Psyllid ID: psy3952


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELRREFKLDELSSR
cHHHHHHcccEEEcccEEEEEEEcccEEEEEEccccEEEEcEEEEcccccHHHHHHHccccccccEEEEEEEEEEEcccccccccccEEEcccccccccEEEEEEcccccEEEcccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHccccccccccccccccccEEEcccccccccEEEEEcccEEEEEccccHHHHccHHHHHHHHHHHHHHccccccccc
cHHHHHHcccEEEEcEEEEEEEEccccEEEEEccccEEEEEEEEEcccHHHHHHHHHcccccccEEEEccccEEEcccHHcccEcccEcccccccccEEEEEEcccccccEEEcHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccEEEEEEcccccccccEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccc
MGEEFCELGGEIRLNQQVEsfkenpesvtistkqgdhlESSYALVCAGLQADEMALksgcslepaivpfrgeylllnpakqhlvrgniypvpdpnfpflgvhftprmdgsvwlgpnavlafkkegyrwrdfSVRELFStlrypgfwrlGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIeagdiqrgpsgvraqalsssgdlvddfvfhsagrtlhcrnapspaatsSLAIAKHILNELRREfkldelssr
MGEefcelggeirlNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELfstlrypgfwrlGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEagdiqrgpSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELrrefkldelssr
MGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELRREFKLDELSSR
***************************************SSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGD*****************DLVDDFVFHSAGRTL************************************
MGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELRREF********
MGEEFCELGGEIRLNQQVE**************QGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELRREFKLDELSSR
MGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELRREFKL******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNELRREFKLDELSSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
A8X2R1434 L-2-hydroxyglutarate dehy N/A N/A 0.972 0.564 0.509 1e-67
A7SMW7456 L-2-hydroxyglutarate dehy N/A N/A 0.972 0.537 0.498 2e-67
Q9N4Z0433 L-2-hydroxyglutarate dehy yes N/A 0.976 0.568 0.513 6e-67
A7MBI3463 L-2-hydroxyglutarate dehy yes N/A 0.968 0.526 0.484 1e-66
Q9H9P8463 L-2-hydroxyglutarate dehy yes N/A 0.968 0.526 0.488 1e-65
Q91YP0464 L-2-hydroxyglutarate dehy yes N/A 0.968 0.525 0.488 2e-65
Q55GI5446 L-2-hydroxyglutarate dehy yes N/A 0.932 0.526 0.414 2e-53
P37339422 L-2-hydroxyglutarate oxid N/A N/A 0.948 0.566 0.452 5e-52
Q5R9N7419 L-2-hydroxyglutarate dehy yes N/A 0.793 0.477 0.430 6e-52
Q9ZMY5450 Malate:quinone oxidoreduc yes N/A 0.412 0.231 0.254 4e-05
>sp|A8X2R1|L2HDH_CAEBR L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG06643 PE=3 SV=2 Back     alignment and function desciption
 Score =  256 bits (654), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 131/257 (50%), Positives = 173/257 (67%), Gaps = 12/257 (4%)

Query: 1   MGEEFCELGGEIRLNQQVESFKEN------PESVTISTKQGDHLESSYALVCAGLQADEM 54
            GE+F + GG+I  +  +E  ++N      P  V+      D  E+   + CAGLQ+D +
Sbjct: 179 FGEDFEKRGGKIYTSYPLEKIEDNLKDSNYPIRVSSDPSYAD-FETKNLITCAGLQSDRV 237

Query: 55  ALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLG 114
           A  SGCS +P IVPFRGEYLLL P K+HLV+ NIYPVPDP FPFLGVHFTPRM+G +WLG
Sbjct: 238 AALSGCSTDPKIVPFRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLG 297

Query: 115 PNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELK 174
           PNAVLA+K+EGY +   S  +L  +L Y G  +L  K+  +G KE+    + + +V +L+
Sbjct: 298 PNAVLAYKREGYSYFSISPSDLLESLSYSGMQKLVKKHFTFGIKELYRGIWIAAQVKQLQ 357

Query: 175 QYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHS-----AGRTLHCRNAPSPAATSS 229
           ++I E++  D+ RGPSGVRAQA+ S+G+LVDDFVF S     +   +H RNAPSPAATSS
Sbjct: 358 RFIPELKYSDVTRGPSGVRAQAMDSAGNLVDDFVFDSGTGKLSSLIMHVRNAPSPAATSS 417

Query: 230 LAIAKHILNELRREFKL 246
           LAIAK I +E    FKL
Sbjct: 418 LAIAKMITSEAITRFKL 434





Caenorhabditis briggsae (taxid: 6238)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 2
>sp|A7SMW7|L2HDH_NEMVE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Nematostella vectensis GN=v1g172254 PE=3 SV=1 Back     alignment and function description
>sp|Q9N4Z0|L2HDH_CAEEL L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y45G12B.3 PE=3 SV=2 Back     alignment and function description
>sp|A7MBI3|L2HDH_BOVIN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=L2HGDH PE=2 SV=1 Back     alignment and function description
>sp|Q9H9P8|L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=L2HGDH PE=1 SV=3 Back     alignment and function description
>sp|Q91YP0|L2HDH_MOUSE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=L2hgdh PE=2 SV=1 Back     alignment and function description
>sp|Q55GI5|L2HDH_DICDI L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=l2hgdh PE=3 SV=1 Back     alignment and function description
>sp|P37339|LHGO_ECOLI L-2-hydroxyglutarate oxidase LhgO OS=Escherichia coli (strain K12) GN=lhgO PE=1 SV=3 Back     alignment and function description
>sp|Q5R9N7|L2HDH_PONAB L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=L2HGDH PE=2 SV=1 Back     alignment and function description
>sp|Q9ZMY5|MQO_HELPJ Malate:quinone oxidoreductase OS=Helicobacter pylori (strain J99) GN=mqo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
321466639 462 hypothetical protein DAPPUDRAFT_305386 [ 0.972 0.530 0.559 2e-79
195484296 455 GE12689 [Drosophila yakuba] gi|194176735 0.972 0.538 0.560 1e-77
24585081 455 CG10639 [Drosophila melanogaster] gi|729 0.972 0.538 0.560 2e-77
195344954 455 GM17047 [Drosophila sechellia] gi|195580 0.972 0.538 0.556 5e-77
194879897 455 GG21668 [Drosophila erecta] gi|190657511 0.972 0.538 0.556 1e-76
194759574 453 GF14644 [Drosophila ananassae] gi|190615 0.972 0.540 0.560 1e-76
195114986 455 GI17168 [Drosophila mojavensis] gi|19391 0.972 0.538 0.571 3e-76
119112468 439 AGAP007868-PA [Anopheles gambiae str. PE 0.972 0.558 0.535 5e-76
195387960 468 GJ17673 [Drosophila virilis] gi|19414911 0.972 0.523 0.568 6e-76
195035497 452 GH11599 [Drosophila grimshawi] gi|193905 0.972 0.542 0.559 8e-76
>gi|321466639|gb|EFX77633.1| hypothetical protein DAPPUDRAFT_305386 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 146/261 (55%), Positives = 184/261 (70%), Gaps = 16/261 (6%)

Query: 2   GEEFCELGGEIRLNQQVESFK-----------ENPESVTISTKQGDHLESSYALVCAGLQ 50
           GE+F  LGG+I LN +V+ FK            N + V ++   G  +   Y L C GLQ
Sbjct: 201 GEDFKALGGDIHLNFEVKDFKVAEESKVKALASNKKGVQVTASNGQSVRCKYVLTCGGLQ 260

Query: 51  ADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGS 110
           +D +A  SGCS EP IVPFRGEYLLLNP K HLV+GNIYPVPDP FPFLGVHFTPRMDGS
Sbjct: 261 SDRLAELSGCSREPRIVPFRGEYLLLNPKKTHLVKGNIYPVPDPRFPFLGVHFTPRMDGS 320

Query: 111 VWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRV 170
           VWLGPNAVLA K+EGY W D ++R+LF +LRY GF +L +K+  +G +E++ S F S+ +
Sbjct: 321 VWLGPNAVLALKREGYSWGDINLRDLFDSLRYRGFQKLAVKHVAFGLQEIVRSAFISLSL 380

Query: 171 NELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFH----SAGR-TLHCRNAPSPA 225
            EL++YI E+++ DI RGP+GVRAQAL + G LV+DFVF       GR  +HCRN PSP 
Sbjct: 381 KELQKYIPEVQSSDITRGPAGVRAQALDADGSLVEDFVFDYGMGEIGRNVIHCRNTPSPG 440

