Psyllid ID: psy3994


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK
cHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEHHHccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHcHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHccccHcccEEEEcHHccccHHHHHEEccccEccHHHHcHHcc
MDVIKTFNQElsslydtkppiskaKITAITRSAIRAIKFYKHVVQSVEKFIIkckpeykvpaLYVIDSLVrqsrhqfqdkdvfgprfaRNLKATFQhlyqcppedksKIIRVLNLwqknevftpdiihplfdmadpnhpiHRELAEIQARNGVENMCSTTLWIGHLSKLVqeeelsdtfgeygdvvsinlipprgcaFVCMNRRQDAAKALYKLKNTKLQGKTItlawapgkgmkdkdwkdfwevqdgvsyipydrlskeidydyledggvfdedtvplwlk
MDVIKTFNQelsslydtkppiskaKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYklkntklqgktitlawapgkgmkdkdwKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK
MDVIKTFNQELSSLYDTKPPISkakitaitrsairaikFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK
********************ISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLW**
**VIKTFNQELSSLY************AITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVR*************PRFARNLKATFQHLYQCPPE*************************LFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITL********************DGVSYIPYDRLSKEIDYDYLEDGGVFDE***P****
MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK
MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q9UPN6 1271 Protein SCAF8 OS=Homo sap yes N/A 0.475 0.105 0.748 2e-54
Q6DID3 1268 Protein SCAF8 OS=Mus musc yes N/A 0.475 0.105 0.748 2e-54
O95104 1147 Splicing factor, arginine no N/A 0.475 0.116 0.740 3e-53
Q63623 1268 Protein SCAF8 OS=Rattus n no N/A 0.475 0.105 0.733 2e-52
Q63627 1048 Splicing factor, arginine no N/A 0.464 0.125 0.433 7e-26
Q9LEB4409 Polyadenylate-binding pro N/A N/A 0.468 0.322 0.291 2e-09
Q9SX79432 Polyadenylate-binding pro yes N/A 0.319 0.208 0.326 2e-08
O60176473 Uncharacterized RNA-bindi yes N/A 0.226 0.135 0.369 4e-08
Q9SX80434 Polyadenylate-binding pro no N/A 0.255 0.165 0.361 4e-08
Q93W34415 Polyadenylate-binding pro no N/A 0.294 0.2 0.313 1e-07
>sp|Q9UPN6|SCAF8_HUMAN Protein SCAF8 OS=Homo sapiens GN=SCAF8 PE=1 SV=1 Back     alignment and function desciption
 Score =  212 bits (540), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/135 (74%), Positives = 117/135 (86%), Gaps = 1/135 (0%)

Query: 1   MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKV 60
           M+ +KTFN EL SL D KPPISKAK+T IT++AI+AIKFYKHVVQSVEKFI KCKPEYKV
Sbjct: 1   MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV 60

Query: 61  PALYVIDSLVRQSRHQF-QDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKN 119
           P LYVIDS+VRQSRHQF Q+KDVF PRF+ N+ +TFQ+LY+CP +DKSKI+RVLNLWQKN
Sbjct: 61  PGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN 120

Query: 120 EVFTPDIIHPLFDMA 134
            VF  +II PL DMA
Sbjct: 121 NVFKSEIIQPLLDMA 135




May play a role in mRNA processing.
Homo sapiens (taxid: 9606)
>sp|Q6DID3|SCAF8_MOUSE Protein SCAF8 OS=Mus musculus GN=Scaf8 PE=1 SV=1 Back     alignment and function description
>sp|O95104|SFR15_HUMAN Splicing factor, arginine/serine-rich 15 OS=Homo sapiens GN=SCAF4 PE=1 SV=3 Back     alignment and function description
>sp|Q63623|SCAF8_RAT Protein SCAF8 OS=Rattus norvegicus GN=Scaf8 PE=1 SV=1 Back     alignment and function description
>sp|Q63627|SFR15_RAT Splicing factor, arginine/serine-rich 15 (Fragment) OS=Rattus norvegicus GN=Scaf4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 Back     alignment and function description
>sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 Back     alignment and function description
>sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 Back     alignment and function description
>sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 Back     alignment and function description
>sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
321462197263 hypothetical protein DAPPUDRAFT_14394 [D 0.925 0.992 0.685 1e-107
443715596274 hypothetical protein CAPTEDRAFT_122321, 0.932 0.959 0.532 1e-82
391327585 657 PREDICTED: uncharacterized protein LOC10 0.971 0.417 0.510 2e-80
260790611263 hypothetical protein BRAFLDRAFT_264027 [ 0.854 0.916 0.546 6e-77
47227869262 unnamed protein product [Tetraodon nigro 0.907 0.977 0.523 1e-71
91094229 1145 PREDICTED: similar to conserved hypothet 0.539 0.132 0.751 7e-63
242024705 1343 conserved hypothetical protein [Pediculu 0.560 0.117 0.716 3e-62
170050233 1014 conserved hypothetical protein [Culex qu 0.5 0.139 0.760 1e-60
347969782 1392 AGAP003369-PA [Anopheles gambiae str. PE 0.507 0.102 0.736 2e-60
307198209 1633 Putative RNA-binding protein 16 [Harpegn 0.507 0.087 0.75 5e-60
>gi|321462197|gb|EFX73222.1| hypothetical protein DAPPUDRAFT_14394 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/270 (68%), Positives = 225/270 (83%), Gaps = 9/270 (3%)

Query: 10  ELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSL 69
           +LSSLYD KPPISKAK+TAIT+ AI+A+KFYKHVVQSVEKF+ KC+PEYK+P LYVIDS+
Sbjct: 1   QLSSLYDMKPPISKAKMTAITKGAIKAVKFYKHVVQSVEKFLQKCRPEYKIPGLYVIDSI 60

Query: 70  VRQSRHQF-QDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIH 128
           VRQSRHQF  DKDVF PRF++N+  TF  +YQC  E+KSK+IRVLNLWQKN VF P++I 
Sbjct: 61  VRQSRHQFGADKDVFAPRFSKNVTYTFYFIYQCTGEEKSKVIRVLNLWQKNAVFPPEVIQ 120

Query: 129 PLFDMADPNHPIHRELAEIQARNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSI 188
           PLFDMAD + P  ++ A         ++CSTTLW+GHLSKLVQ+EELSDTFG+YG+++SI
Sbjct: 121 PLFDMADSSLPPTKKEAL--------SVCSTTLWVGHLSKLVQQEELSDTFGQYGEILSI 172

Query: 189 NLIPPRGCAFVCMNRRQDAAKALYKLKNTKLQGKTITLAWAPGKGMKDKDWKDFWEVQDG 248
           +LIPPRGCAFVCM+RRQDA +AL KL   KLQGK ITLAWAPGKG+K K+WKDFWEV  G
Sbjct: 173 DLIPPRGCAFVCMHRRQDAYRALTKLAGHKLQGKAITLAWAPGKGVKAKEWKDFWEVDQG 232

Query: 249 VSYIPYDRLSKEIDYDYLEDGGVFDEDTVP 278
           VSY+P+ RLS+  D + LE+GG FDE+T+P
Sbjct: 233 VSYVPWQRLSQMTDLEALEEGGSFDEETLP 262




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|443715596|gb|ELU07509.1| hypothetical protein CAPTEDRAFT_122321, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|391327585|ref|XP_003738278.1| PREDICTED: uncharacterized protein LOC100908485 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|260790611|ref|XP_002590335.1| hypothetical protein BRAFLDRAFT_264027 [Branchiostoma floridae] gi|229275527|gb|EEN46346.1| hypothetical protein BRAFLDRAFT_264027 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|47227869|emb|CAG09032.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|91094229|ref|XP_967119.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270016224|gb|EFA12670.1| hypothetical protein TcasGA2_TC010693 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242024705|ref|XP_002432767.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518252|gb|EEB20029.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170050233|ref|XP_001859912.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167871912|gb|EDS35295.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347969782|ref|XP_314272.5| AGAP003369-PA [Anopheles gambiae str. PEST] gi|333469268|gb|EAA09643.5| AGAP003369-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307198209|gb|EFN79224.1| Putative RNA-binding protein 16 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
FB|FBgn0034598 1306 CG4266 [Drosophila melanogaste 0.539 0.116 0.594 8.7e-96
ZFIN|ZDB-GENE-030131-4817 1286 wu:fd99c08 "wu:fd99c08" [Danio 0.475 0.104 0.659 2.2e-73
UNIPROTKB|F1LPT8 1267 Rbm16 "Protein Rbm16" [Rattus 0.475 0.105 0.666 4.3e-73
MGI|MGI:1925212 1268 Scaf8 "SR-related CTD-associat 0.475 0.105 0.666 4.3e-73
UNIPROTKB|Q9UPN6 1271 SCAF8 "Protein SCAF8" [Homo sa 0.475 0.105 0.666 5.5e-73
UNIPROTKB|F1SB23 1347 SCAF8 "Uncharacterized protein 0.475 0.099 0.666 6.9e-73
UNIPROTKB|O95104 1147 SCAF4 "Splicing factor, argini 0.475 0.116 0.674 2e-72
UNIPROTKB|F1LSM7 1226 Sfrs15 "Protein Sfrs15" [Rattu 0.475 0.109 0.674 2.1e-72
UNIPROTKB|I3LPZ9 1132 SCAF4 "Uncharacterized protein 0.475 0.118 0.674 2.4e-72
UNIPROTKB|F1P0Y4 1092 SCAF4 "Uncharacterized protein 0.475 0.122 0.659 9.1e-72
FB|FBgn0034598 CG4266 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 504 (182.5 bits), Expect = 8.7e-96, Sum P(2) = 8.7e-96
 Identities = 91/153 (59%), Positives = 111/153 (72%)

Query:     1 MDVIKTFNQELSSLYDTKPPISXXXXXXXXXXXXXXXXFYKHVVQSVEKFIIKCKPEYKV 60
             M+ +  FN ELS LYD++PPIS                 YKHVVQSVEKFI+KCKPEYKV
Sbjct:     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKV 60

Query:    61 PALYVIDSLVRQSRHQF-QDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKN 119
             P LYVIDS+VRQSRHQ+  DKD+F PRF RNL  TF +L++C PEDKS+IIRVLNLWQKN
Sbjct:    61 PGLYVIDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKN 120

Query:   120 EVFTPDIIHPLFDMADPNHPIHRELAEIQARNG 152
              VF  ++I P+FD+ADPNHPI+ ++  +    G
Sbjct:   121 NVFKSEVIQPIFDLADPNHPIYHQMPPVGGSGG 153


GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
ZFIN|ZDB-GENE-030131-4817 wu:fd99c08 "wu:fd99c08" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPT8 Rbm16 "Protein Rbm16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1925212 Scaf8 "SR-related CTD-associated factor 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UPN6 SCAF8 "Protein SCAF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB23 SCAF8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O95104 SCAF4 "Splicing factor, arginine/serine-rich 15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSM7 Sfrs15 "Protein Sfrs15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LPZ9 SCAF4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0Y4 SCAF4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DID3SCAF8_MOUSENo assigned EC number0.74810.47510.1056yesN/A
Q9UPN6SCAF8_HUMANNo assigned EC number0.74810.47510.1054yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 5e-43
cd03562114 cd03562, CID, CID (CTD-Interacting Domain) domain 2e-33
smart00582124 smart00582, RPR, domain present in proteins, which 1e-30
cd1246279 cd12462, RRM_SCAF8, RNA recognition motif in SR-re 4e-24
cd1246181 cd12461, RRM_SCAF4, RNA recognition motif found in 2e-23
pfam0481864 pfam04818, CTD_bind, RNA polymerase II-binding dom 1e-15
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-15
smart0036073 smart00360, RRM, RNA recognition motif 2e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-14
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 4e-14
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-12
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-12
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 4e-10
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 6e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 6e-10
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-09
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 9e-09
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 1e-08
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-08
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 1e-08
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-08
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-08
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 5e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 6e-08
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-07
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-07
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 1e-07
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 5e-07
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 5e-07
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 8e-07
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 1e-06
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 4e-06
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 4e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 4e-06
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 5e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 5e-06
cd1233179 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif 6e-06
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 6e-06
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 6e-06
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 7e-06
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 7e-06
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-05
cd1256872 cd12568, RRM3_MRD1, RNA recognition motif 3 in yea 2e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 2e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 4e-05
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4e-05
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 5e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 5e-05
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 5e-05
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-05
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 6e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 7e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 7e-05
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 8e-05
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 8e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-05
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 9e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 1e-04
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-04
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 1e-04
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 1e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-04
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 2e-04
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 3e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 3e-04
cd1256972 cd12569, RRM4_RBM19, RNA recognition motif 4 in RN 3e-04
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 4e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 4e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 4e-04
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 4e-04
cd1243676 cd12436, RRM1_2_MATR3_like, RNA recognition motif 5e-04
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 6e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 6e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 7e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 8e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 9e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.001
cd1243571 cd12435, RRM_GW182_like, RNA recognition motif in 0.001
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.001
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 0.002
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.002
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.002
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 0.002
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 0.002
cd1244373 cd12443, RRM_MCM3A_like, RNA recognition motif in 0.002
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 0.002
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.002
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 0.002
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 0.002
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 0.002
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 0.002
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 0.002
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 0.002
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.003
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 0.003
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.003
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 0.003
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 0.003
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 0.004
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 0.004
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 0.004
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 0.004
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
 Score =  141 bits (357), Expect = 5e-43
 Identities = 52/77 (67%), Positives = 62/77 (80%)

