Psyllid ID: psy4259
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 203 | ||||||
| 283945482 | 324 | nuclear excision repair protein rad23 [B | 0.906 | 0.567 | 0.418 | 3e-38 | |
| 357621015 | 323 | nuclear excision repair protein rad23 [D | 0.862 | 0.541 | 0.441 | 5e-37 | |
| 47205078 | 320 | unnamed protein product [Tetraodon nigro | 0.852 | 0.540 | 0.363 | 3e-24 | |
| 170590706 | 354 | UV excision repair protein Rad23 contain | 0.857 | 0.491 | 0.356 | 3e-23 | |
| 393911377 | 337 | UV excision repair protein Rad23 [Loa lo | 0.817 | 0.492 | 0.360 | 4e-22 | |
| 345482490 | 377 | PREDICTED: UV excision repair protein RA | 0.290 | 0.156 | 0.822 | 1e-21 | |
| 187117168 | 347 | rad23 protein [Acyrthosiphon pisum] gi|8 | 0.300 | 0.175 | 0.836 | 2e-21 | |
| 312095801 | 341 | UV excision repair protein Rad23 contain | 0.793 | 0.472 | 0.359 | 3e-21 | |
| 345482494 | 367 | PREDICTED: UV excision repair protein RA | 0.290 | 0.160 | 0.806 | 4e-21 | |
| 427787569 | 397 | Putative nucleotide excision repair fact | 0.206 | 0.105 | 0.793 | 5e-21 |
| >gi|283945482|ref|NP_001164652.1| nuclear excision repair protein rad23 [Bombyx mori] gi|217331039|gb|ACK38234.1| nuclear excision repair protein Rad23 [Bombyx mori] | Back alignment and taxonomy information |
|---|
Score = 163 bits (413), Expect = 3e-38, Method: Compositional matrix adjust.
Identities = 106/253 (41%), Positives = 134/253 (52%), Gaps = 69/253 (27%)
Query: 17 QQTVS-HLDVQEEVKQLKEKIQSEKGSEYLAEYQKLIYAGKILSDDQALSEYNIDESKFI 75
QQT +D +E VK LK KI+ EKG +++A++Q+LIYAGKIL DD ++ YNIDE KFI
Sbjct: 10 QQTFQIEIDPEETVKALKLKIEVEKGKDFVADHQRLIYAGKILLDDNKINSYNIDEKKFI 69
Query: 76 VVMLSKPK-------PTPAPYSGPSDPTQPAGQE------SEATRPATA----------- 111
V+M++KPK T P +G S T + E +P TA
Sbjct: 70 VIMVTKPKVSESQPTSTSIPEAGESASTDSGDAKPKTVPPEEVVKPTTAETERVTETPNT 129
Query: 112 TSDSMLKVFFERVNPYG----------------------------------------GES 131
TSD+ L+ + + G
Sbjct: 130 TSDAELEATIQSIMDMGYDRPQVEQALRASFNNRERAVEYLITGIPEELLHEQEAEESSD 189
Query: 132 EDPLAFLRTQPQFQQMRTVVQQNPELLPTVLQQIGQSNPALLELISHNQEAFVRMLNEPV 191
EDPLAFLR QPQFQQMR V+QQNP LL VLQQIGQ+NPALL++IS +QEAFVRMLNEPV
Sbjct: 190 EDPLAFLRDQPQFQQMRAVIQQNPNLLNAVLQQIGQTNPALLQVISQHQEAFVRMLNEPV 249
Query: 192 ----AGDRRNKNV 200
AG ++NV
Sbjct: 250 NPSAAGVASDENV 262
|
Source: Bombyx mori Species: Bombyx mori Genus: Bombyx Family: Bombycidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357621015|gb|EHJ73001.1| nuclear excision repair protein rad23 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|47205078|emb|CAF91196.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|170590706|ref|XP_001900112.1| UV excision repair protein Rad23 containing protein [Brugia malayi] gi|158592262|gb|EDP30862.1| UV excision repair protein Rad23 containing protein [Brugia malayi] | Back alignment and taxonomy information |
|---|
| >gi|393911377|gb|EFO15597.2| UV excision repair protein Rad23 [Loa loa] | Back alignment and taxonomy information |
|---|
| >gi|345482490|ref|XP_003424606.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|187117168|ref|NP_001119685.1| rad23 protein [Acyrthosiphon pisum] gi|89473754|gb|ABD72689.1| putative RAD23-like B [Acyrthosiphon pisum] gi|239788640|dbj|BAH70991.1| ACYPI000077 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|312095801|ref|XP_003148472.1| UV excision repair protein Rad23 containing protein [Loa loa] | Back alignment and taxonomy information |
|---|
| >gi|345482494|ref|XP_003424607.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|427787569|gb|JAA59236.1| Putative nucleotide excision repair factor nef2 rad23 component [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 203 | ||||||
| ZFIN|ZDB-GENE-040808-59 | 362 | rad23aa "RAD23 homolog Aa (S. | 0.305 | 0.171 | 0.661 | 2.6e-37 | |
| UNIPROTKB|A3KMV2 | 362 | RAD23A "UV excision repair pro | 0.290 | 0.162 | 0.677 | 7.6e-36 | |
| UNIPROTKB|F1PTL1 | 362 | RAD23A "Uncharacterized protei | 0.300 | 0.168 | 0.666 | 1.9e-35 | |
| RGD|1309899 | 351 | Rad23a "RAD23 homolog A (S. ce | 0.290 | 0.168 | 0.677 | 4.8e-35 | |
| UNIPROTKB|P54725 | 363 | RAD23A "UV excision repair pro | 0.290 | 0.162 | 0.677 | 5.4e-35 | |
| UNIPROTKB|D4AD39 | 363 | Rad23a "RAD23a homolog (S. cer | 0.290 | 0.162 | 0.677 | 6.8e-35 | |
| MGI|MGI:105126 | 363 | Rad23a "RAD23a homolog (S. cer | 0.290 | 0.162 | 0.677 | 3.7e-34 | |
| POMBASE|SPBC2D10.12 | 368 | rhp23 "Rad23 homolog Rhp23" [S | 0.463 | 0.255 | 0.45 | 2e-33 | |
| UNIPROTKB|K7ESE3 | 308 | RAD23A "UV excision repair pro | 0.472 | 0.311 | 0.454 | 4.1e-30 | |
| UNIPROTKB|G4MUE8 | 401 | MGG_01656 "UV excision repair | 0.330 | 0.167 | 0.492 | 5.4e-25 |
| ZFIN|ZDB-GENE-040808-59 rad23aa "RAD23 homolog Aa (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 220 (82.5 bits), Expect = 2.6e-37, Sum P(2) = 2.6e-37
Identities = 41/62 (66%), Positives = 50/62 (80%)
Query: 130 ESEDPLAFLRTQPQFQQMRTVVQQNPELLPTVLQQIGQSNPALLELISHNQEAFVRMLNE 189
E E+PL FLR+QPQFQ MR V+QQNP LLP +LQQ+GQ NP LL+ IS +QE F++MLN
Sbjct: 223 EGENPLEFLRSQPQFQSMRQVIQQNPSLLPALLQQLGQENPELLQQISQHQELFIQMLNA 282
Query: 190 PV 191
PV
Sbjct: 283 PV 284
|
|
| UNIPROTKB|A3KMV2 RAD23A "UV excision repair protein RAD23 homolog A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PTL1 RAD23A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1309899 Rad23a "RAD23 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P54725 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AD39 Rad23a "RAD23a homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105126 Rad23a "RAD23a homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC2D10.12 rhp23 "Rad23 homolog Rhp23" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ESE3 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MUE8 MGG_01656 "UV excision repair protein Rad23" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 203 | |||
| pfam09280 | 59 | pfam09280, XPC-binding, XPC-binding domain | 9e-26 | |
| cd01805 | 77 | cd01805, RAD23_N, Ubiquitin-like domain of RAD23 | 1e-24 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 5e-23 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 2e-18 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 6e-13 | |
| smart00213 | 72 | smart00213, UBQ, Ubiquitin homologues | 6e-13 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 8e-13 | |
| cd01809 | 72 | cd01809, Scythe_N, Ubiquitin-like domain of Scythe | 6e-11 | |
| cd00196 | 69 | cd00196, UBQ, Ubiquitin-like proteins | 3e-04 | |
| smart00727 | 41 | smart00727, STI1, Heat shock chaperonin-binding mo | 3e-04 | |
| cd01803 | 76 | cd01803, Ubiquitin, Ubiquitin | 4e-04 | |
| pfam10302 | 90 | pfam10302, DUF2407, DUF2407 ubiquitin-like domain | 7e-04 | |
| cd01790 | 79 | cd01790, Herp_N, Homocysteine-responsive endoplasm | 0.003 |
| >gnl|CDD|192241 pfam09280, XPC-binding, XPC-binding domain | Back alignment and domain information |
|---|
Score = 93.8 bits (234), Expect = 9e-26
Identities = 41/59 (69%), Positives = 48/59 (81%)
Query: 135 LAFLRTQPQFQQMRTVVQQNPELLPTVLQQIGQSNPALLELISHNQEAFVRMLNEPVAG 193
LAFLR PQFQQ+R +VQQNPELLP +LQQ+GQSNP LL+LI NQE F+R+LNE G
Sbjct: 1 LAFLRNNPQFQQLRQMVQQNPELLPPLLQQLGQSNPQLLQLIQQNQEEFLRLLNEGAEG 59
|
Members of this family adopt a structure consisting of four alpha helices, arranged in an array. They bind specifically and directly to the xeroderma pigmentosum group C protein (XPC) to initiate nucleotide excision repair. Length = 59 |
| >gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
| >gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|128966 smart00727, STI1, Heat shock chaperonin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin | Back alignment and domain information |
|---|
| >gnl|CDD|220681 pfam10302, DUF2407, DUF2407 ubiquitin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176385 cd01790, Herp_N, Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| KOG0011|consensus | 340 | 100.0 | ||
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 100.0 | |
| KOG0010|consensus | 493 | 99.9 | ||
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.8 | |
| PF09280 | 59 | XPC-binding: XPC-binding domain; InterPro: IPR0153 | 99.8 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.79 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.79 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.78 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.77 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.76 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.76 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.76 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.76 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.75 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.75 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.74 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.73 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.73 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.73 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.72 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.71 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.71 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.7 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.68 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.65 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.61 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.6 | |
| KOG0005|consensus | 70 | 99.59 | ||
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.56 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.53 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.53 | |
| KOG0003|consensus | 128 | 99.46 | ||
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 99.43 | |
| KOG0004|consensus | 156 | 99.42 | ||
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.42 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 99.32 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 99.31 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 99.29 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 99.17 | |
| KOG4248|consensus | 1143 | 99.02 | ||
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 99.01 | |
| PLN02560 | 308 | enoyl-CoA reductase | 98.98 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.95 | |
| KOG0001|consensus | 75 | 98.89 | ||
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.89 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 98.69 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 98.56 | |
| KOG1872|consensus | 473 | 98.56 | ||
| KOG0006|consensus | 446 | 98.18 | ||
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 98.08 | |
| KOG3493|consensus | 73 | 98.06 | ||
| KOG4495|consensus | 110 | 97.97 | ||
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 97.86 | |
| KOG1769|consensus | 99 | 97.83 | ||
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 97.82 | |
| KOG0012|consensus | 380 | 97.82 | ||
| KOG4583|consensus | 391 | 97.78 | ||
| smart00727 | 41 | STI1 Heat shock chaperonin-binding motif. | 97.72 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 97.68 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 97.61 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 97.48 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 97.43 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 97.36 | |
| COG5417 | 81 | Uncharacterized small protein [Function unknown] | 97.34 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 97.34 | |
| KOG1639|consensus | 297 | 97.24 | ||
| KOG0013|consensus | 231 | 97.05 | ||
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 97.01 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 96.73 | |
| KOG3206|consensus | 234 | 96.73 | ||
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 96.66 | |
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 96.53 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 96.24 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 95.85 | |
| KOG0010|consensus | 493 | 95.49 | ||
| PF14836 | 88 | Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A | 93.59 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 93.11 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 92.7 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 92.64 | |
| PF12754 | 309 | Blt1: Cell-cycle control medial ring component; In | 92.15 | |
| KOG2086|consensus | 380 | 91.72 | ||
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 91.48 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 91.36 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 91.08 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 90.74 | |
| PF10209 | 122 | DUF2340: Uncharacterized conserved protein (DUF234 | 89.71 | |
| KOG2507|consensus | 506 | 89.24 | ||
| PF11620 | 88 | GABP-alpha: GA-binding protein alpha chain; InterP | 88.82 | |
| PF14453 | 57 | ThiS-like: ThiS-like ubiquitin | 88.23 | |
| PF02597 | 77 | ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam | 88.19 | |
| KOG2561|consensus | 568 | 87.9 | ||
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 87.76 | |
| COG5100 | 571 | NPL4 Nuclear pore protein [Nuclear structure] | 87.51 | |
| smart00666 | 81 | PB1 PB1 domain. Phox and Bem1p domain, present in | 86.72 | |
| PRK07440 | 70 | hypothetical protein; Provisional | 86.41 | |
| KOG2982|consensus | 418 | 85.53 | ||
| TIGR01682 | 80 | moaD molybdopterin converting factor, subunit 1, n | 84.76 | |
| PF11069 | 98 | DUF2870: Protein of unknown function (DUF2870); In | 84.57 | |
| TIGR01687 | 88 | moaD_arch MoaD family protein, archaeal. Members o | 84.16 | |
| cd00565 | 65 | ThiS ThiaminS ubiquitin-like sulfur carrier protei | 83.76 | |
| PRK06488 | 65 | sulfur carrier protein ThiS; Validated | 83.69 | |
| PF10407 | 73 | Cytokin_check_N: Cdc14 phosphatase binding protein | 82.82 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 82.7 | |
| PRK05863 | 65 | sulfur carrier protein ThiS; Provisional | 82.56 | |
| PF00564 | 84 | PB1: PB1 domain; InterPro: IPR000270 The Phox and | 82.55 | |
| smart00727 | 41 | STI1 Heat shock chaperonin-binding motif. | 82.46 | |
| TIGR02958 | 452 | sec_mycoba_snm4 secretion protein snm4. Members of | 82.24 | |
| PF10790 | 76 | DUF2604: Protein of Unknown function (DUF2604); In | 82.07 | |
| PF08337 | 539 | Plexin_cytopl: Plexin cytoplasmic RasGAP domain; I | 81.37 | |
| cd06407 | 82 | PB1_NLP A PB1 domain is present in NIN like protei | 80.29 | |
| cd06408 | 86 | PB1_NoxR The PB1 domain is present in the Epichloe | 80.22 | |
| KOG1364|consensus | 356 | 80.01 |
| >KOG0011|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-41 Score=288.40 Aligned_cols=186 Identities=46% Similarity=0.745 Sum_probs=153.2
Q ss_pred eEEEEEeCCCCeee-ecCCCCcHHHHHHHHHhhhCCCCCCCceEEEeCCeecCCCCCccccccCCCCEEEEEeecCCCCC
Q psy4259 8 ISDITQNQWQQTVS-HLDVQEEVKQLKEKIQSEKGSEYLAEYQKLIYAGKILSDDQALSEYNIDESKFIVVMLSKPKPTP 86 (203)
Q Consensus 8 m~I~Vk~~~g~~~~-~v~~~~TV~~LK~~I~~~~~~~ip~~~qkLi~~Gk~L~D~~tL~~~gI~~~~~i~v~~~k~~~~~ 86 (203)
|+|+||+++|.+|+ ++.+++||.++|++|+...|.++|++.|||||+||+|+|+.|+.+|+|+++++|+||++|++.++
T Consensus 1 m~lt~KtL~q~~F~iev~Pe~tV~evK~kIet~~g~dyP~~~QkLIy~GkiL~D~~tv~Eykv~E~~fiVvMlsK~k~~~ 80 (340)
T KOG0011|consen 1 MKLTVKTLKQQTFTIEVKPEDTVVEVKKKIETEKGPDYPAEQQKLIYSGKILKDETTVGEYKVKEKKFIVVMLSKDKSAS 80 (340)
T ss_pred CeeEeeeccCceeEeecCcchhHHHHHHHHHhccCCCCchhhheeeecceeccCCcchhhhccccCceEEEEEecCcccc
Confidence 78999999999999 99999999999999999999889999999999999999999999999999999999999987222
Q ss_pred C---CCCCCCC--------CCC-CCCCCC--CCCC------------------CchhhHHHHHhCCcCCC----------
Q psy4259 87 A---PYSGPSD--------PTQ-PAGQES--EATR------------------PATATSDSMLKVFFERV---------- 124 (203)
Q Consensus 87 ~---p~~~~~~--------p~~-~p~~~~--~~~~------------------~~~~~v~~~~~mG~~~~---------- 124 (203)
+ |.+++.. |+. .....+ +++. ..+.+|.+||+|||+|+
T Consensus 81 t~~ap~s~~~~~~p~~~~ap~~s~a~~~s~~~~~~~~~~~~~~~aas~Lv~G~~~e~~V~~Im~MGy~re~V~~AlRAaf 160 (340)
T KOG0011|consen 81 TQVAPQSSAATHLPKAAEAPPSSAAEDASPATPAQTSQEDTYEIAASTLVVGSEYEQTVQQIMEMGYDREEVERALRAAF 160 (340)
T ss_pred cCCCCCCccccCCCccCCCCCccccccCCCCccccccccchhhhhhhhhhccchhHHHHHHHHHhCccHHHHHHHHHHhh
Confidence 2 1111100 100 000000 0000 11679999999999998
Q ss_pred -CCC--------------------------CC------------------CCCChHHHhhCCHHHHHHHHHHHhCCCcHH
Q psy4259 125 -NPY--------------------------GG------------------ESEDPLAFLRTQPQFQQMRTVVQQNPELLP 159 (203)
Q Consensus 125 -np~--------------------------~~------------------~~~~pl~~l~~~P~~~~~r~~i~~nP~~l~ 159 (203)
||+ +. .+.+|+++||++|+|++||++|++||++|+
T Consensus 161 NNPeRAVEYLl~GIP~~~~~~~~~~~~~~~~~~p~~~~p~~~~~~~~~~~~~~~~l~fLr~~~qf~~lR~~iqqNP~ll~ 240 (340)
T KOG0011|consen 161 NNPERAVEYLLNGIPEDAEVPEPEKSTAAAAELPANAQPLDLFPQGAVEASGGDPLEFLRNQPQFQQLRQMIQQNPELLH 240 (340)
T ss_pred CChhhhHHHHhcCCcccccCCcccCCcccCCCCCCCCChhhcCCccchhhhcCCchhhhhccHHHHHHHHHHhhCHHHHH
Confidence 440 01 134679999999999999999999999999
Q ss_pred HHHHHHhhcCHHHHHHHhhCHHHHHHHHcCCccc
Q psy4259 160 TVLQQIGQSNPALLELISHNQEAFVRMLNEPVAG 193 (203)
Q Consensus 160 ~il~~l~~~nP~l~~~i~~n~~~f~~ml~~p~~~ 193 (203)
.+||+|++.||+|+++|++||++|++||++|.++
T Consensus 241 ~~Lqqlg~~nP~L~q~Iq~nqe~Fl~mlnep~~~ 274 (340)
T KOG0011|consen 241 PLLQQLGKQNPQLLQLIQENQEAFLQLLNEPVEG 274 (340)
T ss_pred HHHHHHhhhCHHHHHHHHHHHHHHHHHhhccccc
Confidence 9999999999999999999999999999999886
|
|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >KOG0010|consensus | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >KOG0005|consensus | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >KOG0003|consensus | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >KOG0004|consensus | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >KOG4248|consensus | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >KOG0001|consensus | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >KOG0006|consensus | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >KOG3493|consensus | Back alignment and domain information |
|---|
| >KOG4495|consensus | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >KOG1769|consensus | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >KOG0012|consensus | Back alignment and domain information |
|---|
| >KOG4583|consensus | Back alignment and domain information |
|---|
| >smart00727 STI1 Heat shock chaperonin-binding motif | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >COG5417 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >KOG1639|consensus | Back alignment and domain information |
|---|
| >KOG0013|consensus | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
| >KOG3206|consensus | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >KOG0010|consensus | Back alignment and domain information |
|---|
| >PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures | Back alignment and domain information |
|---|
| >KOG2086|consensus | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown | Back alignment and domain information |
|---|
| >KOG2507|consensus | Back alignment and domain information |
|---|
| >PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) | Back alignment and domain information |
|---|
| >PF14453 ThiS-like: ThiS-like ubiquitin | Back alignment and domain information |
|---|
| >PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer | Back alignment and domain information |
|---|
| >KOG2561|consensus | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >COG5100 NPL4 Nuclear pore protein [Nuclear structure] | Back alignment and domain information |
|---|
| >smart00666 PB1 PB1 domain | Back alignment and domain information |
|---|
| >PRK07440 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal | Back alignment and domain information |
|---|
| >PF11069 DUF2870: Protein of unknown function (DUF2870); InterPro: IPR021298 This is a eukaryotic family of proteins with unknown function | Back alignment and domain information |
|---|
| >TIGR01687 moaD_arch MoaD family protein, archaeal | Back alignment and domain information |
|---|
| >cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein | Back alignment and domain information |
|---|
| >PRK06488 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PF10407 Cytokin_check_N: Cdc14 phosphatase binding protein N-terminus ; InterPro: IPR018844 Cytokinesis in yeasts involves a family of proteins whose essential function is to bind Cdc14-family phosphatase and prevent this from being sequestered and inhibited in the nucleolus | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PRK05863 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins | Back alignment and domain information |
|---|
| >smart00727 STI1 Heat shock chaperonin-binding motif | Back alignment and domain information |
|---|
| >TIGR02958 sec_mycoba_snm4 secretion protein snm4 | Back alignment and domain information |
|---|
| >PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function | Back alignment and domain information |
|---|
| >PF08337 Plexin_cytopl: Plexin cytoplasmic RasGAP domain; InterPro: IPR013548 This domain is found at C terminus of various plexins (e | Back alignment and domain information |
|---|
| >cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) | Back alignment and domain information |
|---|
| >cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA | Back alignment and domain information |
|---|
| >KOG1364|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 203 | ||||
| 1pve_A | 72 | Solution Structure Of Xpc Binding Domain Of Hhr23b | 1e-17 | ||
| 2f4m_B | 61 | The Mouse Pngase-Hr23 Complex Reveals A Complete Re | 2e-17 | ||
| 1uel_A | 95 | Solution Structure Of Ubiquitin-Like Domain Of Hhr2 | 3e-16 | ||
| 1p1a_A | 85 | Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Le | 6e-15 | ||
| 1oqy_A | 368 | Structure Of The Dna Repair Protein Hhr23a Length = | 6e-13 | ||
| 1oqy_A | 368 | Structure Of The Dna Repair Protein Hhr23a Length = | 4e-12 | ||
| 1tp4_A | 97 | Solution Structure Of The Xpc Binding Domain Of Hhr | 8e-12 | ||
| 2wyq_A | 85 | The Crystal Structure Of The Ubiquitin-Like (Ubl) D | 1e-11 | ||
| 1p98_A | 78 | High-Resolution Nmr Structure Of The Ubl-Domain Of | 5e-11 |
| >pdb|1PVE|A Chain A, Solution Structure Of Xpc Binding Domain Of Hhr23b Length = 72 | Back alignment and structure |
|
| >pdb|2F4M|B Chain B, The Mouse Pngase-Hr23 Complex Reveals A Complete Remodulation Of The Protein-Protein Interface Compared To Its Yeast Orthologs Length = 61 | Back alignment and structure |
| >pdb|1UEL|A Chain A, Solution Structure Of Ubiquitin-Like Domain Of Hhr23b Complexed With Ubiquitin-Interacting Motif Of Proteasome Subunit S5a Length = 95 | Back alignment and structure |
| >pdb|1P1A|A Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Length = 85 | Back alignment and structure |
| >pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 | Back alignment and structure |
| >pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 | Back alignment and structure |
| >pdb|1TP4|A Chain A, Solution Structure Of The Xpc Binding Domain Of Hhr23a Protein Length = 97 | Back alignment and structure |
| >pdb|2WYQ|A Chain A, The Crystal Structure Of The Ubiquitin-Like (Ubl) Domain Of Hhr23a (Human Homologue A Of Rad23) Length = 85 | Back alignment and structure |
| >pdb|1P98|A Chain A, High-Resolution Nmr Structure Of The Ubl-Domain Of Hhr23a Length = 78 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 203 | |||
| 1pve_A | 72 | HHR23B, UV excision repair protein RAD23 homolog B | 7e-25 | |
| 2f4m_B | 61 | UV excision repair protein RAD23 homolog B; glycop | 3e-24 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 4e-23 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 7e-23 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 2e-21 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 1e-17 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 2e-17 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 3e-15 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 4e-13 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 4e-15 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 9e-15 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 2e-14 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 2e-14 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 5e-14 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 3e-13 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 7e-13 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 8e-13 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 6e-12 | |
| 3u5c_F | 225 | RP14, S2, YS8, 40S ribosomal protein S5; translati | 1e-11 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 2e-11 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 2e-11 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 5e-11 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 9e-11 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 9e-11 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 4e-10 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 9e-10 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 2e-09 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 3e-09 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 5e-09 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 6e-09 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 7e-09 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 7e-09 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 1e-08 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 1e-08 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 1e-08 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 2e-08 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 2e-08 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 3e-08 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 6e-08 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 6e-08 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 7e-08 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 7e-08 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 7e-08 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 1e-07 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 1e-07 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 2e-07 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 2e-07 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 3e-07 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 3e-07 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 4e-07 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 8e-07 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 1e-06 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 1e-06 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 5e-05 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 3e-06 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 7e-06 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 4e-06 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 5e-06 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 2e-04 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 8e-06 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 8e-06 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 8e-06 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 9e-05 |
| >1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Length = 72 | Back alignment and structure |
|---|
Score = 91.5 bits (227), Expect = 7e-25
Identities = 41/64 (64%), Positives = 49/64 (76%)
Query: 131 SEDPLAFLRTQPQFQQMRTVVQQNPELLPTVLQQIGQSNPALLELISHNQEAFVRMLNEP 190
S PL FLR QPQFQQMR ++QQNP LLP +LQQIG+ NP LL+ IS +QE F++MLNEP
Sbjct: 2 SHMPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEP 61
Query: 191 VAGD 194
V
Sbjct: 62 VQEA 65
|
| >2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Length = 61 | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 116 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Length = 307 | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 100.0 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.85 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.83 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.82 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.82 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.82 | |
| 1pve_A | 72 | HHR23B, UV excision repair protein RAD23 homolog B | 99.82 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.81 | |
| 2f4m_B | 61 | UV excision repair protein RAD23 homolog B; glycop | 99.81 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.81 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.8 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.79 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.79 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.79 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.79 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.79 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.79 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.78 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.78 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.78 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.78 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.78 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.77 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.77 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.77 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.77 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.77 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.77 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.77 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.77 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.77 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.76 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.76 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.76 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.76 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.76 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.76 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.76 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.76 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.75 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.75 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.75 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.75 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.74 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.74 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.74 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.73 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.73 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.73 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.73 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.73 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.72 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.72 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 99.72 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.72 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.72 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 99.55 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.71 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.7 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.7 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.7 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.7 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.69 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.69 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.69 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.69 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.69 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.68 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.68 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.67 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.67 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.66 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.64 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.64 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.63 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.63 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.62 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.61 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.6 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.6 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.57 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.57 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 99.57 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.57 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.56 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.56 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.53 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.51 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.5 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 99.44 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.44 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 99.43 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 99.39 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 99.36 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 99.32 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 99.31 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 99.3 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 99.24 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 99.23 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 98.97 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 98.72 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 98.71 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 98.67 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 98.64 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 98.46 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 98.34 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 98.21 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 98.11 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 98.02 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 97.98 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 97.94 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 97.92 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 97.91 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 97.83 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 97.81 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 97.68 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 97.43 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 97.2 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 97.03 | |
| 2lnm_A | 62 | Protein TIC 40, chloroplastic; translocon, import, | 96.55 | |
| 2llw_A | 71 | Heat shock protein STI1; DP domain, alpha helix, c | 96.44 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 96.19 | |
| 4e71_A | 111 | Plexin-B2, MM1; transmembrane, signaling, RBD, str | 95.4 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 95.22 | |
| 2r2o_A | 138 | Plexin-B1; effector domain, structural genomics, s | 95.14 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 95.06 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 94.72 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 94.72 | |
| 3h6n_A | 127 | Plexin-D1; structural genomics consortium, SGC, me | 94.45 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 94.42 | |
| 2llv_A | 71 | Heat shock protein STI1; DP domain, alpha helix, c | 94.23 | |
| 2llw_A | 71 | Heat shock protein STI1; DP domain, alpha helix, c | 93.03 | |
| 4e74_A | 117 | Plexin-A4; RBD, structural genomics, structural ge | 92.4 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 92.3 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 92.1 | |
| 2juo_A | 89 | GA-binding protein alpha chain; OST, ubiquitin, tr | 92.06 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 91.86 | |
| 1wgk_A | 114 | Riken cDNA 2900073H19 protein; THis domain, ubiqut | 91.7 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 91.5 | |
| 3onh_A | 127 | Ubiquitin-activating enzyme E1-like; ligase, SUMO | 90.02 | |
| 3hm6_X | 644 | Plexin-B1; structural genomics consortium, SGC, me | 89.02 | |
| 2lnm_A | 62 | Protein TIC 40, chloroplastic; translocon, import, | 88.78 | |
| 1wgy_A | 104 | RAP guanine nucleotide exchange factor 5; ubiquiti | 88.49 | |
| 3ig3_A | 627 | Plxna3 protein; plexin intracellular GAP RBD inact | 87.17 | |
| 3po0_A | 89 | Small archaeal modifier protein 1; ubiquitin-like | 87.07 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 85.69 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 85.62 | |
| 1vd2_A | 89 | Protein kinase C, IOTA type; PB1 domain, OPCA moti | 85.58 | |
| 3kuz_A | 126 | Plexin-C1; structural genomics, structural genomic | 84.52 | |
| 2k9x_A | 110 | Tburm1, uncharacterized protein; unknown function; | 84.14 | |
| 1f0z_A | 66 | THis protein; ubiquitin fold, transport protein; N | 84.03 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 83.65 | |
| 1pve_A | 72 | HHR23B, UV excision repair protein RAD23 homolog B | 83.33 | |
| 3dwg_C | 93 | 9.5 kDa culture filtrate antigen CFP10A; sulfur ca | 83.27 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 82.92 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 82.11 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 81.71 | |
| 2kl0_A | 73 | Putative thiamin biosynthesis THis; structural gen | 81.55 | |
| 2q5w_D | 77 | Molybdopterin converting factor, subunit 1; MOCO, | 80.9 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 80.49 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 80.21 |
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-40 Score=288.94 Aligned_cols=186 Identities=44% Similarity=0.690 Sum_probs=146.7
Q ss_pred cceEEEEEeCCCCeee-ecCCCCcHHHHHHHHHh---hhCCCCCCCceEEEeCCeecCCCCCccccccCCCCEEEEEeec
Q psy4259 6 HDISDITQNQWQQTVS-HLDVQEEVKQLKEKIQS---EKGSEYLAEYQKLIYAGKILSDDQALSEYNIDESKFIVVMLSK 81 (203)
Q Consensus 6 ~~m~I~Vk~~~g~~~~-~v~~~~TV~~LK~~I~~---~~~~~ip~~~qkLi~~Gk~L~D~~tL~~~gI~~~~~i~v~~~k 81 (203)
..|+|+||+.+|++|. +|++++||.+||++|+. +.| +++++|||||+||+|+|+++|++|+|++|++|++++.|
T Consensus 6 ~~M~I~VKtl~Gk~~~leV~~~~TV~~LK~~I~~~~~~~g--ip~~~QrLiy~GK~L~D~~tL~dygI~~gstIv~lv~k 83 (368)
T 1oqy_A 6 SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDA--FPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK 83 (368)
T ss_dssp CCCCEEEEETTTEEEEECCCTTCBHHHHHHHHHHHTCSSS--CCSTEEEEESSSSEECSSSBTTTTCCCTTSCEEEEEEC
T ss_pred ceEEEEEEeCCCCEEEEEeCCCChHHHHHHHHHHHhCcCC--CChhheEEEECCeecCCcCCHHHcCCCCCCEEEEEEec
Confidence 4699999999999999 99999999999999999 566 99999999999999999999999999999999667666
Q ss_pred CCCCCC-CC--C-----CC----------C-CCCCC-C-C-------------CCCC--C--------C------CC---
Q psy4259 82 PKPTPA-PY--S-----GP----------S-DPTQP-A-G-------------QESE--A--------T------RP--- 108 (203)
Q Consensus 82 ~~~~~~-p~--~-----~~----------~-~p~~~-p-~-------------~~~~--~--------~------~~--- 108 (203)
.+..++ ++ + ++ + .|+++ + + +.++ + . .+
T Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~s~l~ 163 (368)
T 1oqy_A 84 TKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLV 163 (368)
T ss_dssp CCSSSCCCCCSSCCCCCSSSCCCSCCCSSSCCCCCCCSSSSCCCCCSCSCCCCSSTTCSCCCSCSCCCSCCCCCCCTTTC
T ss_pred CCCCCCCCCCcccCCCCCccccCCCCCCCCCCCCCCCccccccCCccccCCCCCCCCccccccccccccccccccccccc
Confidence 543211 10 0 00 0 00000 0 0 0000 0 0 01
Q ss_pred ----chhhHHHHHhCCcCCC-----------CCC--------------------------------CCCCCChHHHhhCC
Q psy4259 109 ----ATATSDSMLKVFFERV-----------NPY--------------------------------GGESEDPLAFLRTQ 141 (203)
Q Consensus 109 ----~~~~v~~~~~mG~~~~-----------np~--------------------------------~~~~~~pl~~l~~~ 141 (203)
.++.|++|++|||+|+ |+. ++...+++++||++
T Consensus 164 ~g~~~~~~i~~l~~MGf~~~~~~~AL~a~~nn~~~A~e~L~~gip~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Lr~~ 243 (368)
T 1oqy_A 164 TGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ 243 (368)
T ss_dssp CTTTHHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTTTTSSTTCSSCCCCCCCCCCSSCCCCSSCCSCCTTHHHHHS
T ss_pred CCcchHHHHHHHHHcCCCHHHHHHHHHHcCCCHHHHHHHHHhCCCcccccccCCccccccccccCccccccchHHHHhcC
Confidence 1578999999999998 331 01234679999999
Q ss_pred HHHHHHHHHHHhCCCcHHHHHHHHhhcCHHHHHHHhhCHHHHHHHHcCCccc
Q psy4259 142 PQFQQMRTVVQQNPELLPTVLQQIGQSNPALLELISHNQEAFVRMLNEPVAG 193 (203)
Q Consensus 142 P~~~~~r~~i~~nP~~l~~il~~l~~~nP~l~~~i~~n~~~f~~ml~~p~~~ 193 (203)
|+|++||++|++||++|++|||+|+++||+|+++|++||++|++||++|.++
T Consensus 244 pqf~~lR~~vq~nP~~l~~~lq~l~~~nP~l~~~I~~n~~~Fl~~l~e~~~~ 295 (368)
T 1oqy_A 244 PQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGE 295 (368)
T ss_dssp HHHHHHHHSTTTCTTHHHHHHTTTTTTCHHHHHHHHHHHHHHHHHHHSCCCC
T ss_pred hHHHHHHHHHHhChHHHHHHHHHHHhhCHHHHHHHHHCHHHHHHHHcCcccc
Confidence 9999999999999999999999999999999999999999999999998653
|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A | Back alignment and structure |
|---|
| >3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* | Back alignment and structure |
|---|
| >2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wgy_A RAP guanine nucleotide exchange factor 5; ubiquitin fold, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 | Back alignment and structure |
|---|
| >3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* | Back alignment and structure |
|---|
| >3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A | Back alignment and structure |
|---|
| >3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 | Back alignment and structure |
|---|
| >3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 203 | ||||
| d2f4mb1 | 58 | a.189.1.1 (B:275-332) XPC-binding domain of Rad23 | 5e-26 | |
| d1wgda_ | 93 | d.15.1.1 (A:) Homocysteine-responsive endoplasmic | 8e-14 | |
| d1oqya4 | 77 | d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h | 2e-12 | |
| d1uela_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol | 2e-11 | |
| d1wiaa_ | 95 | d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 | 2e-11 | |
| d1wgha_ | 116 | d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous | 3e-10 | |
| d1wjua_ | 100 | d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human | 2e-09 | |
| d1v5oa_ | 102 | d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu | 2e-08 | |
| d2bwfa1 | 73 | d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc | 3e-08 | |
| d1zkha1 | 86 | d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t | 4e-08 | |
| d1wx9a1 | 73 | d.15.1.1 (A:8-80) Large proline-rich protein BAT3 | 8e-08 | |
| d1x1ma1 | 94 | d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse | 1e-07 | |
| d1wy8a1 | 76 | d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing | 1e-07 | |
| d1v5ta_ | 90 | d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu | 1e-07 | |
| d1ttna1 | 80 | d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit | 1e-07 | |
| d2c9wb1 | 103 | d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) | 2e-07 | |
| d1se9a_ | 101 | d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal | 3e-07 | |
| d1ogwa_ | 76 | d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax | 3e-07 | |
| d1z2ma1 | 76 | d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei | 7e-07 | |
| d2faza1 | 76 | d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing | 9e-07 | |
| d1wxva1 | 81 | d.15.1.1 (A:7-87) Bag-family molecular chaperone r | 1e-06 | |
| d1bt0a_ | 73 | d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t | 2e-06 | |
| d1z2ma2 | 76 | d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot | 3e-06 | |
| d1v6ea_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol | 4e-06 | |
| d1wh3a_ | 87 | d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like | 4e-06 | |
| d2zeqa1 | 78 | d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin | 2e-05 | |
| d1wjna_ | 97 | d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse | 3e-05 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 5e-05 | |
| d1t0ya_ | 90 | d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol | 1e-04 | |
| d1x3zb1 | 57 | a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's y | 1e-04 | |
| d1v2ya_ | 105 | d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik | 2e-04 | |
| d1wx8a1 | 83 | d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul | 8e-04 | |
| d1uh6a_ | 100 | d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous | 0.001 |
| >d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: XPC-binding domain superfamily: XPC-binding domain family: XPC-binding domain domain: XPC-binding domain of Rad23 homolog B (Hhr23b) species: Human (Homo sapiens) [TaxId: 9606]
Score = 92.8 bits (231), Expect = 5e-26
Identities = 40/58 (68%), Positives = 48/58 (82%)
Query: 134 PLAFLRTQPQFQQMRTVVQQNPELLPTVLQQIGQSNPALLELISHNQEAFVRMLNEPV 191
PL FLR QPQFQQMR ++QQNP LLP +LQQIG+ NP LL+ IS +QE F++MLNEPV
Sbjct: 1 PLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPV 58
|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 57 | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.86 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.85 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.85 | |
| d2f4mb1 | 58 | XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu | 99.85 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.85 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.84 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.83 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.83 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.82 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.82 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.82 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.82 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.82 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.82 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.81 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.81 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.8 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.78 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.78 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.77 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.76 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.75 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.75 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.75 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.73 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.73 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.73 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.7 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.69 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.68 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.61 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.55 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.54 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.47 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 99.39 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.36 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.8 | |
| d1x3zb1 | 57 | Rad23 STI1 domain {Baker's yeast (Saccharomyces ce | 98.78 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 98.65 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 97.68 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.51 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 97.28 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 97.27 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 97.23 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 95.06 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 91.12 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 90.01 | |
| d1xo3a_ | 101 | C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 | 89.34 | |
| d1wgra_ | 100 | Growth factor receptor-bound protein 7, GRB-7 {Hum | 87.74 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 83.3 | |
| d1ef1a3 | 84 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 80.73 | |
| d2f4mb1 | 58 | XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu | 80.7 |
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: Ubiquitin-like domain of Rad23 homolog B (Hhr23B) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86 E-value=1e-21 Score=139.57 Aligned_cols=79 Identities=53% Similarity=0.767 Sum_probs=72.7
Q ss_pred eEEEEEeCCCCeee-ecCCCCcHHHHHHHHHhhhCCC-CCCCceEEEeCCeecCCCCCccccccCCCCEEEEEeecCCCC
Q psy4259 8 ISDITQNQWQQTVS-HLDVQEEVKQLKEKIQSEKGSE-YLAEYQKLIYAGKILSDDQALSEYNIDESKFIVVMLSKPKPT 85 (203)
Q Consensus 8 m~I~Vk~~~g~~~~-~v~~~~TV~~LK~~I~~~~~~~-ip~~~qkLi~~Gk~L~D~~tL~~~gI~~~~~i~v~~~k~~~~ 85 (203)
|+|+||+++|++|. +|++++||.+||++|+++.|.. +|+++|||||+||.|+|+++|++|||++|++|++++++++..
T Consensus 1 M~I~vk~~~g~~~~l~v~~~~TV~~lK~~i~~~~~~~~i~~~~qrLi~~Gk~L~d~~tL~~y~I~~~s~i~lv~~~~~~~ 80 (95)
T d1uela_ 1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAV 80 (95)
T ss_dssp CEEEEEETTCCEEEEECCTTSBHHHHHHHHHHHHCTTTCCTTTEEEEETTEECCTTSBGGGGTCCSSSEEEEEESSCCCC
T ss_pred CEEEEEeCCCCEEEEEECCCccHHHHHHHHHhhhcccCCCccceEEEECCeEccCCCcHHHcCCCCCCEEEEEECCCCCC
Confidence 89999999999999 9999999999999999987632 789999999999999999999999999999999999877654
Q ss_pred C
Q psy4259 86 P 86 (203)
Q Consensus 86 ~ 86 (203)
+
T Consensus 81 ~ 81 (95)
T d1uela_ 81 S 81 (95)
T ss_dssp C
T ss_pred C
Confidence 3
|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|