Query: 226 ATSSLAIAKHILNELRREFKL 246
           ATSSLAIAK I ++  ++F L
Sbjct: 441 ATSSLAIAKMIADKAEKDFLL 461




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195484296|ref|XP_002090634.1| GE12689 [Drosophila yakuba] gi|194176735|gb|EDW90346.1| GE12689 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24585081|ref|NP_609923.2| CG10639 [Drosophila melanogaster] gi|7298510|gb|AAF53729.1| CG10639 [Drosophila melanogaster] gi|201065691|gb|ACH92255.1| FI05204p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195344954|ref|XP_002039041.1| GM17047 [Drosophila sechellia] gi|195580020|ref|XP_002079854.1| GD21794 [Drosophila simulans] gi|194134171|gb|EDW55687.1| GM17047 [Drosophila sechellia] gi|194191863|gb|EDX05439.1| GD21794 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194879897|ref|XP_001974324.1| GG21668 [Drosophila erecta] gi|190657511|gb|EDV54724.1| GG21668 [Drosophila erecta] Back     alignment and taxonomy information
>gi|194759574|ref|XP_001962022.1| GF14644 [Drosophila ananassae] gi|190615719|gb|EDV31243.1| GF14644 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195114986|ref|XP_002002048.1| GI17168 [Drosophila mojavensis] gi|193912623|gb|EDW11490.1| GI17168 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|119112468|ref|XP_317624.2| AGAP007868-PA [Anopheles gambiae str. PEST] gi|116123367|gb|EAA12921.2| AGAP007868-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195387960|ref|XP_002052660.1| GJ17673 [Drosophila virilis] gi|194149117|gb|EDW64815.1| GJ17673 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195035497|ref|XP_001989214.1| GH11599 [Drosophila grimshawi] gi|193905214|gb|EDW04081.1| GH11599 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
FB|FBgn0032729455 CG10639 [Drosophila melanogast 0.972 0.538 0.560 3.2e-72
UNIPROTKB|F1NBV3452 L2HGDH "Uncharacterized protei 0.968 0.539 0.523 8.5e-65
ZFIN|ZDB-GENE-090319-6452 l2hgdh "L-2-hydroxyglutarate d 0.972 0.542 0.501 4.2e-63
WB|WBGene00021564433 Y45G12B.3 [Caenorhabditis eleg 0.972 0.565 0.515 5.4e-63
UNIPROTKB|F1SHX9463 L2HGDH "Uncharacterized protei 0.968 0.526 0.5 2.1e-61
RGD|1306250463 L2hgdh "L-2-hydroxyglutarate d 0.968 0.526 0.492 1.2e-60
UNIPROTKB|A7MBI3463 L2HGDH "L-2-hydroxyglutarate d 0.968 0.526 0.484 2.4e-60
UNIPROTKB|E2RRS4674 L2HGDH "Uncharacterized protei 0.968 0.362 0.496 5e-60
MGI|MGI:2384968464 L2hgdh "L-2-hydroxyglutarate d 0.968 0.525 0.488 5e-60
UNIPROTKB|Q9H9P8463 L2HGDH "L-2-hydroxyglutarate d 0.968 0.526 0.492 1.7e-59
FB|FBgn0032729 CG10639 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 730 (262.0 bits), Expect = 3.2e-72, P = 3.2e-72
 Identities = 144/257 (56%), Positives = 178/257 (69%)

Query:     2 GEEFCELGGEIRLNQQVESFKENPES----VTI-STKQGDHLESSYALVCAGLQADEMAL 56
             G++F + GG+I L+  V  F E  E     VTI   K G  + +   L C GLQ+D +A 
Sbjct:   197 GQDFKQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAE 256

Query:    57 KSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPN 116
             K+GC  +P IVPFRGEYLLL   KQH+V+GNIYPVPDP FPFLGVHFTPRMDGS+WLGPN
Sbjct:   257 KTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPN 316

Query:   117 AVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQY 176
             AVLA K+EGY W D ++ ELF  LRYPGF ++  KY  +G  EM  SWF ++++  L++Y
Sbjct:   317 AVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIGFGLSEMSKSWFINLQIKALQKY 376

Query:   177 IEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHS-------AGRTLHCRNAPSPAATSS 229
             I +I   DIQRGP+GVRAQA+   G+LVDDFVF         A R LHCRNAPSP ATSS
Sbjct:   377 IPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSS 436

Query:   230 LAIAKHILNELRREFKL 246
             LAIAK I +++  EF +
Sbjct:   437 LAIAKMIADKIENEFSI 453




GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
UNIPROTKB|F1NBV3 L2HGDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090319-6 l2hgdh "L-2-hydroxyglutarate dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00021564 Y45G12B.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHX9 L2HGDH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1306250 L2hgdh "L-2-hydroxyglutarate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBI3 L2HGDH "L-2-hydroxyglutarate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRS4 L2HGDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2384968 L2hgdh "L-2-hydroxyglutarate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H9P8 L2HGDH "L-2-hydroxyglutarate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9N4Z0L2HDH_CAEEL1, ., 1, ., 9, 9, ., 20.51370.97610.5681yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 1e-121
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 2e-56
PTZ00383497 PTZ00383, PTZ00383, malate:quinone oxidoreductase; 1e-04
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
 Score =  350 bits (901), Expect = e-121
 Identities = 122/240 (50%), Positives = 155/240 (64%), Gaps = 1/240 (0%)

Query: 1   MGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGC 60
           M E     GGEIRL  +V +  E+   V + T QG+  E+   + CAGL +D +A  +G 
Sbjct: 155 MAELIQARGGEIRLGAEVTALDEHANGVVVRTTQGE-YEARTLINCAGLMSDRLAKMAGL 213

Query: 61  SLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLA 120
             +  IVPFRGEY  L P K  LV   IYPVPDP FPFLGVH T  +DGSV +GPNAVLA
Sbjct: 214 EPDFRIVPFRGEYYRLAPEKNQLVNHLIYPVPDPAFPFLGVHLTRMIDGSVTVGPNAVLA 273

Query: 121 FKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEI 180
           FK+EGYR RDFS+R+L   L YPGFW+L  K+ R G  EM  S   S  +  +++Y   +
Sbjct: 274 FKREGYRKRDFSLRDLLEILTYPGFWKLAQKHWRSGLGEMKNSLSKSGYLRLVQKYCPSL 333

Query: 181 EAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNEL 240
              D+Q  P+GVRAQA+S  G LVDDF+F    R+LH  NAPSPAATSSL I +HI++++
Sbjct: 334 TLSDLQPYPAGVRAQAVSRDGKLVDDFLFVETPRSLHVCNAPSPAATSSLPIGEHIVSKV 393


Length = 393

>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240393 PTZ00383, PTZ00383, malate:quinone oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
PRK11728393 hydroxyglutarate oxidase; Provisional 100.0
KOG2665|consensus453 99.96
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.95
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.94
PRK05257494 malate:quinone oxidoreductase; Validated 99.94
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.94
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 99.93
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 99.92
COG0579429 Predicted dehydrogenase [General function predicti 99.92
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.92
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.92
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.92
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.91
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.91
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.91
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.9
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.9
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.9
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.9
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.89
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.89
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.89
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.88
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.88
KOG2844|consensus 856 99.87
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.86
KOG2853|consensus509 99.81
KOG0042|consensus 680 99.73
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.71
KOG3923|consensus342 99.65
KOG2820|consensus399 99.64
KOG2852|consensus380 99.08
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.46
PRK10157428 putative oxidoreductase FixC; Provisional 98.45
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.3
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.26
PLN02697529 lycopene epsilon cyclase 98.25
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.22
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.18
PRK06185407 hypothetical protein; Provisional 98.13
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.13
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.08
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.06
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.99
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.98
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.95
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.91
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.87
PRK10015429 oxidoreductase; Provisional 97.86
COG2081408 Predicted flavoproteins [General function predicti 97.79
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.78
PRK06834 488 hypothetical protein; Provisional 97.73
PLN02463447 lycopene beta cyclase 97.71
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.71
PRK07233434 hypothetical protein; Provisional 97.7
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.69
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.68
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.65
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.5
PRK09126392 hypothetical protein; Provisional 97.49
PRK08244 493 hypothetical protein; Provisional 97.49
PRK07190 487 hypothetical protein; Provisional 97.42
PRK06847375 hypothetical protein; Provisional 97.37
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.36
PRK06184 502 hypothetical protein; Provisional 97.3
PRK08163396 salicylate hydroxylase; Provisional 97.1
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.1
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.07
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.04
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 96.98
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 96.9
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.87
PRK07588391 hypothetical protein; Provisional 96.77
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.74
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.71
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.68
PRK08013400 oxidoreductase; Provisional 96.64
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 96.58
PRK08274466 tricarballylate dehydrogenase; Validated 96.53
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 96.49
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.48
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.46
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.45
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.41
PRK09897 534 hypothetical protein; Provisional 96.38
PRK06996398 hypothetical protein; Provisional 96.32
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.28
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.25
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.14
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 96.14
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.12
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.09
COG1233487 Phytoene dehydrogenase and related proteins [Secon 96.08
PLN02612567 phytoene desaturase 96.08
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.07
PLN02172461 flavin-containing monooxygenase FMO GS-OX 96.07
PRK06126 545 hypothetical protein; Provisional 96.06
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.02
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 96.0
PRK06481506 fumarate reductase flavoprotein subunit; Validated 95.95
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 95.92
PRK09564444 coenzyme A disulfide reductase; Reviewed 95.9
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 95.86
PRK08401466 L-aspartate oxidase; Provisional 95.84
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 95.82
PRK05868372 hypothetical protein; Validated 95.81
PRK14727479 putative mercuric reductase; Provisional 95.81
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 95.77
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.73
PRK07121492 hypothetical protein; Validated 95.72
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 95.71
PRK12842574 putative succinate dehydrogenase; Reviewed 95.68
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 95.66
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 95.65
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 95.6
PLN02268435 probable polyamine oxidase 95.59
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 95.56
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.55
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 95.53
PRK11445351 putative oxidoreductase; Provisional 95.52
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 95.51
KOG0404|consensus322 95.5
PLN02676487 polyamine oxidase 95.5
PRK06116450 glutathione reductase; Validated 95.47
PRK12839572 hypothetical protein; Provisional 95.46
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 95.44
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.44
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.39
PRK14694468 putative mercuric reductase; Provisional 95.37
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 95.35
PRK12416463 protoporphyrinogen oxidase; Provisional 95.34
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.34
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 95.31
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 95.22
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 95.21
PRK06175433 L-aspartate oxidase; Provisional 95.19
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 95.18
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 95.16
KOG4254|consensus561 95.13
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 95.07
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.99
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.98
PRK07804 541 L-aspartate oxidase; Provisional 94.92
PRK06753373 hypothetical protein; Provisional 94.9
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 94.84
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 94.84
PRK07236386 hypothetical protein; Provisional 94.78
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 94.75
PLN02507499 glutathione reductase 94.75
PRK07045388 putative monooxygenase; Reviewed 94.75
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 94.65
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 94.65
PRK11883451 protoporphyrinogen oxidase; Reviewed 94.63
PRK08275 554 putative oxidoreductase; Provisional 94.61
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.6
PRK13748561 putative mercuric reductase; Provisional 94.56
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 94.56
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 94.46
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 94.42
PRK02106560 choline dehydrogenase; Validated 94.39
PRK07512 513 L-aspartate oxidase; Provisional 94.36
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.34
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 94.29
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.25
PRK08071 510 L-aspartate oxidase; Provisional 94.22
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 94.22
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 94.21
PRK07845466 flavoprotein disulfide reductase; Reviewed 94.19
COG1231450 Monoamine oxidase [Amino acid transport and metabo 94.18
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 94.13
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 94.0
PRK06475400 salicylate hydroxylase; Provisional 93.86
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 93.86
PF01134392 GIDA: Glucose inhibited division protein A; InterP 93.83
PLN02487569 zeta-carotene desaturase 93.79
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 93.74
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 93.66
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.6
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 93.6
PRK10262321 thioredoxin reductase; Provisional 93.51
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 93.31
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 93.24
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 93.15
PRK09564 444 coenzyme A disulfide reductase; Reviewed 93.12
PLN02568539 polyamine oxidase 93.1
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 93.07
PTZ00318424 NADH dehydrogenase-like protein; Provisional 93.07
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 93.04
PRK07846451 mycothione reductase; Reviewed 93.04
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 92.96
PRK07538413 hypothetical protein; Provisional 92.92
PRK06370463 mercuric reductase; Validated 92.84
PLN02529 738 lysine-specific histone demethylase 1 92.76
PRK07208479 hypothetical protein; Provisional 92.76
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 92.65
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 92.64
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 92.59
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 92.56
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 92.47
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 92.39
PTZ00052499 thioredoxin reductase; Provisional 92.38
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 92.33
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.31
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.26
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 92.24
TIGR02053463 MerA mercuric reductase. This model represents the 92.24
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 92.1
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 92.06
PRK06327475 dihydrolipoamide dehydrogenase; Validated 92.06
PRK13977576 myosin-cross-reactive antigen; Provisional 92.03
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 91.89
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 91.88
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 91.73
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 91.63
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 91.54
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 91.5
PRK14989 847 nitrite reductase subunit NirD; Provisional 91.5
PRK13512 438 coenzyme A disulfide reductase; Provisional 91.39
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 91.12
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 91.08
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 91.02
PRK14989 847 nitrite reductase subunit NirD; Provisional 90.97
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 90.78
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 90.68
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 90.66
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 90.56
PLN03000 881 amine oxidase 90.5
PRK05976472 dihydrolipoamide dehydrogenase; Validated 90.48
PRK07395 553 L-aspartate oxidase; Provisional 90.42
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 90.36
PLN02576496 protoporphyrinogen oxidase 90.31
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 90.21
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 89.91
PLN02661357 Putative thiazole synthesis 88.88
PRK07845 466 flavoprotein disulfide reductase; Reviewed 88.88
PLN02815 594 L-aspartate oxidase 88.67
PRK09077 536 L-aspartate oxidase; Provisional 88.53
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 88.08
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 87.9
PRK13512438 coenzyme A disulfide reductase; Provisional 87.88
KOG1346|consensus659 87.85
PTZ00058561 glutathione reductase; Provisional 87.59
PLN02976 1713 amine oxidase 87.45
PLN02546558 glutathione reductase 87.33
COG2303542 BetA Choline dehydrogenase and related flavoprotei 87.03
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 86.81
PLN02785587 Protein HOTHEAD 86.71
PLN02328 808 lysine-specific histone demethylase 1 homolog 86.52
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 86.29
PTZ00318424 NADH dehydrogenase-like protein; Provisional 86.03
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 85.99
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 85.96
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 85.55
PRK08294 634 phenol 2-monooxygenase; Provisional 85.26
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 85.2
KOG1399|consensus448 84.88
PLN02985 514 squalene monooxygenase 84.7
PRK12770352 putative glutamate synthase subunit beta; Provisio 83.39
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 82.69
PRK10262321 thioredoxin reductase; Provisional 82.6
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 82.36
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 81.92
KOG2404|consensus477 81.37
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 81.17
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 80.76
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 80.15
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-34  Score=254.19  Aligned_cols=238  Identities=51%  Similarity=0.809  Sum_probs=201.1

Q ss_pred             hhHHHhCCcEEEeCceeEEEEEcCCeEEEEeCCCcEEEcCEEEEcCCCChHHHHHHcCCCCCCceeeeeeEEEEeCCCcc
Q psy3952           2 GEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQ   81 (252)
Q Consensus         2 ~~~a~~~G~~i~~~~~V~~i~~~~~~~~V~t~~g~~i~A~~VV~AaG~ws~~l~~~~g~~~~~~~~p~~g~~~~~~~~~~   81 (252)
                      .+.++++|++++++++|++++.++++|.|.|++| ++.|+.||+|+|.|+..+++++|+..++++.|+||+++.+.+...
T Consensus       156 ~~~~~~~Gv~i~~~~~V~~i~~~~~~~~V~~~~g-~i~ad~vV~A~G~~s~~l~~~~g~~~~~~v~p~rGq~~~~~~~~~  234 (393)
T PRK11728        156 AELIQARGGEIRLGAEVTALDEHANGVVVRTTQG-EYEARTLINCAGLMSDRLAKMAGLEPDFRIVPFRGEYYRLAPEKN  234 (393)
T ss_pred             HHHHHhCCCEEEcCCEEEEEEecCCeEEEEECCC-EEEeCEEEECCCcchHHHHHHhCCCCCCceEEeeeEEEEeccccc
Confidence            4667889999999999999998888888999888 899999999999999999999997556889999999999975433


Q ss_pred             ccccceeecCCCCCCCCceeEEEEecCCcEEEcccceecccccCccccccchhHHhhhhcCCCccccchhhhhhhhHHHH
Q psy3952          82 HLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMI  161 (252)
Q Consensus        82 ~~~~~~i~~~~~~~~~~~~~~~~~~~~g~~~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  161 (252)
                      ..++..+|++|++..++.++|++|+.+|++++|+++.....+++|.....+..++.+++...++|..+.+++.+.++.+.
T Consensus       235 ~~~~~~v~~~p~~~~~~~g~~~~p~~~G~~~~G~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (393)
T PRK11728        235 QLVNHLIYPVPDPAFPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSLRDLLEILTYPGFWKLAQKHWRSGLGEMK  314 (393)
T ss_pred             cccCCceecCCCCCCCcceEEeecCCCCCEEECCCcceehhhcCccccCCCHHHHHHHHhccchHHHHHHHHHHHHHHHH
Confidence            45677889999877667889999999999999997765544456654323344444555556667666667888888887


Q ss_pred             hhhChhHHHHHHHHhccCCCCCCceecCCcceeEeecCCCCcccceEEEecCCeEEEeccCCccccchHHHHHHHHHHH
Q psy3952         162 MSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVFHSAGRTLHCRNAPSPAATSSLAIAKHILNEL  240 (252)
Q Consensus       162 ~~~~~~~~~~~~~~~~P~l~~~~i~~~w~G~rp~~~~~d~~p~~~~~i~~~~~~~~~~G~~~~G~t~a~~~g~~va~~i  240 (252)
                      .+.+++.+++.+++++|.|+..++.+.|+|+||+.++||+.|..||+|...++++++.|..|+|+|.||++|+.|++++
T Consensus       315 ~~~~~~~~~~~a~~~~P~l~~~~i~~~~~G~Rp~~~~~d~~~~~d~~i~~~~~~~~~~~~~spg~t~s~~ia~~v~~~~  393 (393)
T PRK11728        315 NSLSKSGYLRLVQKYCPSLTLSDLQPYPAGVRAQAVSRDGKLVDDFLFVETPRSLHVCNAPSPAATSSLPIGEHIVSKV  393 (393)
T ss_pred             hhhhHHHHHHHHHHhCCCCCHHHcccCCCceeeeeeCCCCCccCceEEecCCCEEEEcCCCCchHHccHHHHHHHHhhC
Confidence            7788889999999999999999999999999997667999999999998889999999999999999999999999863



>KOG2665|consensus Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
3dme_A369 Conserved exported protein; structural genomics, P 2e-68
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 2e-05
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 4e-05
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 5e-04
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
 Score =  214 bits (547), Expect = 2e-68
 Identities = 48/251 (19%), Positives = 77/251 (30%), Gaps = 50/251 (19%)

Query: 1   MGEEFCELGGEIRLNQQVESFKENPES---VTISTKQGDHLESSYALVCAGLQADEMALK 57
              +    G ++  +  + + +  PE    +     +   L     +  AGL A  +A +
Sbjct: 156 YQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARR 215

Query: 58  SGCSLE---PAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLG 114
                    P     +G Y  L  A +      IYPVP      LGVH T  + G    G
Sbjct: 216 IEGIPRDSIPPEYLCKGSYFTL--AGRAPFSRLIYPVPQH--AGLGVHLTLDLGGQAKFG 271

Query: 115 PNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELK 174
           P+       E Y                                              ++
Sbjct: 272 PDTEW-IATEDYTLDPRRADVF---------------------------------YAAVR 297

Query: 175 QYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVF-----HSAGRTLHCRNAPSPAATSS 229
            Y   +  G +  G +G+R + +S   +   DF       H     ++     SP  T+S
Sbjct: 298 SYWPALPDGALAPGYTGIRPK-ISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTAS 356

Query: 230 LAIAKHILNEL 240
           LAIA+  L  L
Sbjct: 357 LAIAEETLARL 367


>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
3dme_A369 Conserved exported protein; structural genomics, P 99.96
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.94
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.92
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.92
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.92
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.91
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.91
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.9
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.9
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.9
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.89
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.89
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.89
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.89
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.88
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.88
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.87
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.86
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.85
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.88
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.58
3atr_A453 Conserved archaeal protein; saturating double bond 98.28
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.16
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.15
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.08
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.05
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.05
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.03
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.03
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.98
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.97
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.84
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.82
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.74
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.73
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.72
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.71
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.71
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.7
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.66
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.5
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.48
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.39
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.39
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.38
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.32
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.31
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.3
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.27
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.27
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.26
2cul_A232 Glucose-inhibited division protein A-related PROT 97.14
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.13
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.09
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.05
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.05
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.04
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.04
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.95
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.95
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.94
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.93
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.93
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.92
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 96.91
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.88
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.85
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.85
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.85
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 96.81
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 96.79
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.77
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.75
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.75
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.72
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.7
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.69
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 96.63
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.62
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.62
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.6
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.6
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.59
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 96.57
1fec_A490 Trypanothione reductase; redox-active center, oxid 96.54
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.52
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.5
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 96.5
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.48
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.46
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 96.46
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.43
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.43
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.42
4dna_A463 Probable glutathione reductase; structural genomic 96.41
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 96.38
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.37
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.35
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.31
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.29
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.28
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.24
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.19
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.19
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.18
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.17
2bry_A497 NEDD9 interacting protein with calponin homology a 96.11
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.1
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.09
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.09
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.09
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 96.06
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.06
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.05
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.03
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.99
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 95.98
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.95
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.92
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 95.91
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.9
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 95.85
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.84
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 95.79
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.73
4gut_A776 Lysine-specific histone demethylase 1B; histone de 95.7
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.69
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 95.64
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.63
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 95.6
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 95.52
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.43
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.38
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.32
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.27
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 95.26
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 95.26
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.25
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.23
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 95.19
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.19
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 95.16
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 95.14
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 94.95
1ojt_A482 Surface protein; redox-active center, glycolysis, 94.84
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 94.84
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.83
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 94.74
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.68
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 94.61
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 94.57
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 94.53
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 94.52
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 94.5
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.43
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 94.36
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.25
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 94.23
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.15
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 94.1
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 94.01
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 93.87
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.86
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 93.76
4hb9_A412 Similarities with probable monooxygenase; flavin, 93.71
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 93.66
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 93.52
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 93.49
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 93.34
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 93.22
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 93.15
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.13
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 93.09
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 93.04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 92.96
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 92.89
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 92.83
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 92.83
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 92.77
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 92.7
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 92.66
3r9u_A315 Thioredoxin reductase; structural genomics, center 92.63
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 92.62
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 92.62
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.55
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 92.48
4fk1_A304 Putative thioredoxin reductase; structural genomic 92.47
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 92.11
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 92.1
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 92.03
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 92.0
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 91.99
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 91.98
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 91.97
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 91.83
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 91.78
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 91.36
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 91.35
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 91.31
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 90.87
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 90.79
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 90.72
3r9u_A315 Thioredoxin reductase; structural genomics, center 90.65
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 90.54
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 90.48
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 90.41
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 90.36
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 90.34
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 90.32
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 90.29
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 90.12
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 90.08
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 90.05
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 89.92
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 89.85
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 89.64
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 89.59
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 89.58
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 89.53
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 89.4
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 89.39
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 89.27
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 89.14
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 89.12
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 89.06
1ojt_A 482 Surface protein; redox-active center, glycolysis, 88.95
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 88.75
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 88.54
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 88.29
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 88.12
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 87.76
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 87.6
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 87.33
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 86.82
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 86.65
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 86.44
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 85.98
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 85.8
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 84.52
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 83.72
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 83.33
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 82.53
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 82.33
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 81.92
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 81.61
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 81.5
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 80.84
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 80.41
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
Probab=99.96  E-value=8.2e-28  Score=209.30  Aligned_cols=201  Identities=22%  Similarity=0.311  Sum_probs=157.1

Q ss_pred             hhHHHhCCcEEEeCceeEEEEEcCCe-EEEEeCCC--cEEEcCEEEEcCCCChHHHHHHc-CCCC--CCceeeeeeEEEE
Q psy3952           2 GEEFCELGGEIRLNQQVESFKENPES-VTISTKQG--DHLESSYALVCAGLQADEMALKS-GCSL--EPAIVPFRGEYLL   75 (252)
Q Consensus         2 ~~~a~~~G~~i~~~~~V~~i~~~~~~-~~V~t~~g--~~i~A~~VV~AaG~ws~~l~~~~-g~~~--~~~~~p~~g~~~~   75 (252)
                      .+.++++|++|+++++|++|+.++++ |.|.|.+|  .++.||.||+|+|+|+..|++++ |++.  ..++.|.||+++.
T Consensus       157 ~~~~~~~Gv~i~~~~~v~~i~~~~~~~~~v~~~~g~~~~~~a~~VV~A~G~~s~~l~~~~~g~~~~~~~~i~p~rG~~~~  236 (369)
T 3dme_A          157 QGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFT  236 (369)
T ss_dssp             HHHHHHTTCEEECSCCEEEEEECTTSSEEEEECTTSCEEEEEEEEEECCGGGHHHHHHTEETSCGGGSCCCEEEEEEEEE
T ss_pred             HHHHHHCCCEEECCCEEEEEEEcCCceEEEEECCCceeEEEeCEEEECCCcchHHHHHHhcCCCccccceeeecceEEEE
Confidence            56788999999999999999998765 88988877  47999999999999999999999 8631  2578999999999


Q ss_pred             eCCCccccccceeecCCCCCCCCceeEEEEecCCcEEEcccceecccccCccccccchhHHhhhhcCCCccccchhhhhh
Q psy3952          76 LNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRY  155 (252)
Q Consensus        76 ~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~g~~~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (252)
                      ++.+  ...++.+|+.|...  ..++++.+..+|++++|++.+...   +++. ..+.                     +
T Consensus       237 ~~~~--~~~~~~~~~~p~~~--~~~~~~~~~~~g~~~iG~t~e~~~---~~~~-~~~~---------------------~  287 (369)
T 3dme_A          237 LAGR--APFSRLIYPVPQHA--GLGVHLTLDLGGQAKFGPDTEWIA---TEDY-TLDP---------------------R  287 (369)
T ss_dssp             CSSS--CSCSSEEEECTTCS--SCCCCEEECTTSCEEECCCCEEES---SCCC-CCCG---------------------G
T ss_pred             ECCC--CccCceeecCCCCC--CceEEEeCccCCcEEECCCccccc---cccc-ccCH---------------------H
Confidence            8763  34556677777542  346778888899999999876421   1111 1111                     2


Q ss_pred             hhHHHHhhhChhHHHHHHHHhccCCCCCCceecCCcceeEeecCCCCcccceEE-Ee----cCCeEEEeccCCccccchH
Q psy3952         156 GSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFVF-HS----AGRTLHCRNAPSPAATSSL  230 (252)
Q Consensus       156 ~~~~l~~~~~~~~~~~~~~~~~P~l~~~~i~~~w~G~rp~~~~~d~~p~~~~~i-~~----~~~~~~~~G~~~~G~t~a~  230 (252)
                      .++.         +++.+.+++|.|+..++.+.|+|+||++.++ +.|+.+|+| ++    .+|+|+++|++++|+|+||
T Consensus       288 ~~~~---------l~~~~~~~~P~l~~~~v~~~w~G~Rp~~~~~-~~~d~~p~i~g~~~~~~~~l~~~~G~~~~G~t~ap  357 (369)
T 3dme_A          288 RADV---------FYAAVRSYWPALPDGALAPGYTGIRPKISGP-HEPAADFAIAGPASHGVAGLVNLYGIESPGLTASL  357 (369)
T ss_dssp             GGGG---------HHHHHHTTCTTCCTTCCEEEEEEEEEESSCT-TSCCCCCEEECHHHHCCTTEEEEECCCTTHHHHHH
T ss_pred             HHHH---------HHHHHHHHCCCCChhhceecceeccccccCC-CCCcCCeEEecccccCCCCEEEEeCCCCchHhccH
Confidence            3333         3488999999999999999999999986322 245567777 44    4799999999999999999


Q ss_pred             HHHHHHHHHHH
Q psy3952         231 AIAKHILNELR  241 (252)
Q Consensus       231 ~~g~~va~~i~  241 (252)
                      ++|+.++++|.
T Consensus       358 ~~a~~~a~~i~  368 (369)
T 3dme_A          358 AIAEETLARLA  368 (369)
T ss_dssp             HHHHHHHHHHC
T ss_pred             HHHHHHHHHhh
Confidence            99999999985



>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.47
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.22
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.14
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.09
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 98.95
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 98.69
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.08
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.91
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.79
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.66
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.64
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.63
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.44
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.25
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.2
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.05
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.94
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 96.93
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.92
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.88
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.81
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.79
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 96.74
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.69
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.68
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 96.66
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 96.64
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.55
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.45
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.43
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.4
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.38
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.2
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.18
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.12
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 95.91
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.83
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 95.68
d1pj5a3119 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.6
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.51
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 95.45
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 95.4
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 95.2
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 94.97
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.86
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 94.82
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 94.51
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.36
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 94.12
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 92.85
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.27
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 91.54
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.5
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.39
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 91.12
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 90.32
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 90.27
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 89.36
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 88.97
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 87.83
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 87.29
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 86.68
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 85.16
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.03
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: N,N-dimethylglycine oxidase
species: Arthrobacter globiformis [TaxId: 1665]
Probab=99.47  E-value=6.5e-16  Score=129.17  Aligned_cols=67  Identities=16%  Similarity=0.176  Sum_probs=58.8

Q ss_pred             ChhHHHhCCcEEEeCceeEEEEEcCCeEE-EEeCCCcEEEcCEEEEcCCCChHHHHHHcCCCCCCceeeee
Q psy3952           1 MGEEFCELGGEIRLNQQVESFKENPESVT-ISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFR   70 (252)
Q Consensus         1 l~~~a~~~G~~i~~~~~V~~i~~~~~~~~-V~t~~g~~i~A~~VV~AaG~ws~~l~~~~g~~~~~~~~p~~   70 (252)
                      |++.|+++|++|+++++|++|+.+++++. |.|++| +|+||+||||||+|+.+|++++|.  .+|+.+.+
T Consensus       154 l~~~a~~~gv~i~~~~~V~~i~~~~~~v~~V~T~~g-~i~a~~VV~aaG~~s~~l~~~~g~--~lP~~~~~  221 (305)
T d1pj5a2         154 LIKRTESAGVTYRGSTTVTGIEQSGGRVTGVQTADG-VIPADIVVSCAGFWGAKIGAMIGM--AVPPDGGP  221 (305)
T ss_dssp             HHHHHHHTTCEEECSCCEEEEEEETTEEEEEEETTE-EEECSEEEECCGGGHHHHHHTTTC--CCCTTSCC
T ss_pred             HHhhhhcccccccCCceEEEEEEeCCEEEEEeccce-eEECCEEEEecchhHHHHHHHcCC--cccccccc
Confidence            35678899999999999999999999864 999999 999999999999999999999997  46665543



>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure