Psyllid ID: psy4037


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MGYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEGLLFKKGQSIWALMEEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEVSRISLKKNHVAISPYEVKLLF
ccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHcccc
cccEccccEEcHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccEEEccHEEEEcc
mgylipgfTISFSQMLLKKIFRhgecqhthgqHFARWTMLSAGILYGvsrqsslekKEEKLRVIRAQKKAIKDAKLAEEKKRANEGLLFKKGQSIWALMEEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEVSRISlkknhvaispyevkllf
MGYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVsrqsslekkeekLRVIRAQKkaikdaklaeekkranegllfkkgqSIWALMEEKKEEKLRVIRAQKkaikdaklaeekkranevsrislkknhvaispyevkllf
MGYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEGLLFKKGQSIWALMEEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEVSRISLKKNHVAISPYEVKLLF
**YLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVS*************************************LLFKKGQSIWALM******************************************************
*GYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVSRQS**************************************************************************************KNHVAISPYEVKLLF
MGYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEGLLFKKGQSIWALMEEKKEEKLRVIRAQKKAI**************VSRISLKKNHVAISPYEVKLLF
*GYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEGLLFKKGQSIWALMEEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEVSRISLKKNHVAISPYEVKLLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYLIPGFTISFSQMLLKKIFRHGECQHTHGQHFARWTMLSAGILYGVSRQSSxxxxxxxxxxxxxxxxxxxxxKLAEEKKRANEGLLFKKGQSIWALMEEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEVSRISLKKNHVAISPYEVKLLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
312376691 350 hypothetical protein AND_12414 [Anophele 0.529 0.231 0.464 3e-10
2135859381 CG3321, isoform A [Drosophila melanogast 0.326 0.617 0.66 1e-09
19532902281 GM24162 [Drosophila sechellia] gi|195501 0.326 0.617 0.64 2e-09
19490074981 GG16851 [Drosophila erecta] gi|190651621 0.326 0.617 0.64 6e-09
19557092781 GD18958 [Drosophila simulans] gi|1941993 0.326 0.617 0.62 6e-09
19544605879 GK10942 [Drosophila willistoni] gi|19416 0.346 0.670 0.584 7e-09
19474084481 GF17508 [Drosophila ananassae] gi|190625 0.326 0.617 0.62 1e-08
19539158080 GJ22808 [Drosophila virilis] gi|19415252 0.326 0.625 0.62 1e-08
19556137572 GD14258 [Drosophila simulans] gi|1942025 0.352 0.75 0.555 3e-08
12577548581 GA17372 [Drosophila pseudoobscura pseudo 0.320 0.604 0.612 4e-08
>gi|312376691|gb|EFR23706.1| hypothetical protein AND_12414 [Anopheles darlingi] Back     alignment and taxonomy information
 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (61%), Gaps = 3/84 (3%)

Query: 33  HFARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANEG---LLF 89
           +F RW+ L  G+ YG   Q  L K+E  +R I AQ+K I+DAKLA+EKKR  EG   +  
Sbjct: 251 NFGRWSFLVVGVAYGAYHQQRLAKREVGIREIEAQQKVIRDAKLAQEKKRNQEGNVKITS 310

Query: 90  KKGQSIWALMEEKKEEKLRVIRAQ 113
           K   SI A ME+ +EE++  IR Q
Sbjct: 311 KLNLSILATMEQDEEEEVHDIREQ 334




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|21358593|ref|NP_650356.1| CG3321, isoform A [Drosophila melanogaster] gi|24646815|ref|NP_731903.1| CG3321, isoform B [Drosophila melanogaster] gi|320542802|ref|NP_001189221.1| CG3321, isoform C [Drosophila melanogaster] gi|3643815|gb|AAC42662.1| 9 kD basic protein [Drosophila melanogaster] gi|7299873|gb|AAF55049.1| CG3321, isoform B [Drosophila melanogaster] gi|10726524|gb|AAG22153.1| CG3321, isoform A [Drosophila melanogaster] gi|16767972|gb|AAL28204.1| GH08548p [Drosophila melanogaster] gi|220947632|gb|ACL86359.1| CG3321-PA [synthetic construct] gi|220956994|gb|ACL91040.1| CG3321-PA [synthetic construct] gi|318068774|gb|ADV37312.1| CG3321, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195329022|ref|XP_002031210.1| GM24162 [Drosophila sechellia] gi|195501630|ref|XP_002097875.1| GE24232 [Drosophila yakuba] gi|38048575|gb|AAR10190.1| similar to Drosophila melanogaster CG3321, partial [Drosophila yakuba] gi|194120153|gb|EDW42196.1| GM24162 [Drosophila sechellia] gi|194183976|gb|EDW97587.1| GE24232 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194900749|ref|XP_001979918.1| GG16851 [Drosophila erecta] gi|190651621|gb|EDV48876.1| GG16851 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195570927|ref|XP_002103455.1| GD18958 [Drosophila simulans] gi|194199382|gb|EDX12958.1| GD18958 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195446058|ref|XP_002070608.1| GK10942 [Drosophila willistoni] gi|194166693|gb|EDW81594.1| GK10942 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194740844|ref|XP_001952900.1| GF17508 [Drosophila ananassae] gi|190625959|gb|EDV41483.1| GF17508 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195391580|ref|XP_002054438.1| GJ22808 [Drosophila virilis] gi|194152524|gb|EDW67958.1| GJ22808 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195561375|ref|XP_002077468.1| GD14258 [Drosophila simulans] gi|194202582|gb|EDX16158.1| GD14258 [Drosophila simulans] Back     alignment and taxonomy information
>gi|125775485|ref|XP_001358959.1| GA17372 [Drosophila pseudoobscura pseudoobscura] gi|195144508|ref|XP_002013238.1| GL23504 [Drosophila persimilis] gi|54638700|gb|EAL28102.1| GA17372 [Drosophila pseudoobscura pseudoobscura] gi|194102181|gb|EDW24224.1| GL23504 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
FB|FBgn003822481 CG3321 [Drosophila melanogaste 0.339 0.641 0.653 2.7e-13
GENEDB_PFALCIPARUM|PF11_0486 2055 PF11_0486 "MAEBL, putative" [P 0.620 0.046 0.349 2.4e-06
UNIPROTKB|Q8IHP3 2055 PF11_0486 "MAEBL, putative" [P 0.620 0.046 0.349 2.4e-06
CGD|CAL0006174 1399 orf19.2208 [Candida albicans ( 0.588 0.064 0.311 0.00039
UNIPROTKB|Q5A2K0 1399 NST1 "Stress response protein 0.588 0.064 0.311 0.00039
UNIPROTKB|E2RAD2508 C1orf114 "Uncharacterized prot 0.522 0.157 0.347 0.00042
UNIPROTKB|Q5TID7509 C1orf114 "Uncharacterized prot 0.522 0.157 0.347 0.00043
ZFIN|ZDB-GENE-051130-171 atp5ib "ATP synthase, H+ trans 0.366 0.788 0.327 0.00047
FB|FBgn0038224 CG3321 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 174 (66.3 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 34/52 (65%), Positives = 41/52 (78%)

Query:    34 FARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANE 85
             F RW++L  GI YG + QS L KKEEKLR I AQ+KA++DAKLAEEKKR+ E
Sbjct:    14 FGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAE 65


GO:0008553 "hydrogen-exporting ATPase activity, phosphorylative mechanism" evidence=ISS
GO:0015992 "proton transport" evidence=ISS
GO:0000276 "mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)" evidence=ISS
GO:0015986 "ATP synthesis coupled proton transport" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GENEDB_PFALCIPARUM|PF11_0486 PF11_0486 "MAEBL, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IHP3 PF11_0486 "MAEBL, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
CGD|CAL0006174 orf19.2208 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A2K0 NST1 "Stress response protein NST1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAD2 C1orf114 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TID7 C1orf114 "Uncharacterized protein C1orf114" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051130-1 atp5ib "ATP synthase, H+ transporting, mitochondrial F0 complex, subunit e, duplicate b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
pfam0568083 pfam05680, ATP-synt_E, ATP synthase E chain 2e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
>gnl|CDD|218688 pfam05680, ATP-synt_E, ATP synthase E chain Back     alignment and domain information
 Score = 51.3 bits (123), Expect = 2e-09
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 34 FARWTMLSAGILYGVSRQSSLEKKEEKLRVIRAQKKAIKDAKLAEEKKRANE 85
            R++ L AG++YG   Q SL+KKEEK+R   AQ+K I+ AK A  KK+  +
Sbjct: 12 VLRYSALVAGVVYGAKHQRSLKKKEEKIREYEAQEKLIEKAKAAYAKKKQAK 63


This family consists of several ATP synthase E chain sequences which are components of the CF(0) subunit. Length = 83

>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
PF0568086 ATP-synt_E: ATP synthase E chain; InterPro: IPR008 99.92
KOG4326|consensus81 99.91
KOG4326|consensus81 97.59
PF0568086 ATP-synt_E: ATP synthase E chain; InterPro: IPR008 89.99
PF09989221 DUF2229: CoA enzyme activase uncharacterised domai 85.16
PRK09174204 F0F1 ATP synthase subunit B'; Validated 84.84
KOG2629|consensus 300 84.55
>PF05680 ATP-synt_E: ATP synthase E chain; InterPro: IPR008386 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
Probab=99.92  E-value=8.3e-26  Score=163.78  Aligned_cols=66  Identities=32%  Similarity=0.328  Sum_probs=62.5

Q ss_pred             CCCCCCchhhhhhHHHHHHHHHHhhhhhhhcc---HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhh
Q psy4037          24 GECQHTHGQHFARWTMLSAGILYGVSRQSSLE---KKEEKLRVIRAQKKAIKDAKLAEEKKRANEGLLF   89 (153)
Q Consensus        24 ~~v~VSPlInv~RwSAL~lGI~YGa~Hqs~Lk---~~aeeeRe~eakEKlI~qAK~a~aKk~~a~~el~   89 (153)
                      +||+|||+|||+|||||++||+||++||+||+   ++++.++++++++++|+|||++|+|+++...+..
T Consensus         2 ~p~~VSp~inv~RySaL~~Gv~YG~~~~~~L~~~~~~~~~~~e~~~~eklie~AK~a~ak~~~~~~~~~   70 (86)
T PF05680_consen    2 PPVQVSPLINVLRYSALGLGVVYGAYHQRYLKAKAKKEAAEREYEAKEKLIEQAKAAYAKKHAPKQEAS   70 (86)
T ss_pred             CCcccCcchHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCchhhhh
Confidence            68999999999999999999999999999999   7789999999999999999999999999888644



ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include: F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit E found in the F0 complex of F-ATPases. Mitochondrial F-ATPases can associate together to form dimeric or oligomeric complexes, such interactions involving the physical association of membrane-embedded F0 complexes. In yeast, the F0 complex E subunit appears to play an important role in supporting F-ATPase dimerisation. This subunit is anchored to the inner mitochondrial membrane via its N-terminal region, which is involved in stabilising subunits G and K of the F0 complex. The C-terminal region of subunit E is hydrophilic, protruding into the intermembrane space where it can also help stabilise the F-ATPase dimer complex []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)

>KOG4326|consensus Back     alignment and domain information
>KOG4326|consensus Back     alignment and domain information
>PF05680 ATP-synt_E: ATP synthase E chain; InterPro: IPR008386 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF09989 DUF2229: CoA enzyme activase uncharacterised domain (DUF2229); InterPro: IPR018709 Proteins containing this domain include various bacterial hypothetical proteins, as well as CoA enzyme activases Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>KOG2629|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00