, middle domain species: Pseudomonas fragi [TaxId: 296]
Score = 95.4 bits (236), Expect = 6e-26
Identities = 47/105 (44%), Positives = 62/105 (59%)
Query: 52 SQSDLVIEAIVENMDIKHKLFTSVDKIAPASAILASNTSSLSITEIASVTNRKDKFVGLH 111
DLV+EA+VEN +K + V+ AILASNTS++SI+ +A R + FVG+H
Sbjct: 82 GNVDLVVEAVVENPKVKQAVLAEVENHVREDAILASNTSTISISLLAKALKRPENFVGMH 141
Query: 112 FFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIGKTTIVCKDTP 156
FFNPV MM L+EVIR +SD + K +GK IV D P
Sbjct: 142 FFNPVHMMPLVEVIRGEKSSDLAVATTVAYAKKMGKNPIVVNDCP 186
|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 100.0 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 100.0 | |
| d2b0ja2 | 242 | 5,10-methenyltetrahydromethanopterin hydrogenase, | 99.55 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 98.78 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 98.22 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 97.59 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 97.55 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 96.97 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 96.6 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.34 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 95.07 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 93.9 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 93.72 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 93.67 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.63 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 93.58 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 92.11 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 91.94 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 91.9 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 90.1 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 88.17 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 87.63 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 87.58 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 87.42 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 87.31 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 86.16 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 85.03 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 84.48 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 83.77 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 82.89 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 80.35 |
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: 6-phosphogluconate dehydrogenase-like, N-terminal domain domain: Short chain L-3-hydroxyacyl CoA dehydrogenase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=3.8e-47 Score=293.90 Aligned_cols=155 Identities=46% Similarity=0.764 Sum_probs=144.0
Q ss_pred hhhCCcc-----------HHHHHHHHHHHHHHhcCCchh----hhhhHHHHhcCceecCChhhhcCCCcEEEEeccCChH
Q psy3942 2 AAQAGNQ-----------EEGEKLIDSTLSRIKGSSKEE----GEKLIDLTLSRIKGSSKVEDSVSQSDLVIEAIVENMD 66 (160)
Q Consensus 2 ~a~~G~~-----------~~a~~~i~~~l~~~~~~~~~~----~~~~~~~~l~~i~~~~~~~~al~~adlViEav~E~l~ 66 (160)
||++||+ ++++++|++.|+..++++... ..+..+..+++|++++|+.+++++|||||||++||++
T Consensus 23 ~a~~G~~V~l~D~~~~~l~~a~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~l~~i~~~~d~~~a~~~ad~ViEav~E~l~ 102 (192)
T d1f0ya2 23 AAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLK 102 (192)
T ss_dssp HHHTTCEEEEECSCHHHHHHHHHHHHHHHHHHHHTTSSSCHHHHHHHHHHHHHTEEEESCHHHHTTSCSEEEECCCSCHH
T ss_pred HHhCCCcEEEEECChHHHHHHHhhHHHHHHHHHHhhhhccchhhHHHHHHHHhhccccchhHhhhcccceehhhcccchh
Confidence 7889999 788999999999887764321 2233677889999999998889999999999999999
Q ss_pred HHHHHHHHHhhhCCCCcEEeecCCCCCHHHHhcccCCCCcEEEeecCCCCCCCceEEEecCCCCCHHHHHHHHHHHHHcC
Q psy3942 67 IKHKLFTSVDKIAPASAILASNTSSLSITEIASVTNRKDKFVGLHFFNPVPMMKLLEVIRTNDTSDATYNAVTEWGKSIG 146 (160)
Q Consensus 67 ~K~~v~~~l~~~~~~~~iiasnTS~l~i~~la~~~~~p~r~ig~Hf~~P~~~~~lVEvv~~~~T~~~~~~~~~~~~~~lg 146 (160)
+|+++|++|++.++++|||+||||++++++|++.+.||+||+|+|||||||.+|||||++|++|++++++++.+|++++|
T Consensus 103 ~K~~v~~~l~~~~~~~~ilasnTS~l~i~~la~~~~~p~r~ig~HffnP~~~~~lVEIv~g~~T~~~~i~~~~~~~~~lg 182 (192)
T d1f0ya2 103 VKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALG 182 (192)
T ss_dssp HHHHHHHHHTTTSCTTCEEEECCSSSCHHHHHTTSSCGGGEEEEEECSSTTTCCEEEEECCTTCCHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHhhhcccCceeeccCcccccchhhhhccCHhHEEeeccccccCcccEEEEcCCCCCCHHHHHHHHHHHHHcC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CeEEEecCcC
Q psy3942 147 KTTIVCKDTP 156 (160)
Q Consensus 147 k~pv~v~d~p 156 (160)
|+||+|+|.|
T Consensus 183 k~pV~v~D~P 192 (192)
T d1f0ya2 183 KHPVSCKDTP 192 (192)
T ss_dssp CEEEEECSCT
T ss_pred CEEEEeeccC
Confidence 9999999998
|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|