Query: 157 CSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKN 216
           CSTTLWIGHLSK V EE+L + F EYG++ SI++IPPRGCA+VCM  RQDA +AL KL+N
Sbjct: 1   CSTTLWIGHLSKKVTEEDLKNLFEEYGEIQSIDMIPPRGCAYVCMETRQDAHRALQKLRN 60

Query: 217 TKLQGKTITLAWAPGKG 233
            KL GK I +AWAP KG
Sbjct: 61  VKLAGKKIKVAWAPNKG 77


This subfamily corresponds to the RRM in a new class of SCAFs (SR-like CTD-associated factors), including SCAF4, SCAF8 and similar proteins. The biological role of SCAF4 remains unclear, but it shows high sequence similarity to SCAF8 (also termed CDC5L complex-associated protein 7, or RNA-binding motif protein 16, or CTD-binding SR-like protein RA8). SCAF8 is a nuclear matrix protein that interacts specifically with a highly serine-phosphorylated form of the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II (pol II). The pol II CTD plays a role in coupling transcription and pre-mRNA processing. In addition, SCAF8 co-localizes primarily with transcription sites that are enriched in nuclear matrix fraction, which is known to contain proteins involved in pre-mRNA processing. Thus, SCAF8 may play a direct role in coupling with both, transcription and pre-mRNA processing, processes. SCAF8 and SCAF4 both contain a conserved N-terminal CTD-interacting domain (CID), an atypical RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNPs (ribonucleoprotein domain), and serine/arginine-rich motifs. Length = 77

>gnl|CDD|239621 cd03562, CID, CID (CTD-Interacting Domain) domain family; CID is present in several RNA-processing factors such as Pcf11 and Nrd1 Back     alignment and domain information
>gnl|CDD|214731 smart00582, RPR, domain present in proteins, which are involved in regulation of nuclear pre-mRNA Back     alignment and domain information
>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and CTD-associated factor 4 (SCAF4) and similar proteins Back     alignment and domain information
>gnl|CDD|218279 pfam04818, CTD_bind, RNA polymerase II-binding domain Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in Saccharomyces cerevisiae protein Nrd1, Schizosaccharomyces pombe Rpb7-binding protein seb1 and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241013 cd12569, RRM4_RBM19, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the matrin 3 family of nuclear proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240881 cd12435, RRM_GW182_like, RNA recognition motif in the GW182 family proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240889 cd12443, RRM_MCM3A_like, RNA recognition motif in 80 kDa MCM3-associated protein (Map80) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
KOG0132|consensus 894 100.0
cd03562114 CID CID (CTD-Interacting Domain) domain family; CI 99.86
KOG0148|consensus321 99.82
smart00582121 RPR domain present in proteins, which are involved 99.8
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.72
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.67
KOG0148|consensus 321 99.66
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.65
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.63
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.62
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.6
KOG2669|consensus325 99.58
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.57
KOG0121|consensus153 99.56
KOG0107|consensus195 99.56
PLN03120 260 nucleic acid binding protein; Provisional 99.55
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.54
KOG0111|consensus 298 99.53
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.52
KOG0125|consensus 376 99.52
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.5
KOG0122|consensus270 99.49
PLN03213 759 repressor of silencing 3; Provisional 99.48
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.47
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.47
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.47
KOG0145|consensus 360 99.47
KOG0117|consensus 506 99.46
KOG2071|consensus 579 99.45
KOG0144|consensus 510 99.45
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.44
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.44
KOG0117|consensus 506 99.43
smart0036272 RRM_2 RNA recognition motif. 99.42
KOG0105|consensus 241 99.42
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.42
KOG0145|consensus 360 99.42
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.42
KOG0113|consensus 335 99.41
KOG0144|consensus 510 99.4
PLN03121 243 nucleic acid binding protein; Provisional 99.39
KOG0149|consensus 247 99.39
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.38
KOG4207|consensus 256 99.37
KOG0114|consensus124 99.37
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.36
KOG0153|consensus377 99.34
KOG0109|consensus 346 99.34
KOG0130|consensus170 99.33
KOG0126|consensus219 99.32
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.31
KOG0131|consensus203 99.3
KOG0127|consensus 678 99.25
smart0036071 RRM RNA recognition motif. 99.25
KOG0131|consensus203 99.23
KOG0124|consensus 544 99.23
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.22
KOG0123|consensus 369 99.21
KOG0108|consensus 435 99.2
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.18
KOG0146|consensus371 99.14
KOG0109|consensus 346 99.13
KOG0146|consensus 371 99.12
KOG0110|consensus725 99.06
KOG4206|consensus221 99.06
smart0036170 RRM_1 RNA recognition motif. 99.03
KOG0147|consensus 549 99.01
KOG0110|consensus725 98.99
PF0481864 CTD_bind: RNA polymerase II-binding domain.; Inter 98.96
KOG0151|consensus 877 98.95
KOG0127|consensus 678 98.93
KOG4661|consensus 940 98.89
KOG0415|consensus 479 98.81
KOG4212|consensus 608 98.78
KOG4208|consensus214 98.78
KOG4212|consensus608 98.78
KOG0123|consensus 369 98.75
KOG0124|consensus 544 98.68
KOG1457|consensus 284 98.64
KOG4660|consensus 549 98.63
KOG4205|consensus 311 98.62
KOG0106|consensus216 98.57
KOG0116|consensus419 98.52
KOG0533|consensus243 98.45
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.44
KOG1190|consensus492 98.43
KOG4205|consensus311 98.39
PF12243139 CTK3: CTD kinase subunit gamma CTK3 98.39
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.32
KOG1548|consensus 382 98.3
KOG4209|consensus231 98.29
KOG4454|consensus 267 98.21
KOG4206|consensus221 97.97
KOG0226|consensus290 97.93
KOG1457|consensus284 97.9
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.89
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.87
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.83
KOG0106|consensus216 97.82
KOG4211|consensus 510 97.75
KOG0120|consensus500 97.75
KOG1456|consensus 494 97.57
KOG1190|consensus492 97.54
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.4
KOG1548|consensus382 97.38
KOG0151|consensus 877 97.33
KOG3152|consensus278 97.31
KOG4210|consensus285 97.3
KOG0112|consensus 975 97.3
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.26
KOG1855|consensus 484 97.24
KOG2416|consensus 718 97.2
KOG1456|consensus494 97.18
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 97.18
KOG0147|consensus549 97.13
KOG0120|consensus500 97.11
KOG1995|consensus 351 96.96
KOG4676|consensus 479 96.94
KOG2193|consensus 584 96.78
KOG0129|consensus 520 96.77
KOG2314|consensus 698 96.63
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.61
KOG0129|consensus520 96.53
KOG4211|consensus 510 96.5
KOG0105|consensus241 96.48
KOG0112|consensus 975 96.37
KOG4849|consensus 498 96.06
KOG2202|consensus260 95.99
KOG4307|consensus944 95.86
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.61
KOG2135|consensus526 95.24
KOG1996|consensus378 95.1
KOG4368|consensus 757 94.8
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.76
KOG0128|consensus881 94.58
KOG4285|consensus350 94.49
KOG4574|consensus 1007 94.34
KOG0115|consensus 275 93.83
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 93.8
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.39
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 93.29
cd03561133 VHS VHS domain family; The VHS domain is present i 93.14
KOG1365|consensus508 93.11
KOG0128|consensus881 93.0
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.62
KOG2253|consensus 668 92.47
KOG2068|consensus 327 92.43
KOG4210|consensus285 92.1
KOG4307|consensus 944 89.86
KOG1365|consensus 508 89.82
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 88.28
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 88.17
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 87.96
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 87.75
KOG4660|consensus549 87.37
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 86.69
KOG4410|consensus396 83.49
KOG2591|consensus 684 82.59
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 81.76
KOG2193|consensus 584 80.36
>KOG0132|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-56  Score=412.57  Aligned_cols=279  Identities=59%  Similarity=0.975  Sum_probs=258.1

Q ss_pred             CchhHHHHHHHHhhhcCCCCCCHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhcCCCCccceeehhhHHHHHhhhhcc-C
Q psy3994           1 MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQ-D   79 (282)
Q Consensus         1 m~~~~~f~~~L~~l~~~~~p~s~~~I~~lt~~a~~~~~~~~~~v~~~~~~~~~~~p~~kl~~lYv~Dsi~r~~~~~~~-~   79 (282)
                      ||.+++|+.+|.+|.++|.|+|++||..||+.|+++++.|+|+|+.+|+||++|+|+|||++|||||||+|+++++++ +
T Consensus         1 me~v~~Fn~eL~SL~DsK~~IS~sKi~~ITkaAikaIk~ykhVVqsVeKfi~kCkpe~Kl~gLYVIDSIVRqsrhq~~~~   80 (894)
T KOG0132|consen    1 MDAVKEFNGELDSLEDSKPGISGSKILKITKAAIKAIKLYKHVVQSVEKFIKKCKPEYKLPGLYVIDSIVRQSRHQFGKE   80 (894)
T ss_pred             ChHHHHHHHHHHHhhccCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccCeeEEehHHHHHHHHhhccc
Confidence            899999999999999999999999999999999999999999999999999999999999999999999999999999 9


Q ss_pred             CCCchhhHHHHHHHHHHHhhcCChhhHHHHHHHHHhhccCcccCCccccccccCCCCCCCCh------------------
Q psy3994          80 KDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMADPNHPIH------------------  141 (282)
Q Consensus        80 ~~~~~~~f~~~l~~~f~~v~~~~~~~~~k~~~~l~~w~~~~~f~~~~i~~~~~~~~~~~~~~------------------  141 (282)
                      +++|.++|.++++.+|..++.|..++..++++++|.|+++++|+.++|++++++++..++..                  
T Consensus        81 kd~F~prf~~n~~~tf~~L~~c~~edks~iIrvlNlwqkn~VfK~e~IqpLlDm~~~s~~~~~p~~~~~~~p~~~v~~~~  160 (894)
T KOG0132|consen   81 KDVFGPRFSKNFTGTFQNLYECPQEDKSDIIRVLNLWQKNNVFKSEIIQPLLDMADGSGLSVFPKSPLQALPSPGVLQAP  160 (894)
T ss_pred             ccccCCccchhHHHHHHHHHhcCHHHHHHHHHhhhhhhcccchhHHHHHHHHHHHhccCccccCCCccCCCCCccccCCC
Confidence            99999999999999999999999999999999999999999999999999999887654310                  


Q ss_pred             --hhh----------------------H----------------Hh----------------------------------
Q psy3994         142 --REL----------------------A----------------EI----------------------------------  147 (282)
Q Consensus       142 --~~~----------------------~----------------~~----------------------------------  147 (282)
                        .++                      +                .+                                  
T Consensus       161 ~sda~asvadIs~~~~g~~sqq~~~s~~~~g~d~~~~~~~q~~~~il~~~~~~~~l~~~~~l~~~f~~~~d~e~~~eP~k  240 (894)
T KOG0132|consen  161 SSDALASVADISNDTAGQQSQQLNISGNPSGGDVGSQAALQRSTQILNEEPAEQGLSFNPKLLDRFDYPDDAESSEEPQK  240 (894)
T ss_pred             chhhhhhhcccccCccccchhhccccCCccccchhhhhhhhHHHHHhcccchhhhhhcChhHHhcCCCCcchhhccCCcc
Confidence              000                      0                00                                  


Q ss_pred             -------------h------------------------------------------------------------------
Q psy3994         148 -------------Q------------------------------------------------------------------  148 (282)
Q Consensus       148 -------------~------------------------------------------------------------------  148 (282)
                                   |                                                                  
T Consensus       241 e~a~~~~v~e~Lqq~f~~~~~g~q~q~~~pl~~~~~~~~n~~qs~p~~~~~~q~~lp~~~~~qq~~~~~vq~q~~~~~~~  320 (894)
T KOG0132|consen  241 EQAILPQVAEVLQQHFQATMIGAQQQSALPLGNPMPQFMNVPQSIPSGPPGQQTGLPNDTQVQQITLMNVQAQQNVITEQ  320 (894)
T ss_pred             ccchhhhHHHHhhhhccccccchhhccCCCCCCCCCccccccccCCCCCccccccCCCcccccccceeecccccCCcccc
Confidence                         0                                                                  


Q ss_pred             ----------h---------------------------------------------------------------------
Q psy3994         149 ----------A---------------------------------------------------------------------  149 (282)
Q Consensus       149 ----------~---------------------------------------------------------------------  149 (282)
                                +                                                                     
T Consensus       321 ~d~~e~e~~~~~n~~~r~~~v~~r~r~~~~s~s~~~~~r~~RsrS~sr~~~~~rrs~Srs~~r~~~s~r~~~~er~~re~  400 (894)
T KOG0132|consen  321 QDRIEKEAFRNYNQEARPHGVRSRSRSAPASASRSRRGRLSRSRSRSRRSRSRRRSGSRSRDRIRHSLRDRLGERRDREH  400 (894)
T ss_pred             ccHHHHHHhcccchhhhhhccCCCcCCCCcccccccccccccccCCCcccccccCCCCCcccccCccCchhhcCcccCcc
Confidence                      0                                                                     


Q ss_pred             ------------cCCCCCCCCcEEEecCCCccCcHHHHHhhhccCCceEEEEEeCCCcEEEEEecCHHHHHHHHHHhCCC
Q psy3994         150 ------------RNGVENMCSTTLWIGHLSKLVQEEELSDTFGEYGDVVSINLIPPRGCAFVCMNRRQDAAKALYKLKNT  217 (282)
Q Consensus       150 ------------~~~~~~~~~~~l~V~nl~~~~te~~l~~~f~~~G~i~~~~~~~~kg~aFV~f~~~~~A~~Ai~~l~g~  217 (282)
                                  +++...+.++|||||+|+.+++|.+|..+|+.||+|.+|.++.++|||||++..+.+|++|+.+|++.
T Consensus       401 ereRr~kglP~I~pd~isV~SrTLwvG~i~k~v~e~dL~~~feefGeiqSi~li~~R~cAfI~M~~RqdA~kalqkl~n~  480 (894)
T KOG0132|consen  401 ERERRKKGLPTIPPDHISVCSRTLWVGGIPKNVTEQDLANLFEEFGEIQSIILIPPRGCAFIKMVRRQDAEKALQKLSNV  480 (894)
T ss_pred             ccccccccCCCCCCcceeEeeeeeeeccccchhhHHHHHHHHHhcccceeEeeccCCceeEEEEeehhHHHHHHHHHhcc
Confidence                        24566678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCeeEEEEeecCCCCCCCccccccccCCCeeeecCCCCCcchhhhhhhcCcccccCCCCCCCC
Q psy3994         218 KLQGKTITLAWAPGKGMKDKDWKDFWEVQDGVSYIPYDRLSKEIDYDYLEDGGVFDEDTVPLWLK  282 (282)
Q Consensus       218 ~~~g~~l~v~~a~~~~~~~~~~~~~~~~~~g~~~~p~~~~~~~~~~~~~~~~~~~~~~~~p~~~~  282 (282)
                      .+.++.|+|.||.++|.+. +|++|||.+.|+++|||++| + .|++.|++|+|+|.+++|+.+|
T Consensus       481 kv~~k~Iki~Wa~g~G~ks-e~k~~wD~~lGVt~IP~~kL-t-~dl~~~~egam~d~~t~~p~~k  542 (894)
T KOG0132|consen  481 KVADKTIKIAWAVGKGPKS-EYKDYWDVELGVTYIPWEKL-T-DDLEAWCEGAMLDGTTGPPEWK  542 (894)
T ss_pred             cccceeeEEeeeccCCcch-hhhhhhhcccCeeEeehHhc-C-HHHHHhhhhceecCccCCcccc
Confidence            9999999999999999998 89999999999999999999 4 4599999999999999988654



>cd03562 CID CID (CTD-Interacting Domain) domain family; CID is present in several RNA-processing factors such as Pcf11 and Nrd1 Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>smart00582 RPR domain present in proteins, which are involved in regulation of nuclear pre-mRNA Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG2669|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG2071|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>PF04818 CTD_bind: RNA polymerase II-binding domain Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PF12243 CTK3: CTD kinase subunit gamma CTK3 Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4368|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4410|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
2diw_A152 Solution Structure Of The Rpr Domain Of Putative Rn 4e-48
3d9i_A145 Snapshots Of The Rna Processing Factor Scaf8 Bound 9e-48
3d9j_A145 Snapshots Of The Rna Processing Factor Scaf8 Bound 2e-47
3d9p_A145 Snapshots Of The Rna Processing Factor Scaf8 Bound 1e-46
3d9o_A145 Snapshots Of The Rna Processing Factor Scaf8 Bound 5e-46
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 4e-08
1sxl_A97 Resonance Assignments And Solution Structure Of The 5e-08
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 8e-08
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 2e-06
2la4_A101 Nmr Structure Of The C-Terminal Rrm Domain Of Poly( 4e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-04
2ytc_A85 Solution Structure Of Rna Binding Domain In Pre-Mrn 2e-04
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 2e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 2e-04
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-04
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 9e-04
>pdb|2DIW|A Chain A, Solution Structure Of The Rpr Domain Of Putative Rna- Binding Protein 16 Length = 152 Back     alignment and structure

Iteration: 1

Score = 187 bits (476), Expect = 4e-48, Method: Compositional matrix adjust. Identities = 91/140 (65%), Positives = 104/140 (74%), Gaps = 1/140 (0%) Query: 1 MDVIKTFNQELSSLYDTKPPISXXXXXXXXXXXXXXXXFYKHVVQSVEKFIIKCKPEYKV 60 M+ +KTFN EL SL D KPPIS FYKHVVQSVEKFI KCKPEYKV Sbjct: 10 MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV 69 Query: 61 PALYVIDSLVRQSRHQF-QDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKN 119 P LYVIDS+VRQSRHQF Q+KDVF PRF+ N+ +TFQ+LY+CP +DKSKI+RVLNLWQKN Sbjct: 70 PGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN 129 Query: 120 EVFTPDIIHPLFDMADPNHP 139 VF +II PL DMA + P Sbjct: 130 NVFKSEIIQPLLDMAAGSGP 149
>pdb|3D9I|A Chain A, Snapshots Of The Rna Processing Factor Scaf8 Bound To Different Phosphorylated Forms Of The Carboxy-Terminal Domain Of Rna-Polymerase Ii Length = 145 Back     alignment and structure
>pdb|3D9J|A Chain A, Snapshots Of The Rna Processing Factor Scaf8 Bound To Different Phosphorylated Forms Of The Carboxy-Terminal Domain Of Rna-Polymerase Ii Length = 145 Back     alignment and structure
>pdb|3D9P|A Chain A, Snapshots Of The Rna Processing Factor Scaf8 Bound To Different Phosphorylated Forms Of The Carboxy-Terminal Domain Of Rna-Polymerase Ii Length = 145 Back     alignment and structure
>pdb|3D9O|A Chain A, Snapshots Of The Rna Processing Factor Scaf8 Bound To Different Phosphorylated Forms Of The Carboxy-Terminal Domain Of Rna-Polymerase Ii Length = 145 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2LA4|A Chain A, Nmr Structure Of The C-Terminal Rrm Domain Of Poly(U) Binding 1 Length = 101 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2YTC|A Chain A, Solution Structure Of Rna Binding Domain In Pre-Mrna- Splicing Factor Rbm22 Length = 85 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3d9j_A145 RNA-binding protein 16; SCAF8, RNA polymerase II C 2e-48
3clj_A157 Protein NRD1; CTD-interacting domain, nucleus, pho 3e-38
1sz9_A144 PCF11 protein; RNA polymerase II CTD interacting d 9e-28
4fld_A135 Regulation of nuclear PRE-mRNA domain-containing 1 1e-25
4flb_A132 Regulation of nuclear PRE-mRNA domain-containing; 3e-24
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-23
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 9e-23
2km4_A142 Regulator of TY1 transposition protein 103; CTD-in 2e-21
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 9e-21
1x5p_A97 Negative elongation factor E; structure genomics, 2e-20
2cpj_A99 Non-POU domain-containing octamer-binding protein; 8e-20
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-19
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-19
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 5e-19
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 6e-19
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-17
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 8e-17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 8e-17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-12
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 9e-17
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-16
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-16
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-15
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-15
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-15
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-15
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 5e-15
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-15
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-15
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-10
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-15
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-15
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 8e-15
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-15
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 8e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 9e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-14
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-14
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-14
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-14
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-14
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-14
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-14
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-14
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-14
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-14
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-14
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-14
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-14
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-14
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-14
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-14
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 8e-14
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-13
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-13
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-13
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-13
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-13
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-13
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-13
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-13
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 6e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 5e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-10
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-13
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-13
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-12
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-09
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 7e-13
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 7e-13
2f3j_A177 RNA and export factor binding protein 2; RRM domai 8e-13
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-13
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-13
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-11
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-12
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-11
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-12
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-12
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-12
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-12
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 3e-12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 3e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-12
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-12
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-12
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-07
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-11
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-11
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-11
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-09
2div_A99 TRNA selenocysteine associated protein; structural 4e-11
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-11
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 7e-11
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-11
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-10
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-10
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-10
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-10
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-09
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 3e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 8e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-07
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 4e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 6e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 7e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 7e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 5e-06
2cqd_A116 RNA-binding region containing protein 1; RNA recog 5e-06
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 7e-06
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 4e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-05
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 3e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-05
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 9e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-04
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 6e-04
>3d9j_A RNA-binding protein 16; SCAF8, RNA polymerase II CTD interacting domain, arm repeats phospho-CTD, phosphoprotein, transcription; 1.60A {Homo sapiens} PDB: 3d9k_A* 3d9l_A* 3d9m_A* 3d9n_A* 3d9p_A* 3d9i_A 3d9o_A* 2diw_A Length = 145 Back     alignment and structure
 Score =  156 bits (396), Expect = 2e-48
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 2/143 (1%)

Query: 1   MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKV 60
           M+ +KTFN EL SL D KPPISKAK+T IT++AI+AIKFYKHVVQSVEKFI KCKPEYKV
Sbjct: 1   MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV 60

Query: 61  PALYVIDSLVRQSRHQF-QDKDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKN 119
           P LYVIDS+VRQSRHQF Q+KDVF PRF+ N+ +TFQ+LY+CP +DKSKI+RVLNLWQKN
Sbjct: 61  PGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN 120

Query: 120 EVFTPDIIHPLFDMAD-PNHPIH 141
            VF  +II PL DMA    H  H
Sbjct: 121 NVFKSEIIQPLLDMAAALEHHHH 143


>3clj_A Protein NRD1; CTD-interacting domain, nucleus, phosphoprotein, RNA polymer binding protein, RNA binding protein; 2.10A {Saccharomyces cerevisiae} Length = 157 Back     alignment and structure
>1sz9_A PCF11 protein; RNA polymerase II CTD interacting domain, arm repeats, transcription; 2.10A {Saccharomyces cerevisiae} SCOP: a.118.9.4 PDB: 1sza_A* 2bf0_X Length = 144 Back     alignment and structure
>4flb_A Regulation of nuclear PRE-mRNA domain-containing; structural genomics consortium, SGC, protein binding; 1.80A {Homo sapiens} Length = 132 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2km4_A Regulator of TY1 transposition protein 103; CTD-interacting domain, RNA polymerase II binding protein, phosphoprotein; NMR {Saccharomyces cerevisiae} PDB: 2l0i_A* Length = 142 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
3d9j_A145 RNA-binding protein 16; SCAF8, RNA polymerase II C 99.97
3clj_A157 Protein NRD1; CTD-interacting domain, nucleus, pho 99.97
1sz9_A144 PCF11 protein; RNA polymerase II CTD interacting d 99.91
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.83
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.82
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.82
4fu3_A135 Regulation of nuclear PRE-mRNA domain-containing 1 99.82
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.81
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.81
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.8
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.8
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.8
4flb_A132 Regulation of nuclear PRE-mRNA domain-containing; 99.79
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.79
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.79
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.78
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.78
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.78
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.78
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.78
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.78
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.77
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.77
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.77
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.77
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.77
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.77
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.77
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.77
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.77
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.77
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.76
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.76
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.76
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.76
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.76
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.76
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.76
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.76
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.76
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.76
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.76
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.76
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.76
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.76
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.76
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.75
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.75
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.75
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.75
1x5p_A97 Negative elongation factor E; structure genomics, 99.75
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.75
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.75
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.75
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.75
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.75
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.75
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.75
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.75
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.75
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.74
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.74
2div_A99 TRNA selenocysteine associated protein; structural 99.74
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.74
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.74
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.74
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.74
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.74
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.74
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.74
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.74
2dis_A109 Unnamed protein product; structural genomics, RRM 99.73
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.73
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.73
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.73
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.73
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.73
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.73
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.73
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.73
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.73
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.73
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.73
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.72
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.72
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.72
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.72
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.72
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.72
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.72
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.71
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.71
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.71
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.71
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.71
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.71
2km4_A142 Regulator of TY1 transposition protein 103; CTD-in 99.71
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.71
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.7
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.7
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.7
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.7
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.7
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.7
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.7
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.7
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.7
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.7
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.7
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.7
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.69
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.69
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.69
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.69
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.69
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.69
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.69
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.69
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.69
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.69
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.69
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.69
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.68
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.68
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.68
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.68
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.68
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.68
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.67
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.67
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.67
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.66
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.66
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.66
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.66
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.65
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.65
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.65
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.65
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.65
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.45
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.64
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.64
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.64
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.62
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.62
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.62
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.62
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.62
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.61
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.61
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.6
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.59
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.59
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.59
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.59
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.59
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.59
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.59
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.59
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.59
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.58
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.58
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.58
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.58
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.57
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.57
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.57
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.56
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.56
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.56
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.56
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.56
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.55
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.55
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.55
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.54
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.54
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.54
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.52
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.47
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.46
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.46
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.44
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.43
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.41
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.37
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.36
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.28
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.15
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.05
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.81
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.66
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.53
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.2
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.05
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.98
2i2y_A150 Fusion protein consists of immunoglobin G- binding 96.94
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.56
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.46
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.29
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.47
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.46
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 91.71
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 89.12
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 88.47
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 88.22
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 87.62
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 86.28
3g2s_A149 C-terminal fragment of sortilin-related receptor; 84.31
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 84.21
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 84.07
>3d9j_A RNA-binding protein 16; SCAF8, RNA polymerase II CTD interacting domain, arm repeats phospho-CTD, phosphoprotein, transcription; 1.60A {Homo sapiens} PDB: 3d9k_A* 3d9l_A* 3d9m_A* 3d9n_A* 3d9p_A* 3d9i_A 3d9o_A* 2diw_A Back     alignment and structure
Probab=99.97  E-value=1.7e-31  Score=208.78  Aligned_cols=134  Identities=75%  Similarity=1.200  Sum_probs=126.4

Q ss_pred             CchhHHHHHHHHhhhcCCCCCCHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhcCCCCccceeehhhHHHHHhhhhcc-C
Q psy3994           1 MDVIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQ-D   79 (282)
Q Consensus         1 m~~~~~f~~~L~~l~~~~~p~s~~~I~~lt~~a~~~~~~~~~~v~~~~~~~~~~~p~~kl~~lYv~Dsi~r~~~~~~~-~   79 (282)
                      |+++++|++.|++|.++++|+|+++|++||.||++|++++++||+.|+++|++|+|.+||++|||+|||+|+++++.+ +
T Consensus         1 m~~v~~f~~~L~~L~~~k~~~S~~~I~~LT~~a~~~~~~~~~IV~~~~~~i~k~~~~~KL~~LYL~DsIvrn~~~k~~~~   80 (145)
T 3d9j_A            1 MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE   80 (145)
T ss_dssp             -CHHHHHHHHHHGGGGSCSSCCHHHHHHHHHHHHHTGGGHHHHHHHHHHHHHHSCGGGHHHHHHHHHHHHHHHHHHHCTT
T ss_pred             CcHHHHHHHHHHHHHhccCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccceeehhhhhHHHHHHhhhhcCCc
Confidence            999999999999999999779999999999999999999999999999999999999999999999999999999875 4


Q ss_pred             CCCchhhHHHHHHHHHHHhhcCChhhHHHHHHHHHhhccCcccCCccccccccCC
Q psy3994          80 KDVFGPRFARNLKATFQHLYQCPPEDKSKIIRVLNLWQKNEVFTPDIIHPLFDMA  134 (282)
Q Consensus        80 ~~~~~~~f~~~l~~~f~~v~~~~~~~~~k~~~~l~~w~~~~~f~~~~i~~~~~~~  134 (282)
                      .+.|++.|+..|.++|..++.+++..+.++.+++++|+++++|+++.++.+.+..
T Consensus        81 ~~~f~~~F~~~L~~~f~~~~~~~~~~r~kl~rLl~iW~~r~vF~~~~l~~l~~~l  135 (145)
T 3d9j_A           81 KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMA  135 (145)
T ss_dssp             TCSHHHHHHHHHHHHHHHHTSSCGGGHHHHHHHHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             cccHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHh
Confidence            5689999999999999999998899999999999999999999999998887643



>3clj_A Protein NRD1; CTD-interacting domain, nucleus, phosphoprotein, RNA polymer binding protein, RNA binding protein; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1sz9_A PCF11 protein; RNA polymerase II CTD interacting domain, arm repeats, transcription; 2.10A {Saccharomyces cerevisiae} SCOP: a.118.9.4 PDB: 1sza_A* 2bf0_X Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>4fu3_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, domain swapping, transc; HET: MSE; 1.90A {Homo sapiens} PDB: 4fld_A* Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4flb_A Regulation of nuclear PRE-mRNA domain-containing; structural genomics consortium, SGC, protein binding; 1.80A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2km4_A Regulator of TY1 transposition protein 103; CTD-interacting domain, RNA polymerase II binding protein, phosphoprotein; NMR {Saccharomyces cerevisiae} PDB: 2l0i_A* Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1szaa_144 a.118.9.4 (A:) PCF11 protein {Baker's yeast (Sacch 2e-24
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-14
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-12
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 5e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-10
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 4e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-10
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 8e-10
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-09
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-09
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-09
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-09
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-09
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 5e-09
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 7e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 9e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-08
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-08
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-08
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 8e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-07
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 9e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-06
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-06
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 6e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-06
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 6e-06
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-05
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-05
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 3e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 6e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 7e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 1e-04
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-04
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 7e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.001
>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ENTH/VHS domain
family: RPR domain (SMART 00582 )
domain: PCF11 protein
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 94.0 bits (233), Expect = 2e-24
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 16/134 (11%)

Query: 3   VIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPA 62
           ++K FN  L  L     PI    IT +T+ A   I   ++ V ++E  I KC P+ K+ A
Sbjct: 8   IVKDFNSILEELTFNSRPI----ITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYA 63

Query: 63  LYVIDSLVRQSRHQFQDKDVFGPRFARNLKATFQHLYQCPPED-KSKIIRVLNLWQKN-- 119
            Y +DS+ +     +         F+RNL   ++  Y       ++K+I +  LW     
Sbjct: 64  FYALDSICKNVGSPYTI------YFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPND 117

Query: 120 ---EVFTPDIIHPL 130
               +F    +  +
Sbjct: 118 TGLPLFEGSALEKI 131


>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1szaa_144 PCF11 protein {Baker's yeast (Saccharomyces cerevi 99.86
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.84
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.84
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.83
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.83
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.83
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.83
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.83
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.82
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.82
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.82
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.82
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.81
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.81
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.8
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.8
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.79
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.79
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.79
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.79
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.79
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.79
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.79
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.79
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.79
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.78
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.78
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.78
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.78
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.77
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.77
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.77
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.76
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.76
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.76
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.76
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.75
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.75
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.74
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.74
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.74
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.74
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.74
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.74
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.73
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.73
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.72
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.72
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.71
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.71
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.69
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.68
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.62
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.6
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.6
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.6
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.55
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.55
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.54
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.51
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.51
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.44
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.55
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.5
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.92
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 93.88
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 88.48
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 87.05
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 86.31
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 81.26
>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ENTH/VHS domain
family: RPR domain (SMART 00582 )
domain: PCF11 protein
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.86  E-value=1.2e-22  Score=156.88  Aligned_cols=120  Identities=27%  Similarity=0.451  Sum_probs=110.2

Q ss_pred             hhHHHHHHHHhhhcCCCCCCHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhcCCCCccceeehhhHHHHHhhhhccCCCC
Q psy3994           3 VIKTFNQELSSLYDTKPPISKAKITAITRSAIRAIKFYKHVVQSVEKFIIKCKPEYKVPALYVIDSLVRQSRHQFQDKDV   82 (282)
Q Consensus         3 ~~~~f~~~L~~l~~~~~p~s~~~I~~lt~~a~~~~~~~~~~v~~~~~~~~~~~p~~kl~~lYv~Dsi~r~~~~~~~~~~~   82 (282)
                      .+++|+..|++|.+    +|+++|++||.||++|.++++++|++|++++++|+|.+||+.|||+|+|+++.      ...
T Consensus         8 ~~~~f~~~L~~L~~----ns~~~I~~Lt~~a~~~~~~a~~Iv~~i~~~i~~~~~~~KL~~LYLiddI~~n~------~~~   77 (144)
T d1szaa_           8 IVKDFNSILEELTF----NSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNV------GSP   77 (144)
T ss_dssp             HHHHHHHHHTTCSS----CCHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHT------CTT
T ss_pred             HHHHHHHHHHHHhh----ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCcccchhhhhhHHHHHHHh------HHH
Confidence            48999999999955    68889999999999999999999999999999999999999999999999998      456


Q ss_pred             chhhHHHHHHHHHHHhhc-CChhhHHHHHHHHHhhccCc-----ccCCcccccccc
Q psy3994          83 FGPRFARNLKATFQHLYQ-CPPEDKSKIIRVLNLWQKNE-----VFTPDIIHPLFD  132 (282)
Q Consensus        83 ~~~~f~~~l~~~f~~v~~-~~~~~~~k~~~~l~~w~~~~-----~f~~~~i~~~~~  132 (282)
                      |...|.+.+.+.|.+++. ++++.++++.+++++|..++     +|+.+.++.+..
T Consensus        78 y~~~f~~~l~~~f~~~y~~~~~~~r~kl~rll~iW~~r~~~~~~vFp~~~l~~ie~  133 (144)
T d1szaa_          78 YTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQ  133 (144)
T ss_dssp             HHHHHHTTHHHHHHHHHTTSCHHHHHHHHHHHHHHSSGGGCSSCSSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhccCCCCcCCCCHHHHHHHHH
Confidence            888899999999999998 88999999999999999877     688888777655



>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure