Psyllid ID: psy4062

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MVLGKRDIERAFSPRVSKVRPRSTSSSRTPGEQSHMKVYIRVRPQSQKEEDGCHSVMTTLELGIIHTGEQSHMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKSVWTCQSLSITFGEPVLTLN
cccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHcccccccccccccccccccccccEEEEEEccccHHHHHccccEEEEEEccEEEEEcccccccccEEEEcccccccccccccccEEEEccEEEcccccHHHHHHccHHHHHHHHcccccccEEEEcccccccEEEEEccccccEEEEEEEEccHHHHHHHHHHHHcccHHHHHHHHcccccccEEEEEEEEEEEcccccEEEEEEEEEEEcccccHHHccccccccHHHcHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
cccccccHHHcccccccccccccccccccccccccEEEEEEEccccHHHHHccccEEEEEccccccccccccEEEEEEEccccccHHHHHcccEEEEccccEEEEEEccccccccccccccccccccccccccEEEEccEEEcccccHHHHHHHHcHHHHHHHHcccEEEEEEEccccccHHHHHcEcccccccEEEEEccHHHHHHHHHHccccccEHEHHcccccccccEEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHccccccEEEEEEEEccEHHHHHHHHHHHHHHHcccccEccEcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEccccccEEEcc
mvlgkrdierafsprvskvrprstsssrtpgeqshmKVYIRvrpqsqkeedgchsVMTTLELGIIHTGEQSHMKVYIRvrpqsqkeedgcHREIVKILNrdtiifdpkqddseffFHGVKQSLRDINKKKSKEMEFLFDrvygpsesnqdvydgSTKDIIASLLEgyncsvfvygatgagkthtmlgnenhkGIMYLTMGIRNRVSALTRQMCTMRMYKTCLIlrrkpsiceKMQLMVYVKMQDKATKQMKMVKLSMIDLAGSEraaanssnqmrfkegsNINKSLLALGNCINsladgcrhvpyrdskLTRILKdslggncktvMIANiaptalsyedsYNTLKYATRAKKIKAKVSRtfksgahfkleyltggvskhcrpavgrrgksvwtcqslsitfgepvltln
mvlgkrdierafsprvskvrprstsssrtpgeqshmkvyirvrpqsqkeedGCHSVMTTLELGIIHTGEQSHMKVYIRVrpqsqkeedgcHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDrvygpsesnqdvyDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILkdslggnckTVMIANIAptalsyedSYNTLKYATRAKKikakvsrtfksgahfkleyltggvskhcrpavgrrgksvwtcqslsitfgepvltln
MVLGKRDIERAFsprvskvrprstsssrtpGEQSHMKVYIRVRPQSQKEEDGCHSVMTTLELGIIHTGEQSHMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKSVWTCQSLSITFGEPVLTLN
****************************************************CHSVMTTLELGIIHTGEQSHMKVYIRVR********GCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLR**********EFLFDRVYG******DVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDK*******V****************************INKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKSVWTCQSLSITFGEPV****
***************************************IRVRPQSQ*************************MKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGV***************EFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGA***********HKGIMYLTMGIRNRVS********************************************KMVKLSMIDLAGS**************EGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTG*****************************PVLTL*
MVLGKRDIERAFS*********************HMKVYIRVRP********CHSVMTTLELGIIHTGEQSHMKVYIRVRP********CHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKSVWTCQSLSITFGEPVLTLN
*********************************SHMKVYIRVRPQSQKEEDGCHSVMTTLELGIIHTGEQSHMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSMIDLAG**************K**SNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKSVWTCQSLSITFGEPVLTLN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLGKRDIERAFSPRVSKVRPRSTSSSRTPGEQSHMKVYIRVRPQSQKEEDGCHSVMTTLELGIIHTGEQSHMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKSVWTCQSLSITFGEPVLTLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query409 2.2.26 [Sep-21-2011]
Q6PFD6 834 Kinesin-like protein KIF1 yes N/A 0.711 0.348 0.399 8e-65
Q4KLL9 826 Kinesin-like protein KIF1 yes N/A 0.713 0.353 0.394 6e-64
Q86Y91 864 Kinesin-like protein KIF1 yes N/A 0.290 0.137 0.592 4e-37
Q5ZLK6 797 Kinesin-like protein KIF1 yes N/A 0.290 0.149 0.576 4e-37
Q91WD7 886 Kinesin-like protein KIF1 no N/A 0.298 0.137 0.570 9e-37
Q8NI77 898 Kinesin-like protein KIF1 no N/A 0.298 0.135 0.562 1e-36
A6QPL4 662 Kinesin-like protein KIF2 no N/A 0.579 0.358 0.328 1e-35
Q5REP4 665 Kinesin-like protein KIF2 no N/A 0.579 0.356 0.325 2e-35
Q14807 665 Kinesin-like protein KIF2 no N/A 0.579 0.356 0.325 2e-35
P53086 805 Kinesin-like protein KIP3 yes N/A 0.332 0.168 0.547 2e-34
>sp|Q6PFD6|KI18B_MOUSE Kinesin-like protein KIF18B OS=Mus musculus GN=Kif18b PE=2 SV=2 Back     alignment and function desciption
 Score =  248 bits (632), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 143/358 (39%), Positives = 203/358 (56%), Gaps = 67/358 (18%)

Query: 81  PQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQS-LRDINKKKSKEMEFLFD 139
           P + KE +   R ++++++   ++FDP++ D    F G+K S   +  KKK K++ F+FD
Sbjct: 18  PPTPKELESQRRPVIQVVDERMLVFDPEECDG--GFPGLKWSGSHNGPKKKGKDLTFVFD 75

Query: 140 RVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLT- 198
           RV+G   + +DV+  +T +I+ S L+GYNCSVF YGATGAGKTHTMLG E   GIMYLT 
Sbjct: 76  RVFGEMATQEDVFQHTTHNILDSFLQGYNCSVFAYGATGAGKTHTMLGREGEPGIMYLTT 135

Query: 199 MGIRNRVSA----------------LTRQMCTMRMYKTCLILRRKPSI------------ 230
           M +  R+ A                   Q+  +   K  L +R  P              
Sbjct: 136 MELYRRLEARQEEKQFEVLISYLEVYNEQIHDLLEPKGPLTIREDPDKGVVVPGLSFHQP 195

Query: 231 --------------CEKMQ---------------LMVYVKMQDKA---TKQMKMVKLSMI 258
                         C + Q                 ++VK QD+    T+ +++ K+S+I
Sbjct: 196 ASAEQLLEMLTRGNCSRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQALRVAKMSLI 255

Query: 259 DLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGC---RHVPYRDSKLTRILK 315
           DLAGSERA++  +   R +EG+NIN+SLLAL N +N+LAD      HVPYRDSKLTR+LK
Sbjct: 256 DLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKSHVPYRDSKLTRLLK 315

Query: 316 DSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLT 373
           DS+GGNC+TVMIA I+P++L+YED+YNTLKYA RAK+I+  +     S  H   +Y T
Sbjct: 316 DSIGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLTLKSNVISVDHHISQYAT 373
May play an important role in regulating cell division.
Mus musculus (taxid: 10090)
>sp|Q4KLL9|KI18B_RAT Kinesin-like protein KIF18B OS=Rattus norvegicus GN=Kif18b PE=2 SV=1 Back     alignment and function description
>sp|Q86Y91|KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens GN=KIF18B PE=1 SV=3 Back     alignment and function description
>sp|Q5ZLK6|KI18B_CHICK Kinesin-like protein KIF18B OS=Gallus gallus GN=KIF18B PE=2 SV=1 Back     alignment and function description
>sp|Q91WD7|KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus GN=Kif18a PE=2 SV=1 Back     alignment and function description
>sp|Q8NI77|KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens GN=KIF18A PE=1 SV=2 Back     alignment and function description
>sp|A6QPL4|KIF22_BOVIN Kinesin-like protein KIF22 OS=Bos taurus GN=KIF22 PE=2 SV=2 Back     alignment and function description
>sp|Q5REP4|KIF22_PONAB Kinesin-like protein KIF22 OS=Pongo abelii GN=KIF22 PE=2 SV=1 Back     alignment and function description
>sp|Q14807|KIF22_HUMAN Kinesin-like protein KIF22 OS=Homo sapiens GN=KIF22 PE=1 SV=5 Back     alignment and function description
>sp|P53086|KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query409
312371080497 hypothetical protein AND_22650 [Anophele 0.711 0.585 0.464 2e-79
194867766 808 GG14050 [Drosophila erecta] gi|190653928 0.699 0.353 0.431 6e-75
195490895 809 GE21253 [Drosophila yakuba] gi|194179433 0.699 0.353 0.431 6e-75
24661483 814 Kinesin-like protein at 67A, isoform A [ 0.699 0.351 0.431 7e-75
1881662 814 kinesin like protein 67a [Drosophila mel 0.699 0.351 0.431 9e-75
442631264 740 Kinesin-like protein at 67A, isoform B [ 0.699 0.386 0.431 1e-74
195326265 808 GM24884 [Drosophila sechellia] gi|194118 0.699 0.353 0.425 5e-74
449280919 868 Kinesin-like protein KIF18A, partial [Co 0.684 0.322 0.420 1e-71
449501708 932 PREDICTED: kinesin-like protein KIF18A [ 0.684 0.300 0.407 4e-69
327281890 920 PREDICTED: kinesin-like protein KIF18A-l 0.699 0.310 0.404 1e-67
>gi|312371080|gb|EFR19344.1| hypothetical protein AND_22650 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 225/349 (64%), Gaps = 58/349 (16%)

Query: 67  TGEQSHMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSE-FFFHGVKQSLRD 125
           +G+   ++V +RVRP + +E +   R I+K+L++ T+IFDP  DD E FFFHGVKQ+ RD
Sbjct: 2   SGDSRSIRVAVRVRPFNSRELEQNPRNIIKVLDQSTLIFDPDVDDDELFFFHGVKQTHRD 61

Query: 126 INKKKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTM 185
           I K+  K++   +D V+  + +N D+++   + ++ S++ GYNCSVFVYGATGAGKTHTM
Sbjct: 62  ITKRVKKKLTMEYDDVFDNTATNADIFEVCMRPLVQSVMNGYNCSVFVYGATGAGKTHTM 121

Query: 186 LGNENHKGIMYLTMG-IRNRVSAL--TRQ----MCTMRMYK------------------- 219
           LGNE   GI +LTM  +  ++ AL  TR+    +  + +Y                    
Sbjct: 122 LGNELCPGITFLTMQELFAQIDALSDTRKFDIGISYLEVYNELVMNLLTKSGPLKLREDS 181

Query: 220 -----TCLILRRKPSICEKMQLM--------------------------VYVKMQDKATK 248
                + L+L++  +  E ++L+                          V+++M DK T 
Sbjct: 182 NGVVVSGLVLKQIHNASELLELLAIGNRNRTQHPTDANAESSRSHAIFQVHIRMCDKKTG 241

Query: 249 QMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDS 308
           Q + VKLSMIDLAGSERAA+     +RFKEG+NINKSLLALGNCIN LADG +H+PYRDS
Sbjct: 242 QKRSVKLSMIDLAGSERAASTKGIGIRFKEGANINKSLLALGNCINKLADGLKHIPYRDS 301

Query: 309 KLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKV 357
            LTRILKDSLGGNC+TVMIANI+P++L+Y+D+YNTLKYA+RAKKI+  V
Sbjct: 302 NLTRILKDSLGGNCQTVMIANISPSSLTYDDTYNTLKYASRAKKIRTTV 350

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194867766|ref|XP_001972145.1| GG14050 [Drosophila erecta] gi|190653928|gb|EDV51171.1| GG14050 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195490895|ref|XP_002093332.1| GE21253 [Drosophila yakuba] gi|194179433|gb|EDW93044.1| GE21253 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24661483|ref|NP_523992.2| Kinesin-like protein at 67A, isoform A [Drosophila melanogaster] gi|7294967|gb|AAF50296.1| Kinesin-like protein at 67A, isoform A [Drosophila melanogaster] gi|17946024|gb|AAL49055.1| RE52076p [Drosophila melanogaster] gi|220949004|gb|ACL87045.1| Klp67A-PA [synthetic construct] Back     alignment and taxonomy information
>gi|1881662|gb|AAB49460.1| kinesin like protein 67a [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442631264|ref|NP_001261624.1| Kinesin-like protein at 67A, isoform B [Drosophila melanogaster] gi|440215536|gb|AGB94319.1| Kinesin-like protein at 67A, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195326265|ref|XP_002029850.1| GM24884 [Drosophila sechellia] gi|194118793|gb|EDW40836.1| GM24884 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|449280919|gb|EMC88144.1| Kinesin-like protein KIF18A, partial [Columba livia] Back     alignment and taxonomy information
>gi|449501708|ref|XP_002191014.2| PREDICTED: kinesin-like protein KIF18A [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|327281890|ref|XP_003225678.1| PREDICTED: kinesin-like protein KIF18A-like [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query409
FB|FBgn0004379 814 Klp67A "Kinesin-like protein a 0.298 0.149 0.639 5.3e-75
ZFIN|ZDB-GENE-040426-862 895 kif18a "kinesin family member 0.315 0.144 0.573 3.2e-70
UNIPROTKB|E1BUZ2 861 KIF18A "Uncharacterized protei 0.327 0.155 0.535 6.2e-70
UNIPROTKB|E2RAH7 899 KIF18A "Uncharacterized protei 0.293 0.133 0.587 4.7e-68
UNIPROTKB|F1SGM6 840 KIF18A "Uncharacterized protei 0.293 0.142 0.587 5.5e-68
UNIPROTKB|E1BDH4 893 KIF18A "Uncharacterized protei 0.293 0.134 0.571 4.3e-67
UNIPROTKB|Q8NI77 898 KIF18A "Kinesin-like protein K 0.293 0.133 0.571 7e-67
UNIPROTKB|E2RS98 866 KIF18B "Uncharacterized protei 0.435 0.205 0.461 5.2e-66
UNIPROTKB|E1BC46 863 KIF18B "Uncharacterized protei 0.330 0.156 0.538 1.4e-65
MGI|MGI:2446979 834 Kif18b "kinesin family member 0.332 0.163 0.549 2.9e-65
FB|FBgn0004379 Klp67A "Kinesin-like protein at 67A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 425 (154.7 bits), Expect = 5.3e-75, Sum P(2) = 5.3e-75
 Identities = 78/122 (63%), Positives = 104/122 (85%)

Query:   238 VYVKMQDKATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLA 297
             V++++ ++ T   + VKLSMIDLAGSERAA+     +RFKEG++INKSLLALGNCIN LA
Sbjct:   231 VHIRITERKTDTKRTVKLSMIDLAGSERAASTKGIGVRFKEGASINKSLLALGNCINKLA 290

Query:   298 DGCRHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKV 357
             DG +H+PYRDS LTRILKDSLGGNC+T+M+AN++ ++L+YED+YNTLKYA+RAKKI+  +
Sbjct:   291 DGLKHIPYRDSNLTRILKDSLGGNCRTLMVANVSMSSLTYEDTYNTLKYASRAKKIRTTL 350

Query:   358 SR 359
              +
Sbjct:   351 KQ 352
GO:0005871 "kinesin complex" evidence=ISS;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0003774 "motor activity" evidence=ISS;IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0003777 "microtubule motor activity" evidence=ISS
GO:0007018 "microtubule-based movement" evidence=ISS
GO:0051299 "centrosome separation" evidence=IMP
GO:0046785 "microtubule polymerization" evidence=IMP
GO:0007059 "chromosome segregation" evidence=IMP
GO:0051225 "spindle assembly" evidence=IMP
GO:0000910 "cytokinesis" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0007060 "male meiosis chromosome segregation" evidence=IMP
GO:0016346 "male meiotic chromosome movement towards spindle pole" evidence=IMP
GO:0031134 "sister chromatid biorientation" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0005876 "spindle microtubule" evidence=IDA
GO:0051231 "spindle elongation" evidence=IMP
GO:0000776 "kinetochore" evidence=IDA
ZFIN|ZDB-GENE-040426-862 kif18a "kinesin family member 18A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUZ2 KIF18A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAH7 KIF18A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGM6 KIF18A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDH4 KIF18A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NI77 KIF18A "Kinesin-like protein KIF18A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS98 KIF18B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BC46 KIF18B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2446979 Kif18b "kinesin family member 18B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 7e-63
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 4e-55
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 7e-52
cd00106328 cd00106, KISc, Kinesin motor domain 1e-48
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 9e-43
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 1e-42
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 4e-42
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 5e-42
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 4e-40
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 9e-39
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 9e-39
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 1e-37
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 2e-36
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 3e-35
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 5e-35
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 7e-30
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 7e-30
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 4e-29
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 1e-27
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 3e-26
cd00106328 cd00106, KISc, Kinesin motor domain 6e-25
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 2e-24
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 5e-24
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 2e-23
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 2e-23
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 1e-22
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 2e-21
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 4e-20
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 1e-18
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 2e-18
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 2e-18
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 5e-18
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 1e-17
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 1e-16
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-15
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 4e-12
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 1e-06
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information 
 Score =  205 bits (523), Expect = 7e-63
 Identities = 77/124 (62%), Positives = 101/124 (81%), Gaps = 6/124 (4%)

Query: 236 LMVYVKMQDK---ATKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNC 292
           L + V+ +D+     +Q+++ KLS+IDLAGSERA+A ++   R KEG+NIN+SLLALGNC
Sbjct: 215 LQITVRQKDRTASINQQVRIGKLSLIDLAGSERASATNNRGQRLKEGANINRSLLALGNC 274

Query: 293 INSLADGC---RHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATR 349
           IN+L DG    +H+PYRDSKLTR+LKDSLGGNCKTVMIANI+P++  YE+++NTLKYA R
Sbjct: 275 INALVDGKKKNKHIPYRDSKLTRLLKDSLGGNCKTVMIANISPSSSHYEETHNTLKYANR 334

Query: 350 AKKI 353
           AK I
Sbjct: 335 AKNI 338

The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 338
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 409
KOG0243|consensus 1041 100.0
KOG4280|consensus 574 100.0
KOG0245|consensus 1221 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
KOG0242|consensus 675 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
KOG0240|consensus 607 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
KOG0241|consensus 1714 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
KOG0239|consensus670 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0246|consensus676 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
KOG0247|consensus 809 100.0
KOG0244|consensus 913 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 97.17
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.62
PRK06893229 DNA replication initiation factor; Validated 93.6
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.5
PRK06620214 hypothetical protein; Validated 92.31
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.8
PRK12377248 putative replication protein; Provisional 90.81
PRK05642234 DNA replication initiation factor; Validated 90.48
PRK09087226 hypothetical protein; Validated 90.29
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 90.02
PRK06526254 transposase; Provisional 89.52
PRK08116268 hypothetical protein; Validated 89.25
PRK08084235 DNA replication initiation factor; Provisional 89.18
PF04851184 ResIII: Type III restriction enzyme, res subunit; 89.18
PRK14086617 dnaA chromosomal replication initiation protein; P 88.64
PRK14088440 dnaA chromosomal replication initiation protein; P 88.48
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 88.14
TIGR00362405 DnaA chromosomal replication initiator protein Dna 88.0
PRK07952244 DNA replication protein DnaC; Validated 87.96
PRK00149450 dnaA chromosomal replication initiation protein; R 87.58
PRK08727233 hypothetical protein; Validated 87.51
PRK08903227 DnaA regulatory inactivator Hda; Validated 87.22
TIGR02928365 orc1/cdc6 family replication initiation protein. M 87.14
PRK14087450 dnaA chromosomal replication initiation protein; P 87.07
PRK00411394 cdc6 cell division control protein 6; Reviewed 86.55
PRK08181269 transposase; Validated 86.2
PRK10436462 hypothetical protein; Provisional 85.99
PF1324576 AAA_19: Part of AAA domain 85.87
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 85.51
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 85.03
TIGR02533486 type_II_gspE general secretory pathway protein E. 84.99
PRK08939306 primosomal protein DnaI; Reviewed 84.89
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 84.41
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 84.35
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 84.23
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 84.03
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 83.68
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 83.63
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 82.92
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 82.56
PRK06835329 DNA replication protein DnaC; Validated 82.48
COG1484254 DnaC DNA replication protein [DNA replication, rec 82.39
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 82.29
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 82.12
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 82.09
smart00382148 AAA ATPases associated with a variety of cellular 81.7
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 81.5
COG0593408 DnaA ATPase involved in DNA replication initiation 81.4
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 81.28
PF12846304 AAA_10: AAA-like domain 81.16
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 80.75
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 80.58
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 80.5
>KOG0243|consensus Back     alignment and domain information 
Probab=100.00  E-value=5e-76  Score=630.54  Aligned_cols=306  Identities=34%  Similarity=0.544  Sum_probs=267.4

Q ss_pred             CCCeEEEEEeCCCCChhhccCCceEEEEeC-CcEEEeCCCCCCCcceeeccccchhhccccCCCceeEeeceEeCCCCCc
Q psy4062          70 QSHMKVYIRVRPQSQKEEDGCHREIVKILN-RDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESN  148 (409)
Q Consensus        70 ~~~ikV~vRvRP~~~~E~~~~~~~~v~~~~-~~~ii~dp~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~FD~VF~~~asQ  148 (409)
                      ..||+|+|||||++.+|.......+|.+++ ++-|.+.....  .                ..-.+.|+||+||||++.|
T Consensus        48 ~~NIqVivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~--s----------------k~~~k~ftFDkVFGpes~Q  109 (1041)
T KOG0243|consen   48 EVNIQVIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIA--S----------------KQIDKTFTFDKVFGPESQQ  109 (1041)
T ss_pred             CCceEEEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccc--c----------------ccccceeecceeeCcchhH
Confidence            469999999999999999888899999988 44354433211  0                1245689999999999999


Q ss_pred             hhhhccchHHHHHHHhcCcceEEEeeccCCCCceeeecC--------CCCCCchhhhhhhhhhHHHhhhhce-------e
Q psy4062         149 QDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLG--------NENHKGIMYLTMGIRNRVSALTRQM-------C  213 (409)
Q Consensus       149 ~eVf~~~~~plV~~vl~G~N~tI~aYGqTGSGKTyTm~G--------~~~~~GIi~~~~~~~~lf~~~~~~~-------s  213 (409)
                      ++||+.++.|+|+.|+.|||||||||||||+||||||.|        .+.++|||||++.+  +|+.++...       |
T Consensus       110 ~d~Y~~~v~p~i~eVl~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~--IFd~Le~~~~EYsvKVS  187 (1041)
T KOG0243|consen  110 EDLYDQAVSPIIKEVLEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQ--IFDTLEAQGAEYSVKVS  187 (1041)
T ss_pred             HHHHHHHHHHHHHHHhccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHH--HHHHHHhcCCeEEEEEE
Confidence            999999999999999999999999999999999999999        57789999999999  999998765       9


Q ss_pred             EEEEEeceeeEe------------------------------------------------------------ecCcccce
Q psy4062         214 TMRMYKTCLILR------------------------------------------------------------RKPSICEK  233 (409)
Q Consensus       214 ~~eiy~~~~~~~------------------------------------------------------------~~~ssrsh  233 (409)
                      |+|+|++.+.|+                                                            +..|||||
T Consensus       188 fLELYNEEl~DLLa~~~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSH  267 (1041)
T KOG0243|consen  188 FLELYNEELTDLLASEDTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSH  267 (1041)
T ss_pred             ehhhhhHHHHHhcCCccccccccccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhhhhccccc
Confidence            999998777765                                                            34599999


Q ss_pred             eeEEEEEEeeccc---cceeEEeEEEEeecCCcccccccCCccchhhhhcccchhHHHHHHHHHHHhcCCCCcccCCchh
Q psy4062         234 MQLMVYVKMQDKA---TKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKL  310 (409)
Q Consensus       234 ~i~~i~v~~~~~~---~~~~~~skL~~VDLAGSEr~~~~~~~~~r~~E~~~IN~SL~aL~~vI~aL~~~~~~iPyRdSkL  310 (409)
                      .+|+|+|.....+   .+-++.|||+||||||||.++++|+.+.|.+|+..||+||++||+||+||.+...|||||+|||
T Consensus       268 sIFsItvhike~t~~geelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s~HIPYRESKL  347 (1041)
T KOG0243|consen  268 SIFSITVHIKENTPEGEELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHSGHIPYRESKL  347 (1041)
T ss_pred             eEEEEEEEEecCCCcchhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccCCCCCchHHHH
Confidence            9999999766544   4568899999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHhhhhccCCCccEEEEEEeCCCCCCHHHHHHHHHHHHHHhcCcccceeeccCCchhhhhhhhCCcCCcccccccccCCc
Q psy4062         311 TRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAHFKLEYLTGGVSKHCRPAVGRRGKS  390 (409)
Q Consensus       311 T~LLk~sLgGn~~t~~I~~isP~~~~~~eTl~TL~fa~rak~Ik~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  390 (409)
                      ||||||+|||..||+|||||||+..+++||++||.||.|||+|+|+|.+|+.-.....++-+..+++.+.+.....|.|-
T Consensus       348 TRLLQDSLGGkTKT~iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd~~~EIerLK~dl~AaReKn  427 (1041)
T KOG0243|consen  348 TRLLQDSLGGKTKTCIIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKDLYEEIERLKRDLAAAREKN  427 (1041)
T ss_pred             HHHHHHHhCCCceeEEEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHHHHHHHHHHHHHHHHhHhhC
Confidence            99999999999999999999999999999999999999999999999999776666666666777877766555555443


Q ss_pred             -ccccc
Q psy4062         391 -VWTCQ  395 (409)
Q Consensus       391 -~~~~~  395 (409)
                       .|-.+
T Consensus       428 Gvyise  433 (1041)
T KOG0243|consen  428 GVYISE  433 (1041)
T ss_pred             ceEech
Confidence             45333

>KOG4280|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 1e-39
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 2e-37
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 2e-36
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 7e-35
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 2e-33
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 1e-31
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 1e-30
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-30
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-30
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 6e-30
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 6e-30
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 4e-29
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-27
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 2e-25
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 4e-25
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 5e-25
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 6e-25
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 2e-24
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 2e-24
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 2e-24
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 2e-24
4a28_A368 Eg5-2 Length = 368 2e-24
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 2e-24
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 2e-24
4a1z_A368 Eg5-1 Length = 368 2e-24
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 2e-24
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 3e-24
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 3e-23
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 3e-23
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 7e-23
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 2e-22
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 4e-22
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 6e-22
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 9e-22
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 5e-20
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 8e-20
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 1e-19
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 1e-19
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 5e-19
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 4e-18
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 5e-18
2kin_B100 Kinesin (Monomeric) From Rattus Norvegicus Length = 1e-17
3kin_B117 Kinesin (Dimeric) From Rattus Norvegicus Length = 1 2e-17
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 2e-17
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 2e-17
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 5e-17
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 7e-17
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 5e-16
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 6e-16
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 7e-16
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 4e-15
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 4e-15
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 4e-15
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 5e-15
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 5e-15
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 7e-15
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 3e-14
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 3e-10
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure 
Iteration: 1

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/346 (30%), Positives = 167/346 (48%), Gaps = 73/346 (21%)
Query: 72  HMKVYIRVRPQSQKEEDGCHREIVKILNRDT-IIFDPKQDDSEFFFHGVKQSLRDINKKK 130
           ++KV +R RP + +E       I+++      +I DP + +            +   + K
Sbjct: 5   NIKVIVRCRPLNARETRENALNIIRMDEASAQVIVDPPEQE------------KSATQAK 52
Query: 131 SKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNEN 190
                F FD VY  +  N  ++  S K +I ++LEG+N ++F YG TGAGKT TM GN+ 
Sbjct: 53  KVPRTFTFDAVYDQTSCNYGIFQASFKPLIDAVLEGFNSTIFAYGQTGAGKTWTMGGNKE 112
Query: 191 HKGIM-------------------YLTMG-------------IRNRVSALTRQMCTMRMY 218
             G +                   +L +G             I+N      ++  T  +Y
Sbjct: 113 EPGAIPNSFKHLFDAINSSSSNQNFLVIGSYLELYNEEIRDLIKNNTKLPLKEDKTRGIY 172
Query: 219 KTCLILRRKPSICEKMQLM---------VYVKMQDKATKQ-------------------M 250
              L + R  +  E   LM            +M D +++                    +
Sbjct: 173 VDGLSMHRVTTAAELSALMDKGFANRHVAATQMNDTSSRSHSIFMVRIECSEVIENKEVI 232
Query: 251 KMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKL 310
           ++ KL+++DLAGSER +   +      EG+ IN SL ALG  I+ L +G  H+PYRDSKL
Sbjct: 233 RVGKLNLVDLAGSERQSKTGATGETLVEGAKINLSLSALGLVISKLVEGATHIPYRDSKL 292
Query: 311 TRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKIKAK 356
           TR+L+DSLGGN KT+M ANI+P + +Y+++ +TL+YA RAK+IK K
Sbjct: 293 TRLLQDSLGGNSKTLMCANISPASTNYDETMSTLRYADRAKQIKNK 338
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 Back     alignment and structure
>pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 1e-112
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 1e-104
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 3e-62
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 4e-34
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-60
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 5e-33
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 4e-60
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 2e-35
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 4e-60
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 3e-35
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 6e-58
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 8e-30
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 1e-57
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 1e-30
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 1e-57
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 8e-28
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 5e-56
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 1e-24
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 6e-56
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 1e-28
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 4e-55
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 8e-25
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 5e-55
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 3e-26
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 6e-55
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 2e-26
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 9e-55
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 4e-23
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 3e-54
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 8e-27
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 4e-54
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 2e-28
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 5e-54
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 1e-26
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 2e-53
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 2e-25
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 3e-53
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 6e-25
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 8e-53
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 1e-28
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 2e-52
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 5e-31
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 2e-52
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 2e-25
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 3e-51
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-26
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 6e-51
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 4e-24
3u06_A412 Protein claret segregational; motor domain, stalk 8e-51
3u06_A412 Protein claret segregational; motor domain, stalk 1e-25
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 3e-42
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 6e-42
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-12
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
 Score =  332 bits (853), Expect = e-112
 Identities = 137/349 (39%), Positives = 209/349 (59%), Gaps = 65/349 (18%)

Query: 69  EQSHMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINK 128
              HMKV +RVRP++ KE+     ++V ++++  ++FDPKQ++  FF HG K + +++ K
Sbjct: 8   LCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFF-HGKKTTNQNVIK 66

Query: 129 KKSKEMEFLFDRVYGPSESNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGN 188
           K++K+++F+FD V+  + +  +V++ +TK I+ S L GYNC+V  YGATGAGKTHTMLG+
Sbjct: 67  KQNKDLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKTHTMLGS 126

Query: 189 ENHKGIMYLTM-GIRNRVSALTRQM-CTMRM-----Y----------KTCLILRRKP--- 228
            +  G+MYLTM  +   +  +  +  C+  +     Y             L +R      
Sbjct: 127 ADEPGVMYLTMLHLYKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVREDTQKG 186

Query: 229 ------------SICEKMQLM--------------------------VYVKMQDK---AT 247
                       S  E + L+                          +Y++ QDK     
Sbjct: 187 VVVHGLTLHQPKSSEEILHLLDNGNKNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASIN 246

Query: 248 KQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCR---HVP 304
           + +++ K+S+IDLAGSERA+ + +   RF EG+NIN+SLLALGN IN+LAD  R   H+P
Sbjct: 247 QNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTNINRSLLALGNVINALADSKRKNQHIP 306

Query: 305 YRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLKYATRAKKI 353
           YR+SKLTR+LKDSLGGNC+T+MIA ++P+++ Y+D+YNTLKYA RAK I
Sbjct: 307 YRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYANRAKDI 355
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query409
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.96
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.94
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.77
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.03
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.06
2qgz_A308 Helicase loader, putative primosome component; str 91.95
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.18
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 87.65
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 87.42
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 87.3
2r62_A268 Cell division protease FTSH homolog; ATPase domain 86.81
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 84.51
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 84.46
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 83.97
3bos_A242 Putative DNA replication factor; P-loop containing 83.64
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 83.26
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 82.96
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 82.77
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 82.59
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.39
2chg_A226 Replication factor C small subunit; DNA-binding pr 81.35
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 81.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 80.09
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
Probab=100.00  E-value=4.4e-78  Score=601.64  Aligned_cols=283  Identities=35%  Similarity=0.569  Sum_probs=230.6

Q ss_pred             CCCeEEEEEeCCCCChhhccCCceEEEEeCC-cEEEeCCCCCCCcceeeccccchhhccccCCCceeEeeceEeCCCCCc
Q psy4062          70 QSHMKVYIRVRPQSQKEEDGCHREIVKILNR-DTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESN  148 (409)
Q Consensus        70 ~~~ikV~vRvRP~~~~E~~~~~~~~v~~~~~-~~ii~dp~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~FD~VF~~~asQ  148 (409)
                      .++|+|+||+||+++.|...+...++.+.++ ..+++.++.....            ........+.|.||+||+++++|
T Consensus         3 ~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~v~v~~~~~~~~------------~~~~~~~~~~f~FD~Vf~~~~~Q   70 (350)
T 2vvg_A            3 SDNIKVIVRCRPLNARETRENALNIIRMDEASAQVIVDPPEQEKS------------ATQAKKVPRTFTFDAVYDQTSCN   70 (350)
T ss_dssp             -CBCEEEEEECCCCHHHHHTTCCBCEEEEGGGTEEEECC--------------------------EEEECSEEECTTCCH
T ss_pred             CCCeEEEEEeCCCChhhhccCCceEEEEcCCCCEEEEeecccccc------------ccccCCCceEeeCCEEECCCcch
Confidence            5689999999999999998888889988753 4555554432111            00112356789999999999999


Q ss_pred             hhhhccchHHHHHHHhcCcceEEEeeccCCCCceeeecCCCCCCchhhhhhhhhhHHHhhhhce---------eEEEEEe
Q psy4062         149 QDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQM---------CTMRMYK  219 (409)
Q Consensus       149 ~eVf~~~~~plV~~vl~G~N~tI~aYGqTGSGKTyTm~G~~~~~GIi~~~~~~~~lf~~~~~~~---------s~~eiy~  219 (409)
                      ++||+.+++|+|+++|+|||+||||||||||||||||+|+++++|||||++.+  +|+.+....         ||+|||+
T Consensus        71 ~~Vy~~~~~plv~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~Giipr~~~~--lF~~i~~~~~~~~~~v~vS~~EIYn  148 (350)
T 2vvg_A           71 YGIFQASFKPLIDAVLEGFNSTIFAYGQTGAGKTWTMGGNKEEPGAIPNSFKH--LFDAINSSSSNQNFLVIGSYLELYN  148 (350)
T ss_dssp             HHHHHHTTHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHH--HHHHHHTCCTTEEEEEEEEEEEEET
T ss_pred             hHHHHHHHHHHHHHHhCCCceeEEeecCCCCCCCEEeecCCccCchHHHHHHH--HHHHHHhhccCCcEEEEEEEEEEeC
Confidence            99999999999999999999999999999999999999999999999999999  999987422         8999999


Q ss_pred             ceeeEe---------------------------------------------------ecCcccceeeEEEEEEeeccc--
Q psy4062         220 TCLILR---------------------------------------------------RKPSICEKMQLMVYVKMQDKA--  246 (409)
Q Consensus       220 ~~~~~~---------------------------------------------------~~~ssrsh~i~~i~v~~~~~~--  246 (409)
                      +.++|+                                                   +..|||||++|+|+++..+..  
T Consensus       149 E~i~DLL~~~~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~  228 (350)
T 2vvg_A          149 EEIRDLIKNNTKLPLKEDKTRGIYVDGLSMHRVTTAAELSALMDKGFANRHVAATQMNDTSSRSHSIFMVRIECSEVIEN  228 (350)
T ss_dssp             TEEEETTTTEEEECEEEETTTEEEETTCCCEEESSHHHHHHHHHHHHHHC----------CTTCEEEEEEEEEEEEC---
T ss_pred             CEEEEcccCCcCceeeEcCCCCEEecCCEEEEcCCHHHHHHHHHHHHhccccccccCCCCCCcceEEEEEEEEEeeccCC
Confidence            998886                                                   234899999999999876643  


Q ss_pred             cceeEEeEEEEeecCCcccccccCCccchhhhhcccchhHHHHHHHHHHHhcCCCCcccCCchhhHhhhhccCCCccEEE
Q psy4062         247 TKQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVM  326 (409)
Q Consensus       247 ~~~~~~skL~~VDLAGSEr~~~~~~~~~r~~E~~~IN~SL~aL~~vI~aL~~~~~~iPyRdSkLT~LLk~sLgGn~~t~~  326 (409)
                      ......++|+|||||||||..++++.|++++|+.+||+||++||+||.+|++++.||||||||||+||||+|||||+|+|
T Consensus       229 ~~~~~~skl~lVDLAGSEr~~~t~~~g~rl~E~~~IN~SL~aLg~vI~aL~~~~~hvPyRdSkLT~lLqdsLgGnskt~m  308 (350)
T 2vvg_A          229 KEVIRVGKLNLVDLAGSERQSKTGATGETLVEGAKINLSLSALGLVISKLVEGATHIPYRDSKLTRLLQDSLGGNSKTLM  308 (350)
T ss_dssp             -CEEEEEEEEEEECCCCCC---------------CTTHHHHHHHHHHHHHHHTCSSCCGGGCHHHHHTTTTTTSSSEEEE
T ss_pred             CccEEEEEEEEEeCCCCCccccccccHHHHHHHHHHhHHHHHHHHHHHHHHcCCCCCCccccHHHHHHHHhcCCCccEEE
Confidence            34567899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCCCHHHHHHHHHHHHHHhcCcccceeeccCCch
Q psy4062         327 IANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGAH  366 (409)
Q Consensus       327 I~~isP~~~~~~eTl~TL~fa~rak~Ik~~~~~n~~~~~~  366 (409)
                      |+||||+..+++||++||+||+|||+|+|+|++|....+.
T Consensus       309 I~~isP~~~~~~ETl~TL~fA~rak~i~n~~~~n~~~~~~  348 (350)
T 2vvg_A          309 CANISPASTNYDETMSTLRYADRAKQIKNKPRINEDPKDA  348 (350)
T ss_dssp             EEEECCBGGGHHHHHHHHHHHHHHTTCBCCCCCCBSCTTC
T ss_pred             EEEeCCccccHHHHHHHHHHHHHHhhccccceecCCchhc
Confidence            9999999999999999999999999999999999876653
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 409
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 3e-49
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 5e-48
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 2e-44
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 8e-44
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 2e-43
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 4e-43
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 4e-42
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 3e-41
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 4e-41
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif1a [TaxId: 10090]

 Score =  168 bits (426), Expect = 3e-49
 Identities = 94/366 (25%), Positives = 145/366 (39%), Gaps = 108/366 (29%)

Query: 74  KVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKE 133
           KV +RVRP + +E     + I+++    T I +PKQ                    K   
Sbjct: 4   KVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQ-------------------PKETP 44

Query: 134 MEFLFDRVYGPSE--------SNQDVYDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTM 185
             F FD  Y            S + VY    ++++    EGYN  +F YG TGAGK++TM
Sbjct: 45  KSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTM 104

Query: 186 LGNENHK--GIMYLTMGI-----------------------------------RNRVSAL 208
           +G +     GI+                                         +N+ +  
Sbjct: 105 MGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLR 164

Query: 209 TRQMCTMRMYKTCLILRRKPSICEKMQLMVYVKMQDKATKQMKMVKLSM----------- 257
            R+   +  Y   L      S  +   LM     + +      M + S            
Sbjct: 165 VREHPLLGPYVEDLSKLAVTSYNDIQDLM-DSGNKPRTVAATNMNETSSRSHAVFNIIFT 223

Query: 258 --------------------IDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLA 297
                               +DLAGSERA +  +   R KEG+NINKSL  LG  I++LA
Sbjct: 224 QKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALA 283

Query: 298 DGC------------RHVPYRDSKLTRILKDSLGGNCKTVMIANIAPTALSYEDSYNTLK 345
           +                +PYRDS LT +L+++LGGN +T M+A ++P  ++Y+++ +TL+
Sbjct: 284 EMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLR 343

Query: 346 YATRAK 351
           YA RAK
Sbjct: 344 YADRAK 349
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query409
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.56
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.72
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.48
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.07
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.89
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.15
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.29
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 84.63
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 84.63
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 83.95
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 83.52
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 83.19
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 83.12
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.26
d1okkd2207 GTPase domain of the signal recognition particle r 81.66
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 80.67
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=9.4e-72  Score=558.69  Aligned_cols=270  Identities=33%  Similarity=0.563  Sum_probs=239.6

Q ss_pred             CeEEEEEeCCCCChhhccCCceEEEEeCCcEEEeCCCCCCCcceeeccccchhhccccCCCceeEeeceEeCCCCCchhh
Q psy4062          72 HMKVYIRVRPQSQKEEDGCHREIVKILNRDTIIFDPKQDDSEFFFHGVKQSLRDINKKKSKEMEFLFDRVYGPSESNQDV  151 (409)
Q Consensus        72 ~ikV~vRvRP~~~~E~~~~~~~~v~~~~~~~ii~dp~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~FD~VF~~~asQ~eV  151 (409)
                      .|||+|||||+.+.|...+...++.+.++.++...+..                     ...+.|.||+||+++++|++|
T Consensus         1 rIkV~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~---------------------~~~~~f~FD~vf~~~~~q~~v   59 (364)
T d1sdma_           1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKD---------------------DKAKQHMYDRVFDGNATQDDV   59 (364)
T ss_dssp             CCEEEEEECCCCHHHHHTTCCBCEEECSTTEEEEECSS---------------------SSEEEEECSEEECTTCCHHHH
T ss_pred             CeEEEEEcCCCChhhcccCCCCeEEeCCCCeEEecCCC---------------------CCceEEECCeecCCCCCHHHH
Confidence            48999999999999988888888888888776543322                     234689999999999999999


Q ss_pred             hccchHHHHHHHhcCcceEEEeeccCCCCceeeecCCCCCCchhhhhhhhhhHHHhhhhce---------eEEEEEecee
Q psy4062         152 YDGSTKDIIASLLEGYNCSVFVYGATGAGKTHTMLGNENHKGIMYLTMGIRNRVSALTRQM---------CTMRMYKTCL  222 (409)
Q Consensus       152 f~~~~~plV~~vl~G~N~tI~aYGqTGSGKTyTm~G~~~~~GIi~~~~~~~~lf~~~~~~~---------s~~eiy~~~~  222 (409)
                      |+.+ .|+|+++++|||+||||||||||||||||+|+.+++||+||++.+  +|..+....         ||+|||++.+
T Consensus        60 y~~v-~~lv~~~l~G~n~~i~aYGqTGSGKTyTm~G~~~~~Giipr~~~~--lf~~i~~~~~~~~~~v~~S~~EIyne~i  136 (364)
T d1sdma_          60 FEDT-KYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGADSNPGLTPRAMSE--LFRIMKKDSNKFSFSLKAYMVELYQDTL  136 (364)
T ss_dssp             HHTT-THHHHHHHTTCEEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHH--HHHHHHHGGGTEEEEEEEEEEEESSSCE
T ss_pred             HHHH-HHHHHHHhcCCceeeeccccCCCCcccccccCccccchhHHHHHH--HHhhhhhccccccceEEEEEEEEecccc
Confidence            9975 899999999999999999999999999999999999999999999  998876543         8999999988


Q ss_pred             eEe-------------------------------------------------------ecCcccceeeEEEEEEeecccc
Q psy4062         223 ILR-------------------------------------------------------RKPSICEKMQLMVYVKMQDKAT  247 (409)
Q Consensus       223 ~~~-------------------------------------------------------~~~ssrsh~i~~i~v~~~~~~~  247 (409)
                      +|+                                                       +..++|+|++|++++.......
T Consensus       137 ~DLL~~~~~~~~~l~~~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~  216 (364)
T d1sdma_         137 VDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQT  216 (364)
T ss_dssp             EETTSCTTSCCCCCEEEECTTSCEEEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETTT
T ss_pred             ccccCcccccccccceeecccCccccccceeeeeCCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEeccCc
Confidence            887                                                       1237899999999999998888


Q ss_pred             ceeEEeEEEEeecCCcccccccCCccchhhhhcccchhHHHHHHHHHHHhcCCCCcccCCchhhHhhhhccCCCccEEEE
Q psy4062         248 KQMKMVKLSMIDLAGSERAAANSSNQMRFKEGSNINKSLLALGNCINSLADGCRHVPYRDSKLTRILKDSLGGNCKTVMI  327 (409)
Q Consensus       248 ~~~~~skL~~VDLAGSEr~~~~~~~~~r~~E~~~IN~SL~aL~~vI~aL~~~~~~iPyRdSkLT~LLk~sLgGn~~t~~I  327 (409)
                      .....++|+|||||||||..++++.|.+++|+..||+||++|++||.+|++++.|||||+||||+||+|+|||||+|+||
T Consensus       217 ~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~~~ipyR~SkLT~lL~d~Lggns~t~~I  296 (364)
T d1sdma_         217 QAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMF  296 (364)
T ss_dssp             CCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHHHHTCSCCCGGGCHHHHHTTTTTTSSSEEEEE
T ss_pred             ceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHHHcCCCcCCchhhhhhHHHHhhcCCCceEEEE
Confidence            88899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCCCHHHHHHHHHHHHHHhcCcccceeeccCCc
Q psy4062         328 ANIAPTALSYEDSYNTLKYATRAKKIKAKVSRTFKSGA  365 (409)
Q Consensus       328 ~~isP~~~~~~eTl~TL~fa~rak~Ik~~~~~n~~~~~  365 (409)
                      +||||...+++||++||+||++||+|+|+|++|+...+
T Consensus       297 ~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~~~  334 (364)
T d1sdma_         297 VNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSSKE  334 (364)
T ss_dssp             EEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCCEECHH
T ss_pred             EEeCCCcchHHHHHHHHHHHHHHhhcccCCcccCCHHH
Confidence            99999999999999999999999999999999987654
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure