Psyllid ID: psy4057


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MNIILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFMERPKKVRKQPAPVEDPAEAKKSKKKAAKEQARLMQAQQQQMQALSVQQPPVSQPAPPAPMATAGVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK
ccccccccccccEEEEccccHHHHHHHHHHHHcccccEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccccccccEEEcccccccHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEcccccEEEEEEccHHHHHHHHHHHcccEEcccccEEEEEEcc
ccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEccHHHHHHHHHHccccEEccEEcEEEEcccccHHHHHHHcccccccHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEcccccEEEEEEccHHHHHHHHHHHccccccccccEEEEEEcc
MNIILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALrsmqgfpfydkpmriqysktdSDVISKIKGtfmerpkkvrkqpapvedpaeAKKSKKKAAKEQARLMQAQQQQMQALsvqqppvsqpappapmatagvpeqppnqilfltnlpeETSEMMLSMLFnqfpgfkevrlvpnrhdiaFVEFENEMQSAAAKLALhgfkitpthamKISFAKK
MNIILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTDSDVISKIkgtfmerpkkvrkqpapvedpaeakKSKKKAAKEQARLMQAQQQQMQALSVQQPPVSQPAPPAPMATAGVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFkitpthamkisfakk
MNIILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFMERPKKVRKQPAPVEDPaeakkskkkaakeqarlmqaqqqqmqalsvqqppvsqpappapMATAGVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK
**IILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYS***************************************************************************************ILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHA********
*******ICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTD******IKGTFMERPKKVRK*******************************QMQALSVQQPPVSQPAPPAPMATAGVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK
MNIILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFME**************************************************************GVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK
*****AHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFM****************************************************************VPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIILAHICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFMERPKKVRKQPAPVEDPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQPPVSQPAPPAPMATAGVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query246 2.2.26 [Sep-21-2011]
P45429282 U1 small nuclear ribonucl N/A N/A 0.959 0.836 0.554 7e-72
Q2KIR1282 U1 small nuclear ribonucl yes N/A 0.926 0.808 0.550 1e-71
Q06AA4282 U1 small nuclear ribonucl yes N/A 0.926 0.808 0.550 1e-71
P09012282 U1 small nuclear ribonucl yes N/A 0.926 0.808 0.547 3e-71
Q62189287 U1 small nuclear ribonucl yes N/A 0.926 0.794 0.549 2e-70
Q9CQI7225 U2 small nuclear ribonucl no N/A 0.865 0.946 0.599 3e-70
P43332216 U1 small nuclear ribonucl yes N/A 0.776 0.884 0.668 5e-70
P08579225 U2 small nuclear ribonucl no N/A 0.865 0.946 0.586 2e-69
Q8H1S6229 U2 small nuclear ribonucl yes N/A 0.914 0.982 0.455 9e-53
O22922232 U2 small nuclear ribonucl no N/A 0.926 0.982 0.443 2e-52
>sp|P45429|SNRPA_XENLA U1 small nuclear ribonucleoprotein A OS=Xenopus laevis GN=snrpa PE=2 SV=1 Back     alignment and function desciption
 Score =  270 bits (690), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 184/274 (67%), Gaps = 38/274 (13%)

Query: 11  TNFVYVTH----ISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNA 66
            N +Y+ +    I   +LKKSLYAIFSQFGQI+DI+  + LKMRGQAFVIFKE +SATNA
Sbjct: 9   NNTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRNLKMRGQAFVIFKETSSATNA 68

Query: 67  LRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFMERPKKVR-KQPAPVEDPAEAKKSKKK 125
           LRSMQGFPFYDKPMRIQYSKTDSD+I+K+KGTF+ER +K + K+   V +    K +   
Sbjct: 69  LRSMQGFPFYDKPMRIQYSKTDSDIIAKMKGTFVERDRKRQEKRKVKVPEVQGVKNAMPG 128

Query: 126 AA-----KEQARLMQ-----AQQQQMQALSVQQPPVSQPA--PPAPMATAGVP------- 166
           AA       Q   MQ      Q  +M  ++ Q P +  P   PP  MA   +P       
Sbjct: 129 AALLPGVPGQMAAMQDMPGMTQAPRMMHMAGQAPYMHHPGMMPPPGMAPGQMPPGGMPHG 188

Query: 167 --------------EQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAF 212
                         E PPN ILFLTNLPEET+E+MLSMLFNQFPGFKEVRLVP RHDIAF
Sbjct: 189 QLMPGQMAPMQPISENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAF 248

Query: 213 VEFENEMQSAAAKLALHGFKITPTHAMKISFAKK 246
           VEF+NE+Q+ AA+ +L GFKIT +++MKISFAKK
Sbjct: 249 VEFDNEVQAGAARESLQGFKITQSNSMKISFAKK 282




Binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP.
Xenopus laevis (taxid: 8355)
>sp|Q2KIR1|SNRPA_BOVIN U1 small nuclear ribonucleoprotein A OS=Bos taurus GN=SNRPA PE=2 SV=1 Back     alignment and function description
>sp|Q06AA4|SNRPA_PIG U1 small nuclear ribonucleoprotein A OS=Sus scrofa GN=SNRPA PE=2 SV=1 Back     alignment and function description
>sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3 Back     alignment and function description
>sp|Q62189|SNRPA_MOUSE U1 small nuclear ribonucleoprotein A OS=Mus musculus GN=Snrpa PE=2 SV=3 Back     alignment and function description
>sp|Q9CQI7|RU2B_MOUSE U2 small nuclear ribonucleoprotein B'' OS=Mus musculus GN=Snrpb2 PE=2 SV=1 Back     alignment and function description
>sp|P43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A OS=Drosophila melanogaster GN=snf PE=1 SV=1 Back     alignment and function description
>sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens GN=SNRPB2 PE=1 SV=1 Back     alignment and function description
>sp|Q8H1S6|RU2B2_ARATH U2 small nuclear ribonucleoprotein B'' 2 OS=Arabidopsis thaliana GN=At1g06960 PE=1 SV=1 Back     alignment and function description
>sp|O22922|RU2B1_ARATH U2 small nuclear ribonucleoprotein B'' OS=Arabidopsis thaliana GN=U2B'' PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
383847977231 PREDICTED: U2 small nuclear ribonucleopr 0.902 0.961 0.720 8e-87
270047496231 U1 small nuclear ribonucleoprotein A [Ap 0.902 0.961 0.720 1e-86
380024353231 PREDICTED: U2 small nuclear ribonucleopr 0.902 0.961 0.720 1e-86
340726396233 PREDICTED: u2 small nuclear ribonucleopr 0.902 0.952 0.716 3e-86
307195443231 U2 small nuclear ribonucleoprotein B'' [ 0.902 0.961 0.716 8e-86
156548050230 PREDICTED: U2 small nuclear ribonucleopr 0.898 0.960 0.708 5e-83
58394659216 AGAP011637-PA [Anopheles gambiae str. PE 0.829 0.944 0.649 2e-79
242247219224 U1 small nuclear ribonucleoprotein A-lik 0.857 0.941 0.645 6e-79
312372120216 hypothetical protein AND_20571 [Anophele 0.772 0.879 0.714 2e-78
255710361202 U1 small nuclear ribonucleoprotein A [Oc 0.776 0.945 0.695 7e-78
>gi|383847977|ref|XP_003699629.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  325 bits (834), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 193/240 (80%), Gaps = 18/240 (7%)

Query: 11  TNFVYVTH----ISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNA 66
            N +Y+ +    I   +LKKSLYAIFSQFGQI+DIVALKTLKMRGQAFVIFKEIASATNA
Sbjct: 6   NNTIYINNLNEKIKKDELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIASATNA 65

Query: 67  LRSMQGFPFYDKPMRIQYSKTDSDVISKIKGTFMERPKKVRKQPAPVEDPAEAKKSKKKA 126
           LRSMQGFPFYDKPMRIQY+KTDSD+I+K+KGT+ ERPKK  K+  P  D  EAK++KK+ 
Sbjct: 66  LRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTYAERPKKP-KRVVPAAD-EEAKRAKKR- 122

Query: 127 AKEQARLMQAQQQQMQALSVQQPPVSQPAPPAPMATAGVPEQPPNQILFLTNLPEETSEM 186
           AKEQA+   +QQ    A   Q P          +  A VPEQPPNQILFLTNLP+ETSEM
Sbjct: 123 AKEQAK--HSQQISYHAGVPQHP---------GLVNAAVPEQPPNQILFLTNLPDETSEM 171

Query: 187 MLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK 246
           MLSMLFNQFPGFKEVRLVPNRHDIAFVEFENE+QS AAK AL GFKITP+HAMKISFAKK
Sbjct: 172 MLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEVQSGAAKDALQGFKITPSHAMKISFAKK 231




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270047496|ref|NP_001161808.1| U1 small nuclear ribonucleoprotein A [Apis mellifera] Back     alignment and taxonomy information
>gi|380024353|ref|XP_003695965.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Apis florea] Back     alignment and taxonomy information
>gi|340726396|ref|XP_003401545.1| PREDICTED: u2 small nuclear ribonucleoprotein B''-like [Bombus terrestris] gi|350423999|ref|XP_003493658.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307195443|gb|EFN77329.1| U2 small nuclear ribonucleoprotein B'' [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156548050|ref|XP_001606482.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 1 [Nasonia vitripennis] gi|345485456|ref|XP_003425274.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|58394659|ref|XP_320869.2| AGAP011637-PA [Anopheles gambiae str. PEST] gi|55235062|gb|EAA00418.2| AGAP011637-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242247219|ref|NP_001156146.1| U1 small nuclear ribonucleoprotein A-like [Acyrthosiphon pisum] gi|239790514|dbj|BAH71814.1| ACYPI003668 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312372120|gb|EFR20150.1| hypothetical protein AND_20571 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|255710361|gb|ACU31000.1| U1 small nuclear ribonucleoprotein A [Ochlerotatus triseriatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
FB|FBgn0003449216 snf "sans fille" [Drosophila m 0.394 0.449 0.785 1.6e-73
UNIPROTKB|Q2KIR1282 SNRPA "U1 small nuclear ribonu 0.398 0.347 0.727 9.8e-68
UNIPROTKB|P09012282 SNRPA "U1 small nuclear ribonu 0.398 0.347 0.727 9.8e-68
UNIPROTKB|Q06AA4282 SNRPA "U1 small nuclear ribonu 0.398 0.347 0.727 9.8e-68
RGD|1307416281 Snrpa "small nuclear ribonucle 0.398 0.348 0.727 9.8e-68
UNIPROTKB|F1M6Z8285 Snrpa "Protein Snrpa" [Rattus 0.398 0.343 0.727 9.8e-68
ZFIN|ZDB-GENE-030131-2841281 snrpa "small nuclear ribonucle 0.373 0.327 0.763 2.6e-67
UNIPROTKB|E1C0I4226 SNRPB2 "Uncharacterized protei 0.333 0.362 0.817 4.2e-67
MGI|MGI:1855690287 Snrpa "small nuclear ribonucle 0.398 0.341 0.707 6.8e-67
UNIPROTKB|G5E5Y0218 SNRPB2 "Uncharacterized protei 0.378 0.426 0.698 8.7e-67
FB|FBgn0003449 snf "sans fille" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 392 (143.0 bits), Expect = 1.6e-73, Sum P(2) = 1.6e-73
 Identities = 77/98 (78%), Positives = 88/98 (89%)

Query:    19 ISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDK 78
             I   +LKKSLYAIFSQFGQI+DIVALKTLKMRGQAFVIFKEI SA+NALR+MQGFPFYDK
Sbjct:    18 IKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDK 77

Query:    79 PMRIQYSKTDSDVISKIKGTFMERPKKVRK-QPAPVED 115
             PM+I YSK+DSD+++KIKGTF ERPKKV+  +PAP  D
Sbjct:    78 PMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTD 115


GO:0048477 "oogenesis" evidence=IMP;TAS
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS;NAS;IDA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS;NAS
GO:0019099 "female germ-line sex determination" evidence=NAS
GO:0005692 "U11 snRNP" evidence=ISS
GO:0030619 "U1 snRNA binding" evidence=IDA;NAS
GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0005634 "nucleus" evidence=IC;NAS;TAS
GO:0007539 "primary sex determination, soma" evidence=NAS
GO:0008380 "RNA splicing" evidence=TAS
GO:0005685 "U1 snRNP" evidence=ISS
GO:0005686 "U2 snRNP" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0043234 "protein complex" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0035614 "snRNA stem-loop binding" evidence=IDA
GO:0030620 "U2 snRNA binding" evidence=IDA
UNIPROTKB|Q2KIR1 SNRPA "U1 small nuclear ribonucleoprotein A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P09012 SNRPA "U1 small nuclear ribonucleoprotein A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q06AA4 SNRPA "U1 small nuclear ribonucleoprotein A" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307416 Snrpa "small nuclear ribonucleoprotein polypeptide A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M6Z8 Snrpa "Protein Snrpa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2841 snrpa "small nuclear ribonucleoprotein polypeptide A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0I4 SNRPB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1855690 Snrpa "small nuclear ribonucleoprotein polypeptide A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5Y0 SNRPB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H1S6RU2B2_ARATHNo assigned EC number0.45560.91460.9825yesN/A
P08579RU2B_HUMANNo assigned EC number0.58640.86580.9466noN/A
O74968RU1A_SCHPONo assigned EC number0.32930.81700.8072yesN/A
Q0DKM4RU1A_ORYSJNo assigned EC number0.47130.88610.8616yesN/A
P43332SNRPA_DROMENo assigned EC number0.66810.77640.8842yesN/A
Q62189SNRPA_MOUSENo assigned EC number0.54900.92680.7944yesN/A
P09012SNRPA_HUMANNo assigned EC number0.54710.92680.8085yesN/A
Q9CQI7RU2B_MOUSENo assigned EC number0.59910.86580.9466noN/A
Q06AA4SNRPA_PIGNo assigned EC number0.55070.92680.8085yesN/A
P45429SNRPA_XENLANo assigned EC number0.55470.95930.8368N/AN/A
Q2KIR1SNRPA_BOVINNo assigned EC number0.55070.92680.8085yesN/A
Q54J05RU2B_DICDINo assigned EC number0.42970.90240.9211yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
cd1247980 cd12479, RRM2_SNF, RNA recognition motif 2 found i 9e-44
cd1248180 cd12481, RRM2_U2B, RNA recognition motif 2 found i 4e-41
cd1247891 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 s 2e-40
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 6e-40
cd1248080 cd12480, RRM2_U1A, RNA recognition motif 2 found i 2e-38
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 5e-38
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 1e-37
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 3e-37
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-14
smart0036073 smart00360, RRM, RNA recognition motif 3e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-12
smart0036073 smart00360, RRM, RNA recognition motif 3e-11
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 1e-10
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 4e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 7e-10
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-09
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 3e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 6e-09
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 9e-09
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 1e-08
cd1242576 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 3e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 4e-08
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-07
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 3e-07
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 5e-07
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 5e-07
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-06
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 1e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 3e-06
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 3e-06
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 5e-06
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 1e-05
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-05
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 2e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-05
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-05
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 3e-05
cd1230879 cd12308, RRM1_Spen, RNA recognition motif 1 in the 5e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 5e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 6e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 7e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 8e-05
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 9e-05
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-04
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-04
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 1e-04
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 1e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 1e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-04
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 1e-04
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 2e-04
cd1270280 cd12702, RRM4_PTBP2, RNA recognition motif 4 in ve 2e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-04
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-04
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 3e-04
cd1243386 cd12433, RRM_Yme2p_like, RNA recognition motif in 3e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 3e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 4e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 5e-04
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 6e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 6e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 8e-04
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 8e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.001
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 0.001
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.001
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.002
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 0.002
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 0.002
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.002
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 0.002
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 0.002
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 0.002
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.002
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.002
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.002
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 0.002
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 0.002
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 0.002
cd1269396 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 0.002
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.002
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.003
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 0.003
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.003
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.003
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 0.003
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.004
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 0.004
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 0.004
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 0.004
cd1268276 cd12682, RRM_RBPMS, RNA recognition motif in verte 0.004
cd1269486 cd12694, RRM2_hnRNPL_like, RNA recognition motif 2 0.004
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 0.004
>gnl|CDD|240923 cd12479, RRM2_SNF, RNA recognition motif 2 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
 Score =  142 bits (358), Expect = 9e-44
 Identities = 74/80 (92%), Positives = 77/80 (96%)

Query: 167 EQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAAKL 226
           EQPPNQILFLTNLPEET+EMMLSMLFNQFPGFKEVRLVP RHDIAFVEFENE+QSAAAK 
Sbjct: 1   EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENEVQSAAAKE 60

Query: 227 ALHGFKITPTHAMKISFAKK 246
           AL GFKITPTHAMKI+FAKK
Sbjct: 61  ALQGFKITPTHAMKITFAKK 80


This subgroup corresponds to the RRM2 of SNF (Sans fille), also termed U1 small nuclear ribonucleoprotein A (U1 snRNP A or U1-A or U1A), an RNA-binding protein found in the U1 and U2 snRNPs of Drosophila. It is essential in Drosophila sex determination and possesses a novel dual RNA binding specificity. SNF binds with high affinity to both Drosophila U1 snRNA stem-loop II (SLII) and U2 snRNA stem-loop IV (SLIV). It can also bind to poly(U) RNA tracts flanking the alternatively spliced Sex-lethal (Sxl) exon, as does Drosophila Sex-lethal protein (SXL). SNF contains two RNA recognition motifs (RRMs); it can self-associate through RRM1, and each RRM can recognize poly(U) RNA binding independently. . Length = 80

>gnl|CDD|240925 cd12481, RRM2_U2B, RNA recognition motif 2 found in vertebrate U2 small nuclear ribonucleoprotein B" (U2B") Back     alignment and domain information
>gnl|CDD|240922 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 small nuclear ribonucleoprotein B" (U2B") and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240924 cd12480, RRM2_U1A, RNA recognition motif 2 found in vertebrate U1 small nuclear ribonucleoprotein A (U1 snRNP A or U1-A or U1A) Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240871 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240754 cd12308, RRM1_Spen, RNA recognition motif 1 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241146 cd12702, RRM4_PTBP2, RNA recognition motif 4 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240879 cd12433, RRM_Yme2p_like, RNA recognition motif in yeast mitochondrial escape protein 2 (Yme2p) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241137 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|241126 cd12682, RRM_RBPMS, RNA recognition motif in vertebrate RNA-binding protein with multiple splicing (RBP-MS) Back     alignment and domain information
>gnl|CDD|241138 cd12694, RRM2_hnRNPL_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
KOG0148|consensus321 100.0
KOG0117|consensus 506 100.0
KOG4206|consensus221 99.98
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.97
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.97
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.97
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.97
KOG0131|consensus203 99.97
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.97
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.96
KOG0144|consensus 510 99.96
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.96
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.96
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.95
KOG0145|consensus 360 99.95
KOG0127|consensus 678 99.95
KOG0127|consensus 678 99.94
KOG0109|consensus 346 99.94
KOG0145|consensus360 99.93
KOG0110|consensus725 99.92
KOG0123|consensus 369 99.92
KOG0124|consensus 544 99.91
KOG0147|consensus549 99.91
KOG0144|consensus 510 99.9
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.89
KOG0146|consensus371 99.89
KOG0123|consensus 369 99.87
KOG0105|consensus241 99.86
KOG1457|consensus284 99.86
KOG1190|consensus492 99.84
KOG0148|consensus 321 99.84
KOG0147|consensus 549 99.83
KOG0110|consensus 725 99.81
KOG1190|consensus 492 99.8
KOG0124|consensus544 99.78
KOG1548|consensus382 99.78
KOG4205|consensus 311 99.77
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.77
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.75
KOG0106|consensus216 99.74
KOG4212|consensus 608 99.71
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.7
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.7
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.67
PLN03120260 nucleic acid binding protein; Provisional 99.66
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.66
KOG1456|consensus 494 99.66
KOG1456|consensus 494 99.65
KOG0107|consensus 195 99.65
KOG0114|consensus124 99.64
KOG0114|consensus124 99.64
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.64
KOG0121|consensus153 99.63
KOG0120|consensus500 99.63
PLN03121243 nucleic acid binding protein; Provisional 99.62
PLN03120 260 nucleic acid binding protein; Provisional 99.6
KOG0125|consensus376 99.6
KOG0121|consensus153 99.59
KOG0107|consensus195 99.59
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.59
KOG4211|consensus 510 99.59
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.57
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.57
KOG0122|consensus270 99.57
KOG0111|consensus298 99.57
KOG0122|consensus270 99.57
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.55
PLN03213 759 repressor of silencing 3; Provisional 99.54
KOG4207|consensus256 99.53
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.53
KOG0149|consensus247 99.52
KOG0125|consensus 376 99.52
KOG0126|consensus219 99.52
KOG4207|consensus 256 99.51
smart0036272 RRM_2 RNA recognition motif. 99.51
KOG0113|consensus335 99.5
KOG4212|consensus608 99.5
smart0036272 RRM_2 RNA recognition motif. 99.5
KOG4206|consensus 221 99.49
PLN03121 243 nucleic acid binding protein; Provisional 99.49
KOG0130|consensus170 99.48
PLN03213 759 repressor of silencing 3; Provisional 99.48
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.45
KOG0113|consensus 335 99.45
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.42
KOG0130|consensus170 99.42
KOG0105|consensus 241 99.41
KOG0111|consensus 298 99.41
smart0036071 RRM RNA recognition motif. 99.41
smart0036071 RRM RNA recognition motif. 99.41
KOG0117|consensus 506 99.39
KOG0108|consensus 435 99.38
KOG0131|consensus 203 99.37
KOG0108|consensus 435 99.33
KOG0126|consensus 219 99.32
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.32
smart0036170 RRM_1 RNA recognition motif. 99.3
KOG0112|consensus 975 99.29
KOG0149|consensus 247 99.28
KOG0109|consensus 346 99.24
KOG1365|consensus 508 99.24
KOG0129|consensus520 99.24
smart0036170 RRM_1 RNA recognition motif. 99.21
KOG0132|consensus 894 99.2
KOG0120|consensus 500 99.2
KOG0132|consensus 894 99.16
KOG4454|consensus 267 99.12
KOG0415|consensus479 99.12
KOG0153|consensus377 99.09
KOG0146|consensus371 99.09
KOG0153|consensus377 99.09
KOG1457|consensus 284 99.07
KOG0415|consensus 479 99.06
KOG4208|consensus214 99.04
KOG4660|consensus 549 98.98
KOG4676|consensus 479 98.97
KOG4660|consensus 549 98.94
KOG4661|consensus 940 98.92
KOG4661|consensus 940 98.89
KOG4210|consensus285 98.87
KOG0226|consensus290 98.87
KOG4208|consensus214 98.87
KOG0151|consensus 877 98.85
KOG2193|consensus 584 98.83
KOG0533|consensus243 98.83
KOG4211|consensus 510 98.78
KOG0128|consensus881 98.76
KOG0533|consensus243 98.74
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.71
KOG4205|consensus311 98.71
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.66
KOG4454|consensus 267 98.62
KOG0151|consensus 877 98.6
KOG1548|consensus 382 98.58
KOG0116|consensus419 98.57
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.5
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.48
KOG0106|consensus 216 98.46
KOG0226|consensus290 98.41
KOG4209|consensus231 98.41
KOG4209|consensus231 98.37
KOG0116|consensus419 98.35
KOG4307|consensus 944 98.3
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.3
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.07
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.98
KOG1365|consensus 508 97.91
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.88
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.8
KOG2314|consensus 698 97.79
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.79
KOG2314|consensus 698 97.78
KOG1995|consensus 351 97.77
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.76
KOG0115|consensus 275 97.74
KOG1995|consensus351 97.73
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.69
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.66
KOG4307|consensus944 97.65
KOG0128|consensus 881 97.6
KOG2202|consensus260 97.58
KOG3152|consensus 278 97.58
KOG2202|consensus 260 97.57
KOG4210|consensus285 97.55
KOG1855|consensus484 97.55
KOG1855|consensus 484 97.53
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.42
KOG1996|consensus378 97.41
KOG4676|consensus 479 97.38
KOG1996|consensus378 97.35
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.23
KOG3152|consensus278 97.21
PF15023166 DUF4523: Protein of unknown function (DUF4523) 97.21
KOG2416|consensus718 97.18
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.11
KOG2416|consensus 718 97.04
KOG4574|consensus 1007 96.8
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.8
KOG0112|consensus 975 96.73
KOG0115|consensus275 96.73
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.61
KOG0129|consensus520 96.58
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 96.46
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.42
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.17
KOG0804|consensus 493 96.06
KOG2193|consensus 584 96.01
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.98
KOG4849|consensus 498 95.88
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.51
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.37
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.36
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 95.27
KOG2068|consensus327 94.98
KOG4849|consensus 498 94.89
KOG0804|consensus 493 94.86
KOG2591|consensus 684 94.77
KOG2068|consensus 327 94.75
KOG4285|consensus350 94.74
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 94.48
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 94.42
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 94.4
KOG2253|consensus 668 94.2
KOG2253|consensus 668 93.67
KOG2135|consensus526 93.66
KOG4574|consensus 1007 93.16
KOG4285|consensus350 92.72
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 92.3
KOG2135|consensus526 92.24
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 92.21
KOG2591|consensus 684 90.88
PF14111153 DUF4283: Domain of unknown function (DUF4283) 87.65
KOG2318|consensus 650 84.95
KOG4483|consensus528 84.63
PF10567 309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 83.22
KOG2318|consensus 650 82.7
KOG4019|consensus 193 82.07
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=100.00  E-value=1.1e-34  Score=242.56  Aligned_cols=163  Identities=20%  Similarity=0.382  Sum_probs=145.7

Q ss_pred             CCCCCcEEEecCCChhhhHHHHHHHhhccCCeeEEEEccCC---CCccEEEEEEcCHHHHHHHHHHhcCCccCCeeEEEE
Q psy4057           7 HICVTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTL---KMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQ   83 (246)
Q Consensus         7 ~~~~~~~l~V~nl~~~~~e~~l~~~F~~fG~i~~v~~~~~~---~~kg~aFV~f~~~~~A~~Ai~~lng~~~~g~~l~v~   83 (246)
                      ...++++|||+|||.++++++|+++|+.||+|++|+|+++.   +++|||||+|.++++|.+|++.||+..+.+++|+|.
T Consensus       103 ~~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~  182 (346)
T TIGR01659       103 TNNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVS  182 (346)
T ss_pred             CCCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeee
Confidence            45578999999999999999999999999999999998764   788999999999999999999999999999999999


Q ss_pred             EccCCccccccccCccccccccccCCCCCCCChhHHhhhhhhhHHHHHHHHHHHHHHHhcccccCCCCCCCCCCCCCCCC
Q psy4057          84 YSKTDSDVISKIKGTFMERPKKVRKQPAPVEDPAEAKKSKKKAAKEQARLMQAQQQQMQALSVQQPPVSQPAPPAPMATA  163 (246)
Q Consensus        84 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (246)
                      ++....                                                                          
T Consensus       183 ~a~p~~--------------------------------------------------------------------------  188 (346)
T TIGR01659       183 YARPGG--------------------------------------------------------------------------  188 (346)
T ss_pred             cccccc--------------------------------------------------------------------------
Confidence            974321                                                                          


Q ss_pred             CCCCCCCCcEEEEcCCCCCCCHHHHHHHHccCCCceEEEEeeCC-----ccEEEEEeCCHHHHHHHHHHhCCCccCC-CC
Q psy4057         164 GVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNR-----HDIAFVEFENEMQSAAAKLALHGFKITP-TH  237 (246)
Q Consensus       164 ~~~~~~~~~~l~v~nL~~~~t~e~l~~~f~~~G~i~~v~~~~~~-----~g~afV~f~~~~~A~~Al~~l~g~~i~~-g~  237 (246)
                         .....++|||+|||.++|+++|+++|++||.|+.++++.++     ++||||+|.+.++|.+|++.||+..+.+ ++
T Consensus       189 ---~~~~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~~~g~~~  265 (346)
T TIGR01659       189 ---ESIKDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQEAISALNNVIPEGGSQ  265 (346)
T ss_pred             ---cccccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHHHHHHHHHhCCCccCCCce
Confidence               11135679999999999999999999999999999999875     4899999999999999999999999873 37


Q ss_pred             ceEEEeecC
Q psy4057         238 AMKISFAKK  246 (246)
Q Consensus       238 ~l~v~~ak~  246 (246)
                      +|+|.||+.
T Consensus       266 ~l~V~~a~~  274 (346)
T TIGR01659       266 PLTVRLAEE  274 (346)
T ss_pred             eEEEEECCc
Confidence            899999863



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG4483|consensus Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG4019|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1fht_A116 Rna-Binding Domain Of The U1a Spliceosomal Protein 5e-37
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 7e-37
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 3e-33
2b0g_A83 Solution Structure Of Drosophila Melanogaster Snf R 8e-37
2k3k_A104 Solution Structure Of Drosophila Melanogaster Snf R 4e-36
1aud_A101 U1a-Utrrna, Nmr, 31 Structures Length = 101 2e-33
2u1a_A88 Rna Binding Domain 2 Of Human U1a Protein, Nmr, 20 8e-33
1m5k_C100 Crystal Structure Of A Hairpin Ribozyme In The Cata 9e-33
1a9n_B96 Crystal Structure Of The Spliceosomal U2b''-U2a' Pr 1e-31
2nz4_A94 Structural Investigation Of The Glms Ribozyme Bound 2e-31
1oia_A95 U1a Rnp Domain 1-95 Length = 95 2e-31
1urn_A97 U1a MutantRNA COMPLEX + GLYCEROL Length = 97 2e-31
1u6b_A98 Crystal Structure Of A Self-Splicing Group I Intron 2e-31
3bo2_A95 A Relaxed Active Site Following Exon Ligation By A 2e-31
3k0j_A96 Crystal Structure Of The E. Coli Thim Riboswitch In 7e-31
3iwn_C91 Co-Crystal Structure Of A Bacterial C-Di-Gmp Ribosw 8e-31
3l3c_A90 Crystal Structure Of The Bacillus Anthracis Glms Ri 9e-31
1drz_A97 U1a Spliceosomal ProteinHEPATITIS DELTA VIRUS GENOM 5e-29
3cul_A98 Aminoacyl-Trna Synthetase Ribozyme Length = 98 5e-29
1cx0_A95 Hepatitis Delta Virus Ribozyme Length = 95 1e-28
2a3j_A127 Structure Of Urndesign, A Complete Computational Re 6e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 4e-05
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 1e-04
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-04
3lqv_A115 Branch Recognition By Sf3b14 Length = 115 2e-04
2f9d_A125 2.5 Angstrom Resolution Structure Of The Spliceosom 2e-04
2fho_B87 Nmr Solution Structure Of The Human Spliceosomal Pr 2e-04
>pdb|1FHT|A Chain A, Rna-Binding Domain Of The U1a Spliceosomal Protein U1a117, Nmr, 43 Structures Length = 116 Back     alignment and structure

Iteration: 1

Score = 150 bits (380), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 69/91 (75%), Positives = 83/91 (91%) Query: 19 ISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDK 78 I +LKKSLYAIFSQFGQI+DI+ ++LKMRGQAFVIFKE++SATNALRSMQGFPFYDK Sbjct: 20 IKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK 79 Query: 79 PMRIQYSKTDSDVISKIKGTFMERPKKVRKQ 109 PMRIQY+KTDSD+I+K+KGTF+ER +K K+ Sbjct: 80 PMRIQYAKTDSDIIAKMKGTFVERDRKREKR 110
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|2B0G|A Chain A, Solution Structure Of Drosophila Melanogaster Snf Rbd2 Length = 83 Back     alignment and structure
>pdb|2K3K|A Chain A, Solution Structure Of Drosophila Melanogaster Snf Rbd1 Length = 104 Back     alignment and structure
>pdb|1AUD|A Chain A, U1a-Utrrna, Nmr, 31 Structures Length = 101 Back     alignment and structure
>pdb|2U1A|A Chain A, Rna Binding Domain 2 Of Human U1a Protein, Nmr, 20 Structures Length = 88 Back     alignment and structure
>pdb|1M5K|C Chain C, Crystal Structure Of A Hairpin Ribozyme In The Catalytically-Active Conformation Length = 100 Back     alignment and structure
>pdb|1A9N|B Chain B, Crystal Structure Of The Spliceosomal U2b''-U2a' Protein Complex Bound To A Fragment Of U2 Small Nuclear Rna Length = 96 Back     alignment and structure
>pdb|2NZ4|A Chain A, Structural Investigation Of The Glms Ribozyme Bound To Its Catalytic Cofactor Length = 94 Back     alignment and structure
>pdb|1OIA|A Chain A, U1a Rnp Domain 1-95 Length = 95 Back     alignment and structure
>pdb|1URN|A Chain A, U1a MutantRNA COMPLEX + GLYCEROL Length = 97 Back     alignment and structure
>pdb|1U6B|A Chain A, Crystal Structure Of A Self-Splicing Group I Intron With Both Exons Length = 98 Back     alignment and structure
>pdb|3BO2|A Chain A, A Relaxed Active Site Following Exon Ligation By A Group I Intron Length = 95 Back     alignment and structure
>pdb|3K0J|A Chain A, Crystal Structure Of The E. Coli Thim Riboswitch In Complex With Thiamine Pyrophosphate And The U1a Crystallization Module Length = 96 Back     alignment and structure
>pdb|3IWN|C Chain C, Co-Crystal Structure Of A Bacterial C-Di-Gmp Riboswitch Length = 91 Back     alignment and structure
>pdb|3L3C|A Chain A, Crystal Structure Of The Bacillus Anthracis Glms Ribozyme Bound To Glc6p Length = 90 Back     alignment and structure
>pdb|1DRZ|A Chain A, U1a Spliceosomal ProteinHEPATITIS DELTA VIRUS GENOMIC Ribozyme Complex Length = 97 Back     alignment and structure
>pdb|3CUL|A Chain A, Aminoacyl-Trna Synthetase Ribozyme Length = 98 Back     alignment and structure
>pdb|1CX0|A Chain A, Hepatitis Delta Virus Ribozyme Length = 95 Back     alignment and structure
>pdb|2A3J|A Chain A, Structure Of Urndesign, A Complete Computational Redesign Of Human U1a Protein Length = 127 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|3LQV|A Chain A, Branch Recognition By Sf3b14 Length = 115 Back     alignment and structure
>pdb|2F9D|A Chain A, 2.5 Angstrom Resolution Structure Of The Spliceosomal Protein P14 Bound To Region Of Sf3b155 Length = 125 Back     alignment and structure
>pdb|2FHO|B Chain B, Nmr Solution Structure Of The Human Spliceosomal Protein Complex P14-Sf3b155 Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 9e-59
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-08
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 8e-41
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-08
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 9e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-37
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-37
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-31
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 6e-10
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 6e-26
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-10
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-25
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-05
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 7e-25
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 9e-07
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-21
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-07
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-15
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-08
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 8e-14
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-09
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 2e-13
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 6e-08
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-13
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-11
1x5p_A97 Negative elongation factor E; structure genomics, 6e-13
1x5p_A97 Negative elongation factor E; structure genomics, 2e-05
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-12
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-07
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-12
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 5e-12
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-09
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 6e-12
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-09
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-09
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-11
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 7e-10
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-07
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 9e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 9e-11
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-10
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-10
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 9e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-10
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 6e-06
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-10
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 5e-10
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 8e-10
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 7e-08
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-07
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-09
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 5e-06
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-09
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-07
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-09
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-09
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-07
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-05
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-04
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-05
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 8e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-07
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 6e-06
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-08
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-07
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-08
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 4e-08
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-08
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-08
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-07
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-08
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-07
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-04
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-08
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 8e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-08
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-08
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-08
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 3e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-06
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-08
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-08
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-08
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-08
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-05
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-04
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-08
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 8e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-08
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-08
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 5e-08
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-08
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-06
2kt5_A124 RNA and export factor-binding protein 2; chaperone 4e-08
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 5e-08
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-08
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-07
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 2e-04
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-04
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-08
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-07
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-08
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-05
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-08
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-05
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-08
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-08
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 8e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-06
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 9e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 9e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 7e-04
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-08
2cph_A107 RNA binding motif protein 19; RNA recognition moti 3e-06
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 9e-08
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-07
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-06
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 7e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 3e-04
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-07
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 9e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-07
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-06
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-07
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-06
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-07
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-06
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-07
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-07
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-07
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-07
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-05
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-07
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-06
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-07
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-07
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-05
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-07
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-07
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-07
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-07
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-05
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-07
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-07
2i2y_A150 Fusion protein consists of immunoglobin G- binding 6e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-07
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-07
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 4e-07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-06
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-07
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 8e-05
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-07
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-07
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-05
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-07
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-05
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-06
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-07
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 8e-07
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 8e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-05
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-06
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 1e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-04
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 4e-06
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-06
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 6e-04
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 7e-06
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 5e-04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 8e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 5e-04
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-04
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-05
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-05
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 2e-05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 7e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 5e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 7e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-05
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 9e-05
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-04
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 9e-05
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-04
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-04
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-04
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-04
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 7e-04
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-04
2div_A99 TRNA selenocysteine associated protein; structural 3e-04
2div_A99 TRNA selenocysteine associated protein; structural 7e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 4e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-04
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-04
2cqd_A116 RNA-binding region containing protein 1; RNA recog 5e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 5e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 7e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 9e-04
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
 Score =  186 bits (473), Expect = 9e-59
 Identities = 139/262 (53%), Positives = 165/262 (62%), Gaps = 34/262 (12%)

Query: 19  ISSTDLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDK 78
           I   +LKKSLYAIFSQFGQI+DI+  ++LKMRGQAFVIFKE++SATNALRSMQGFPFYDK
Sbjct: 21  IKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK 80

Query: 79  PMRIQYSKTDSDVISKIKGTFMERPKKVRKQPAPVEDPAEAKKSKKKAAKEQARLMQAQQ 138
           PMRIQY+KTDSD+I+K+KGTF+ER +K  K+    ++    KK+ +              
Sbjct: 81  PMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP 140

Query: 139 QQMQALSVQQPPVSQPAPPAPMATAGVPEQP----------------------------- 169
                   Q P +    P  P         P                             
Sbjct: 141 VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQP 200

Query: 170 -----PNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFENEMQSAAA 224
                PN ILFLTNLPEET+E+MLSMLFNQFPGFKEVRLVP RHDIAFVEF+NE+Q+ AA
Sbjct: 201 LSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAA 260

Query: 225 KLALHGFKITPTHAMKISFAKK 246
           + AL GFKIT  +AMKISFAKK
Sbjct: 261 RDALQGFKITQNNAMKISFAKK 282


>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 100.0
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 100.0
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.92
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.92
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.91
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.87
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.86
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.86
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.86
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.86
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.85
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.85
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.84
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.84
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.84
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.84
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.84
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.84
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.84
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.83
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.83
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.83
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.83
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.83
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.83
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.83
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.83
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.82
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.82
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.82
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.82
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.82
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.82
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.82
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.82
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.82
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.82
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.82
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.82
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.82
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.82
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.82
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.82
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.82
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.82
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.81
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.81
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.81
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.81
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.81
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.81
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.81
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.81
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.81
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.81
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.81
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.81
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.81
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.81
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.81
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.81
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.81
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.81
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.81
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.81
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.81
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.81
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.81
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.81
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.81
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.81
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.81
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.81
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.81
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.81
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.81
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.8
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.8
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.8
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.8
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.8
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.8
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.8
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.8
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.8
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.8
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.8
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.8
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.8
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.8
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.8
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.8
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.8
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.8
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.8
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.8
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.8
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.8
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.8
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.8
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.8
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.8
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.8
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.8
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.8
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.8
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.8
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.8
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.8
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.8
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.79
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.79
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.79
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.79
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.79
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.79
2div_A99 TRNA selenocysteine associated protein; structural 99.79
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.79
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.79
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.79
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.79
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.79
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.79
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.79
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.79
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.79
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.79
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.79
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.79
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.79
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.79
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.79
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.79
2div_A99 TRNA selenocysteine associated protein; structural 99.79
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.79
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.79
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.79
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.78
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.78
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.78
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.78
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.78
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.78
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.78
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.78
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.78
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.78
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.78
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.78
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.78
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.78
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.78
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.78
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.78
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.78
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.78
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.78
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.78
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.78
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.78
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.78
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.78
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.78
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.78
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.78
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.78
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.77
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.77
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.77
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.77
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.77
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.77
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.77
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.77
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.77
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.77
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.77
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.77
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.77
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.77
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.77
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.77
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.77
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.77
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.77
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.77
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.77
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.77
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.77
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.77
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.77
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.77
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.77
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.77
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.77
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.77
2dis_A109 Unnamed protein product; structural genomics, RRM 99.77
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.77
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.77
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.77
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.76
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.76
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.76
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.76
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.76
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.76
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.76
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.76
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.76
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.76
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.76
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.76
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.76
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.76
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.76
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.76
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.75
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.75
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.75
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.75
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.75
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.75
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.75
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.75
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.75
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.75
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.75
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.75
1x5p_A97 Negative elongation factor E; structure genomics, 99.75
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.75
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.75
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.74
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.74
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.74
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.74
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.74
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.74
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.74
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.74
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.74
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.74
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.74
1x5p_A97 Negative elongation factor E; structure genomics, 99.74
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.74
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.74
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.74
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.73
2dis_A109 Unnamed protein product; structural genomics, RRM 99.73
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.73
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.73
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.73
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.73
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.73
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.73
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.73
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.73
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.72
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.72
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.72
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.72
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.72
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.72
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.72
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.72
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.72
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.72
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.72
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.56
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.71
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.71
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.71
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.71
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.71
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.71
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.71
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.71
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.71
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.71
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.71
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.71
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.7
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.7
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.7
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.7
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.7
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.7
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.7
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.7
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.69
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.69
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.69
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.69
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.69
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.52
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.69
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.68
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.68
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.68
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.68
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.68
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.67
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.67
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.67
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.67
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.66
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.66
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.66
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.66
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.66
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.66
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.66
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.66
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.65
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.65
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.65
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.65
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.65
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.64
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.64
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.64
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.63
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.63
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.63
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.62
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.61
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.6
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.58
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.58
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.58
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.58
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.58
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.56
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.56
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.56
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.53
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.51
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.44
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.39
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.38
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.29
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.26
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.26
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.05
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.05
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.93
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.76
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.46
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.33
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.3
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.01
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.99
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.81
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.66
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.48
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.44
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.42
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.33
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.24
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.11
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.84
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.76
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.53
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.0
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.87
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 93.53
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 92.07
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 89.34
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
Probab=100.00  E-value=8.7e-39  Score=262.68  Aligned_cols=239  Identities=60%  Similarity=0.922  Sum_probs=167.0

Q ss_pred             CCCCCcEEEecCCChhhhHHHHH----HHhhccCCeeEEEEccCCCCccEEEEEEcCHHHHHHHHHHhcCCccCCeeEEE
Q psy4057           7 HICVTNFVYVTHISSTDLKKSLY----AIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRI   82 (246)
Q Consensus         7 ~~~~~~~l~V~nl~~~~~e~~l~----~~F~~fG~i~~v~~~~~~~~kg~aFV~f~~~~~A~~Ai~~lng~~~~g~~l~v   82 (246)
                      ..+++++|||+|||.++++++|+    ++|++||.|.+|.+.++++++|||||+|.+.++|.+|++.|||..+.|++|+|
T Consensus         5 ~~~~~~~l~V~nlp~~~~~~~l~~~L~~~F~~~G~i~~v~~~~~~~~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~v   84 (282)
T 3pgw_A            5 ETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRI   84 (282)
T ss_pred             CCCCCCEEEEeCCCCCCCHHHHHHHHHHHHhccCCeEEEEEcCCCCcceEEEEEECCHHHHHHHHHHhcCCeeCCcEEEE
Confidence            57889999999999999999966    99999999999999998899999999999999999999999999999999999


Q ss_pred             EEccCCccccccccCccccccccccC-CCCCCCChhHHhhhhhhhHHHH-----------HHHHHHHHHHHhcccccCCC
Q psy4057          83 QYSKTDSDVISKIKGTFMERPKKVRK-QPAPVEDPAEAKKSKKKAAKEQ-----------ARLMQAQQQQMQALSVQQPP  150 (246)
Q Consensus        83 ~~a~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~  150 (246)
                      .+++...+......+.+..+...... +.....................           ...... ........+..+.
T Consensus        85 ~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~g~~~~  163 (282)
T 3pgw_A           85 QYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQA-PRIMHHMPGQPPY  163 (282)
T ss_pred             EEeccCcchhhhhcCCcccchhhhhhhhccccchhhhhhhccCcCCcccCCCCCCCCCCCCccccc-ccccccCCCCCCC
Confidence            99977765555444544433332222 1111111100000000000000           000000 0000000000000


Q ss_pred             CCCCC-CCCC----------------------CCCCCCCCCCCCcEEEEcCCCCCCCHHHHHHHHccCCCceEEEEeeCC
Q psy4057         151 VSQPA-PPAP----------------------MATAGVPEQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNR  207 (246)
Q Consensus       151 ~~~~~-~~~~----------------------~~~~~~~~~~~~~~l~v~nL~~~~t~e~l~~~f~~~G~i~~v~~~~~~  207 (246)
                      ...+. .+.+                      .........+++++|||+|||.++++++|+++|++||.|.+++++.++
T Consensus       164 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~~~~l~~~F~~~G~i~~v~~~~~~  243 (282)
T 3pgw_A          164 MPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGR  243 (282)
T ss_pred             CCCCCCCCCCCCCccccCcccCcccccCccccCccCCccCCCCCCEEEEeCCCCcCCHHHHHHHHHhcCCeEEEEEecCC
Confidence            00000 0000                      000112345578999999999999999999999999999999999998


Q ss_pred             ccEEEEEeCCHHHHHHHHHHhCCCccCCCCceEEEeecC
Q psy4057         208 HDIAFVEFENEMQSAAAKLALHGFKITPTHAMKISFAKK  246 (246)
Q Consensus       208 ~g~afV~f~~~~~A~~Al~~l~g~~i~~g~~l~v~~ak~  246 (246)
                      +|||||+|.+.++|.+|+..|||+.|++|+.|+|+||||
T Consensus       244 ~g~afV~f~~~~~A~~A~~~l~g~~~~~g~~l~v~~akk  282 (282)
T 3pgw_A          244 HDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK  282 (282)
T ss_pred             CcEEEEEeCCHHHHHHHHHHcCCcEeCCCCEEEEEEecC
Confidence            899999999999999999999999998789999999997



>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 246
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-15
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 7e-14
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-08
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 5e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 8e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-10
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 5e-10
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 4e-04
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-10
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-08
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-09
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 4e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-08
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-08
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-07
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-08
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-07
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 4e-08
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 9e-05
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-08
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 7e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 5e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 7e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 8e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 7e-05
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 9e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-06
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-06
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-07
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-07
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-07
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-04
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 5e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-04
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 9e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 6e-05
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-06
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 4e-06
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 4e-04
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 6e-06
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 6e-06
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 7e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-05
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-05
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 6e-05
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-04
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-04
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 0.001
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.001
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 7e-04
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 0.002
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 0.003
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicesomal U1A protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.4 bits (164), Expect = 2e-15
 Identities = 59/86 (68%), Positives = 77/86 (89%), Gaps = 4/86 (4%)

Query: 14 VYVTHISST----DLKKSLYAIFSQFGQIMDIVALKTLKMRGQAFVIFKEIASATNALRS 69
          +Y+ +++      +LKKSL+AIFS+FGQI+DI+  ++LKMRGQAFVIFKE++SATNALRS
Sbjct: 6  IYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRS 65

Query: 70 MQGFPFYDKPMRIQYSKTDSDVISKI 95
          MQGFPFYDKPMRIQY+KTDSD+I+K+
Sbjct: 66 MQGFPFYDKPMRIQYAKTDSDIIAKM 91


>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 100.0
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.92
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.87
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.87
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.87
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.87
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.86
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.86
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.86
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.86
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.86
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.86
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.86
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.86
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.86
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.86
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.86
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.86
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.85
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.85
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.85
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.85
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.85
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.85
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.85
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.85
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.85
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.84
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.84
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.84
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.84
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.84
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.84
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.84
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.84
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.84
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.84
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.84
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.84
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.84
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.83
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.83
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.83
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.83
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.83
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.83
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.83
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.83
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.82
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.82
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.82
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.82
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.82
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.82
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.82
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.82
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.82
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.82
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.82
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.82
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.82
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.81
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.81
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.81
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.81
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.81
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.81
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.81
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.81
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.81
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.81
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.8
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.8
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.8
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.8
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.8
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.8
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.8
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.8
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.8
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.8
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.8
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.8
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.8
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.8
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.79
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.79
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.79
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.79
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.79
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.79
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.79
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.79
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.79
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.79
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.79
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.78
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.78
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.78
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.78
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.78
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.78
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.78
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.78
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.78
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.77
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.77
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.77
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.77
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.77
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.77
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.76
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.76
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.76
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.75
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.75
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.75
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.75
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.74
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.74
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.74
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.7
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.7
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.68
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.67
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.67
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.66
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.66
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.66
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.65
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.64
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.63
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.63
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.6
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.6
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.6
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.6
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.58
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.51
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.5
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.32
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.17
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.16
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.14
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.82
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.32
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.83
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.55
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.5e-32  Score=206.65  Aligned_cols=162  Identities=17%  Similarity=0.293  Sum_probs=139.4

Q ss_pred             CCcEEEecCCChhhhHHHHHHHhhccCCeeEEEEccCC---CCccEEEEEEcCHHHHHHHHHHhcCCccCCeeEEEEEcc
Q psy4057          10 VTNFVYVTHISSTDLKKSLYAIFSQFGQIMDIVALKTL---KMRGQAFVIFKEIASATNALRSMQGFPFYDKPMRIQYSK   86 (246)
Q Consensus        10 ~~~~l~V~nl~~~~~e~~l~~~F~~fG~i~~v~~~~~~---~~kg~aFV~f~~~~~A~~Ai~~lng~~~~g~~l~v~~a~   86 (246)
                      ..++|||+|||+++++++|+++|++||.|.++.++++.   .++|||||+|.+.++|..|+. +++..+.++.+.+....
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~   83 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAV   83 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECC
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhh
Confidence            34899999999999999999999999999999998754   788999999999999999998 66777888888887754


Q ss_pred             CCccccccccCccccccccccCCCCCCCChhHHhhhhhhhHHHHHHHHHHHHHHHhcccccCCCCCCCCCCCCCCCCCCC
Q psy4057          87 TDSDVISKIKGTFMERPKKVRKQPAPVEDPAEAKKSKKKAAKEQARLMQAQQQQMQALSVQQPPVSQPAPPAPMATAGVP  166 (246)
Q Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (246)
                      ......                                                                       ...
T Consensus        84 ~~~~~~-----------------------------------------------------------------------~~~   92 (183)
T d1u1qa_          84 SREDSQ-----------------------------------------------------------------------RPG   92 (183)
T ss_dssp             CTTGGG-----------------------------------------------------------------------STT
T ss_pred             hccccc-----------------------------------------------------------------------ccc
Confidence            332100                                                                       011


Q ss_pred             CCCCCcEEEEcCCCCCCCHHHHHHHHccCCCceEEEEeeCC-----ccEEEEEeCCHHHHHHHHHHhCCCccCCCCceEE
Q psy4057         167 EQPPNQILFLTNLPEETSEMMLSMLFNQFPGFKEVRLVPNR-----HDIAFVEFENEMQSAAAKLALHGFKITPTHAMKI  241 (246)
Q Consensus       167 ~~~~~~~l~v~nL~~~~t~e~l~~~f~~~G~i~~v~~~~~~-----~g~afV~f~~~~~A~~Al~~l~g~~i~~g~~l~v  241 (246)
                      .....++|||+|||..+|+++|+++|+.||.|..+.++.++     +|||||+|.+.++|.+|++ ++|..+. |+.|+|
T Consensus        93 ~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~-G~~i~V  170 (183)
T d1u1qa_          93 AHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVN-GHNCEV  170 (183)
T ss_dssp             TTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEET-TEEEEE
T ss_pred             cccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeEC-CEEEEE
Confidence            33467899999999999999999999999999999999865     4799999999999999997 7999998 999999


Q ss_pred             Eeec
Q psy4057         242 SFAK  245 (246)
Q Consensus       242 ~~ak  245 (246)
                      .+|.
T Consensus       171 ~~A~  174 (183)
T d1u1qa_         171 RKAL  174 (183)
T ss_dssp             EECC
T ss_pred             EecC
Confidence            9984



>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure